F346851

General Info

Members Datasets Scaffolds Average Seq Length
234 183 468 184

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100370928|Ga0070662_1003709282
Length 207
Sequence MTDLTGKKIAFAVAKEGIEQIELTSPWEAVRDAGGQPVLVSVEKGQVQAFNHFDKADTAAADATSYDGLVLPGGVGNPDALRTDADAVAFVKAFFDADKPVAAICHAPWTLINAGVVAGRTLTSWPSLRVDITNASGTWVDEGVHVCADGPNLLVTSRKPDDLPAFCQTLVQVFRATGLHRSEDAIDEAGRESFPASDPPAWNARAS

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
40 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
68 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
69 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
70 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
71 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
76 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
77 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 2527291627 Frankia casuarinae Thr Isolate Nodule
173 2527291629 Frankia sp. BMG5.23 Isolate Nodule
174 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
175 2576861822 Frankia sp. CeD Isolate Nodule
176 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
177 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
178 2684623036 Frankia sp. CgIM4 Isolate Nodule
179 2710264753 Frankia sp. KB5 Isolate Nodule
180 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
181 2773857924 Frankia sp. CgIS1 Isolate Nodule
182 2922554459 Rhodococcus sp. 66b Isolate Unclassified
183 637000116 Frankia casuarinae CcI3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.17
Metatranscriptomes 4.7
Isolates 5.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 2.99
Rhizoplane 4.7
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100370928 3300005457 Bacteria 1176
2 JGI24735J21928_10018824 3300002067 Bacteria 2127
3 rootH2_10002938 3300003320 Bacteria 50511
4 Ga0070658_10381759 3300005327 Bacteria 1209
5 Ga0070683_100072310 3300005329 Bacteria 3219
6 Ga0070683_100075636 3300005329 Bacteria 3147
7 Ga0070682_100096604 3300005337 Bacteria 1943
8 Ga0068868_100438372 3300005338 Bacteria 1134
9 Ga0070668_100078006 3300005347 Bacteria 2590
10 Ga0070674_100340661 3300005356 Bacteria 1208
11 Ga0070667_100645140 3300005367 Bacteria 977
12 Ga0070714_100001225 3300005435 Bacteria 18503
13 Ga0070713_100037215 3300005436 Bacteria 3934
14 Ga0070713_100354021 3300005436 Bacteria 1363
15 Ga0070713_100849507 3300005436 Bacteria 876
16 Ga0070701_10438191 3300005438 Bacteria 836
17 Ga0070700_100255192 3300005441 Bacteria 1260
18 Ga0070663_100352471 3300005455 Bacteria 1192
19 Ga0070678_100036601 3300005456 Bacteria 3437
20 Ga0070685_10036289 3300005466 Bacteria 2786
21 Ga0070706_100000939 3300005467 Bacteria 31876
22 Ga0070706_100410834 3300005467 Bacteria 1260
23 Ga0070707_100000166 3300005468 Bacteria 63590
24 Ga0070698_100000006 3300005471 Bacteria 129236
25 Ga0070684_100276117 3300005535 Bacteria 1539
26 Ga0070686_100330071 3300005544 Bacteria 1140
27 Ga0070664_100734200 3300005564 Bacteria 921
28 Ga0068852_100240342 3300005616 Bacteria 1730
29 Ga0068864_100829545 3300005618 Bacteria 910
30 Ga0068861_100868197 3300005719 Bacteria 852
31 Ga0075363_100026441 3300006048 Bacteria 2969
32 Ga0075364_10049589 3300006051 Bacteria 2739
33 Ga0075369_10002888 3300006186 Bacteria 6194
34 Ga0105245_10123185 3300009098 Bacteria 2424
35 Ga0114129_10634717 3300009147 Bacteria 1380
36 Ga0105243_10032607 3300009148 Bacteria 4026
37 Ga0105243_11767600 3300009148 Bacteria 649
38 Ga0163162_11615114 3300013306 Bacteria 740
39 Ga0157375_10054919 3300013308 Bacteria 3925
40 Ga0163163_10093037 3300014325 Bacteria 3031
41 Ga0163163_10974290 3300014325 Bacteria 911
42 Ga0157376_10321633 3300014969 Bacteria 1471
43 Ga0163161_10029451 3300017792 Bacteria 3904
44 Ga0206349_1310855 3300020075 Bacteria 717
45 Ga0206355_1271366 3300020076 Bacteria 767
46 Ga0206350_10033694 3300020080 Bacteria 754
47 Ga0206350_11323082 3300020080 Bacteria 790
48 Ga0154015_1320901 3300020610 Bacteria 657
49 Ga0213875_10000411 3300021388 Bacteria 37617
50 Ga0224712_10074782 3300022467 Bacteria 1384
51 Ga0224712_10117631 3300022467 Bacteria 1147
52 Ga0224712_10213423 3300022467 Bacteria 881
53 Ga0224712_10264277 3300022467 Bacteria 798
54 Ga0207688_10261304 3300025901 Bacteria 1051
55 Ga0207643_10065847 3300025908 Bacteria 2076
56 Ga0207684_10002178 3300025910 Bacteria 20052
57 Ga0207646_10000049 3300025922 Bacteria 171680
58 Ga0207700_10020660 3300025928 Bacteria 4478
59 Ga0207700_10335628 3300025928 Bacteria 1313
60 Ga0207690_10227216 3300025932 Bacteria 1431
61 Ga0207709_10031068 3300025935 Bacteria 3115
62 Ga0207669_10264261 3300025937 Bacteria 1289
63 Ga0207661_10072388 3300025944 Bacteria 2820
64 Ga0207661_10085848 3300025944 Bacteria 2610
65 Ga0207712_10444563 3300025961 Bacteria 1098
66 Ga0207658_10178681 3300025986 Bacteria 1755
67 Ga0207677_10121330 3300026023 Bacteria 1967
68 Ga0207678_10038900 3300026067 Bacteria 4130
69 Ga0207675_100096906 3300026118 Bacteria 2777
70 Ga0207675_100142575 3300026118 Bacteria 2277
71 Ga0207683_10049865 3300026121 Bacteria 3665
72 Ga0207683_10107791 3300026121 Bacteria 2492
73 Ga0268264_11341059 3300028381 Bacteria 726
74 Ga0307406_10208342 3300031901 Bacteria 1445
75 Ga0307409_100117583 3300031995 Bacteria 2244
76 Ga0307416_101563163 3300032002 Bacteria 765
77 Ga0395900_0004342 3300037418 Bacteria 15040
78 Ga0395898_0788195 3300037466 Bacteria 891
79 Ga0395901_0389041 3300038443 Bacteria 1434
80 Ga0436363_0001790 3300039450 Bacteria 4470
81 Ga0451789_1163579 3300041443 Bacteria 1599
82 Ga0451793_0313950 3300041452 Bacteria 6147
83 Ga0451797_0080835 3300041453 Bacteria 6839
84 Ga0451798_1068432 3300041458 Bacteria 933
85 Ga0451800_0750594 3300041459 Bacteria 1358
86 Ga0451802_1615408 3300041460 Bacteria 1082
87 Ga0451833_1094083 3300041491 Bacteria 1642
88 Ga0451837_1146786 3300041494 Bacteria 1634
89 Ga0451839_0996852 3300041496 Bacteria 1773
90 Ga0451841_0787463 3300041498 Bacteria 7682
91 Ga0451851_1064167 3300041507 Bacteria 964
92 Ga0451843_1467190 3300041509 Bacteria 1347
93 Ga0451853_2688018 3300041512 Bacteria 2981
94 Ga0466969_0000477 3300044656 Bacteria 21916
95 Ga0466965_0067601 3300044683 Bacteria 1794
96 Ga0466966_0000311 3300044684 Bacteria 31440
97 Ga0466966_0381625 3300044684 Bacteria 847
98 Ga0466961_0000220 3300044693 Bacteria 38742
99 Ga0466963_0089838 3300044694 Bacteria 2090
100 Ga0466963_0242846 3300044694 Bacteria 1263
101 Ga0466964_0006156 3300044706 Bacteria 4471
102 Ga0466964_0050148 3300044706 Bacteria 1711
103 Ga0466971_0000114 3300044719 Bacteria 29087
104 Ga0466968_0330860 3300044735 Bacteria 737
105 Ga0466970_0000397 3300044765 Bacteria 21154
106 Ga0466970_0041060 3300044765 Bacteria 2458
107 Ga0466970_0044998 3300044765 Bacteria 2350
108 Ga0466957_0014813 3300044842 Bacteria 4545
109 Ga0466957_0033899 3300044842 Bacteria 3063
110 Ga0466959_0005734 3300045049 Bacteria 8542
111 Ga0466959_0020633 3300045049 Bacteria 4855
112 Ga0466959_0058970 3300045049 Bacteria 2796
113 Ga0466959_0114121 3300045049 Bacteria 1926
114 Ga0466959_0242712 3300045049 Bacteria 1244
115 Ga0466959_0366831 3300045049 Bacteria 981
116 Ga0466958_0016454 3300045836 Bacteria 4259
117 Ga0466958_0016568 3300045836 Bacteria 4245
118 Ga0466958_0168877 3300045836 Bacteria 1385
119 Ga0466958_0258557 3300045836 Bacteria 1114
120 Ga0466958_0712340 3300045836 Bacteria 654
121 Ga0466958_0855088 3300045836 Bacteria 593
122 Ga0466967_0020018 3300045976 Bacteria 5397
123 Ga0466967_0113079 3300045976 Bacteria 2497
124 Ga0466967_0507970 3300045976 Bacteria 1183
125 Ga0466967_1861775 3300045976 Bacteria 599
126 Ga0495603_0039178 3300046455 Bacteria 2840
127 Ga0495603_0194725 3300046455 Bacteria 1172
128 Ga0495629_0336151 3300046459 Bacteria 1031
129 Ga0495653_0711692 3300046463 Bacteria 609
130 Ga0495580_0067411 3300046472 Bacteria 2504
131 Ga0495605_0012477 3300046474 Bacteria 4713
132 Ga0495605_0126641 3300046474 Bacteria 1154
133 Ga0495664_0084937 3300046477 Bacteria 1900
134 Ga0495585_0090985 3300046492 Bacteria 1643
135 Ga0495594_0004213 3300046499 Bacteria 7383
136 Ga0495596_0032512 3300046500 Bacteria 2079
137 Ga0495607_0059893 3300046501 Bacteria 2169
138 Ga0495583_0040810 3300046506 Bacteria 2177
139 Ga0495583_0124640 3300046506 Bacteria 1081
140 Ga0495606_0019397 3300046507 Bacteria 5061
141 Ga0495610_0049431 3300046512 Bacteria 2059
142 Ga0495616_0011681 3300046513 Bacteria 5021
143 Ga0495618_0266080 3300046514 Bacteria 1072
144 Ga0495620_0005901 3300046515 Bacteria 6792
145 Ga0495620_0019983 3300046515 Bacteria 3279
146 Ga0495628_0172558 3300046516 Bacteria 1639
147 Ga0495631_0009589 3300046518 Bacteria 4830
148 Ga0495637_0116837 3300046520 Bacteria 1030
149 Ga0495643_0005855 3300046522 Bacteria 8222
150 Ga0495648_0090694 3300046524 Bacteria 1712
151 Ga0495666_0022626 3300046526 Bacteria 3112
152 Ga0495640_0045927 3300046533 Bacteria 3029
153 Ga0495609_0082729 3300046538 Bacteria 1402
154 Ga0495597_0020730 3300046542 Bacteria 3059
155 Ga0495597_0149224 3300046542 Bacteria 960
156 Ga0495622_0101341 3300046557 Bacteria 1319
157 Ga0495633_0098303 3300046558 Bacteria 1359
158 Ga0495668_0021649 3300046616 Bacteria 3683
159 Ga0495668_0101648 3300046616 Bacteria 1572
160 Ga0495634_0270496 3300046642 Bacteria 1034
161 Ga0495611_0045585 3300046648 Bacteria 1964
162 Ga0495611_0217041 3300046648 Bacteria 890
163 Ga0495625_0039925 3300046660 Bacteria 3425
164 Ga0495635_0227291 3300046663 Bacteria 1261
165 Ga0495661_0338683 3300046665 Bacteria 743
166 Ga0495657_0023536 3300046675 Bacteria 4399
167 Ga0495613_0012076 3300046689 Bacteria 6420
168 Ga0495613_0156963 3300046689 Bacteria 1620
169 Ga0495624_0048355 3300046690 Bacteria 2700
170 Ga0495624_0134044 3300046690 Bacteria 1518
171 Ga0495671_0025077 3300046692 Bacteria 3102
172 Ga0495649_0052479 3300046694 Bacteria 2209
173 Ga0495600_0123770 3300046809 Bacteria 1682
174 Ga0495660_0029283 3300046810 Bacteria 3108
175 Ga0495581_0265364 3300047315 Bacteria 1004
176 Ga0495604_0034654 3300047317 Bacteria 3993
177 Ga0495683_0028261 3300047323 Bacteria 2867
178 Ga0495687_058970 3300047443 Bacteria 1590
179 Ga0495687_073584 3300047443 Bacteria 1361
180 Ga0495687_092706 3300047443 Bacteria 1152
181 Ga0495677_0027458 3300047445 Bacteria 2066
182 Ga0495685_020109 3300047447 Bacteria 2293
183 Ga0495685_062444 3300047447 Bacteria 1254
184 Ga0495686_0041276 3300047472 Bacteria 2938
185 Ga0495593_0145944 3300047673 Bacteria 1197
186 Ga0495614_0039012 3300048089 Bacteria 2038
187 Ga0495614_0070767 3300048089 Bacteria 1503
188 Ga0495626_0138547 3300048091 Bacteria 1033
189 Ga0496105_0787172 3300048908 Bacteria 724
190 Ga0496109_0081543 3300048912 Bacteria 2981
191 Ga0496110_0093368 3300048913 Bacteria 2694
192 Ga0496110_0211806 3300048913 Bacteria 1762
193 Ga0496125_0002084 3300048928 Bacteria 26951
194 Ga0496126_0239315 3300048929 Bacteria 1517
195 Ga0495678_020176 3300049459 Bacteria 2957
196 Ga0495682_0111979 3300049460 Bacteria 978
197 Ga0501037_0300352 3300049573 Bacteria 1115
198 Ga0501038_0029065 3300049574 Bacteria 4902
199 Ga0501039_0130714 3300049575 Bacteria 1970
200 Ga0501042_0027877 3300049578 Bacteria 3974
201 Ga0501043_0187085 3300049579 Bacteria 1612
202 Ga0501043_0785387 3300049579 Bacteria 690
203 Ga0501047_0000098 3300049581 Bacteria 106464
204 Ga0501048_0123687 3300049582 Bacteria 1829
205 Ga0501068_0239326 3300049584 Bacteria 1155
206 Ga0501069_0138995 3300049585 Bacteria 1393
207 Ga0501070_1070649 3300049586 Bacteria 623
208 Ga0501074_0041940 3300049590 Bacteria 3312
209 Ga0501083_0116958 3300049744 Bacteria 1750
210 Ga0501035_0353109 3300049822 Bacteria 1230
211 Ga0501035_0614096 3300049822 Bacteria 885
212 nmdc:mga00v17_162743_c1 3300050491 Bacteria 1437
213 nmdc:mga05p37_140345_c1 3300050507 Bacteria 2961
214 nmdc:mga0n895_99485_c1 3300050512 Bacteria 2916
215 nmdc:mga0sz30_9641_c1 3300050516 Bacteria 3680
216 Ga0500583_0104430 3300053092 Bacteria 1390
217 Ga0501084_0501171 3300054114 Bacteria 1026
218 Ga0587066_091989 3300059490 Bacteria 675
219 Ga0587083_0114731 3300059505 Bacteria 689
220 Ga0466962_0001423 3300061719 Bacteria 11137
221 Ga0466962_0067056 3300061719 Bacteria 1713
222 Ga0466962_0161954 3300061719 Bacteria 1087
223 2528203895 2527291627 Bacteria 5309833
224 2528215701 2527291629 Bacteria 5267418
225 2546949387 2546825537 Bacteria 5389291
226 2579747139 2576861822 Bacteria 5004595
227 2644013774 2643221601 Bacteria 7493239
228 2644178597 2643221631 Bacteria 8168043
229 2686542763 2684623036 Bacteria 5199090
230 2710606431 2710264753 Bacteria 5455564
231 2753269602 2751185782 Bacteria 11227053
232 2774865142 2773857924 Bacteria 5256821
233 2922556402 2922554459 Bacteria 6683962
234 637878285 637000116 Bacteria 5433628
235 Ga0070662_100370928
236 JGI24735J21928_10018824
237 rootH2_10002938
238 Ga0070658_10381759
239 Ga0070683_100072310
240 Ga0070683_100075636
241 Ga0070682_100096604
242 Ga0068868_100438372
243 Ga0070668_100078006
244 Ga0070674_100340661
245 Ga0070667_100645140
246 Ga0070714_100001225
247 Ga0070713_100037215
248 Ga0070713_100354021
249 Ga0070713_100849507
250 Ga0070701_10438191
251 Ga0070700_100255192
252 Ga0070663_100352471
253 Ga0070678_100036601
254 Ga0070685_10036289
255 Ga0070706_100000939
256 Ga0070706_100410834
257 Ga0070707_100000166
258 Ga0070698_100000006
259 Ga0070684_100276117
260 Ga0070686_100330071
261 Ga0070664_100734200
262 Ga0068852_100240342
263 Ga0068864_100829545
264 Ga0068861_100868197
265 Ga0075363_100026441
266 Ga0075364_10049589
267 Ga0075369_10002888
268 Ga0105245_10123185
269 Ga0114129_10634717
270 Ga0105243_10032607
271 Ga0105243_11767600
272 Ga0163162_11615114
273 Ga0157375_10054919
274 Ga0163163_10093037
275 Ga0163163_10974290
276 Ga0157376_10321633
277 Ga0163161_10029451
278 Ga0206349_1310855
279 Ga0206355_1271366
280 Ga0206350_10033694
281 Ga0206350_11323082
282 Ga0154015_1320901
283 Ga0213875_10000411
284 Ga0224712_10074782
285 Ga0224712_10117631
286 Ga0224712_10213423
287 Ga0224712_10264277
288 Ga0207688_10261304
289 Ga0207643_10065847
290 Ga0207684_10002178
291 Ga0207646_10000049
292 Ga0207700_10020660
293 Ga0207700_10335628
294 Ga0207690_10227216
295 Ga0207709_10031068
296 Ga0207669_10264261
297 Ga0207661_10072388
298 Ga0207661_10085848
299 Ga0207712_10444563
300 Ga0207658_10178681
301 Ga0207677_10121330
302 Ga0207678_10038900
303 Ga0207675_100096906
304 Ga0207675_100142575
305 Ga0207683_10049865
306 Ga0207683_10107791
307 Ga0268264_11341059
308 Ga0307406_10208342
309 Ga0307409_100117583
310 Ga0307416_101563163
311 Ga0395900_0004342
312 Ga0395898_0788195
313 Ga0395901_0389041
314 Ga0436363_0001790
315 Ga0451789_1163579
316 Ga0451793_0313950
317 Ga0451797_0080835
318 Ga0451798_1068432
319 Ga0451800_0750594
320 Ga0451802_1615408
321 Ga0451833_1094083
322 Ga0451837_1146786
323 Ga0451839_0996852
324 Ga0451841_0787463
325 Ga0451851_1064167
326 Ga0451843_1467190
327 Ga0451853_2688018
328 Ga0466969_0000477
329 Ga0466965_0067601
330 Ga0466966_0000311
331 Ga0466966_0381625
332 Ga0466961_0000220
333 Ga0466963_0089838
334 Ga0466963_0242846
335 Ga0466964_0006156
336 Ga0466964_0050148
337 Ga0466971_0000114
338 Ga0466968_0330860
339 Ga0466970_0000397
340 Ga0466970_0041060
341 Ga0466970_0044998
342 Ga0466957_0014813
343 Ga0466957_0033899
344 Ga0466959_0005734
345 Ga0466959_0020633
346 Ga0466959_0058970
347 Ga0466959_0114121
348 Ga0466959_0242712
349 Ga0466959_0366831
350 Ga0466958_0016454
351 Ga0466958_0016568
352 Ga0466958_0168877
353 Ga0466958_0258557
354 Ga0466958_0712340
355 Ga0466958_0855088
356 Ga0466967_0020018
357 Ga0466967_0113079
358 Ga0466967_0507970
359 Ga0466967_1861775
360 Ga0495603_0039178
361 Ga0495603_0194725
362 Ga0495629_0336151
363 Ga0495653_0711692
364 Ga0495580_0067411
365 Ga0495605_0012477
366 Ga0495605_0126641
367 Ga0495664_0084937
368 Ga0495585_0090985
369 Ga0495594_0004213
370 Ga0495596_0032512
371 Ga0495607_0059893
372 Ga0495583_0040810
373 Ga0495583_0124640
374 Ga0495606_0019397
375 Ga0495610_0049431
376 Ga0495616_0011681
377 Ga0495618_0266080
378 Ga0495620_0005901
379 Ga0495620_0019983
380 Ga0495628_0172558
381 Ga0495631_0009589
382 Ga0495637_0116837
383 Ga0495643_0005855
384 Ga0495648_0090694
385 Ga0495666_0022626
386 Ga0495640_0045927
387 Ga0495609_0082729
388 Ga0495597_0020730
389 Ga0495597_0149224
390 Ga0495622_0101341
391 Ga0495633_0098303
392 Ga0495668_0021649
393 Ga0495668_0101648
394 Ga0495634_0270496
395 Ga0495611_0045585
396 Ga0495611_0217041
397 Ga0495625_0039925
398 Ga0495635_0227291
399 Ga0495661_0338683
400 Ga0495657_0023536
401 Ga0495613_0012076
402 Ga0495613_0156963
403 Ga0495624_0048355
404 Ga0495624_0134044
405 Ga0495671_0025077
406 Ga0495649_0052479
407 Ga0495600_0123770
408 Ga0495660_0029283
409 Ga0495581_0265364
410 Ga0495604_0034654
411 Ga0495683_0028261
412 Ga0495687_058970
413 Ga0495687_073584
414 Ga0495687_092706
415 Ga0495677_0027458
416 Ga0495685_020109
417 Ga0495685_062444
418 Ga0495686_0041276
419 Ga0495593_0145944
420 Ga0495614_0039012
421 Ga0495614_0070767
422 Ga0495626_0138547
423 Ga0496105_0787172
424 Ga0496109_0081543
425 Ga0496110_0093368
426 Ga0496110_0211806
427 Ga0496125_0002084
428 Ga0496126_0239315
429 Ga0495678_020176
430 Ga0495682_0111979
431 Ga0501037_0300352
432 Ga0501038_0029065
433 Ga0501039_0130714
434 Ga0501042_0027877
435 Ga0501043_0187085
436 Ga0501043_0785387
437 Ga0501047_0000098
438 Ga0501048_0123687
439 Ga0501068_0239326
440 Ga0501069_0138995
441 Ga0501070_1070649
442 Ga0501074_0041940
443 Ga0501083_0116958
444 Ga0501035_0353109
445 Ga0501035_0614096
446 nmdc:mga00v17_162743_c1
447 nmdc:mga05p37_140345_c1
448 nmdc:mga0n895_99485_c1
449 nmdc:mga0sz30_9641_c1
450 Ga0500583_0104430
451 Ga0501084_0501171
452 Ga0587066_091989
453 Ga0587083_0114731
454 Ga0466962_0001423
455 Ga0466962_0067056
456 Ga0466962_0161954
457 2528203895
458 2528215701
459 2546949387
460 2579747139
461 2644013774
462 2644178597
463 2686542763
464 2710606431
465 2753269602
466 2774865142
467 2922556402
468 637878285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

7

173

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9811 5 186
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9463 7 181
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9463 9 182
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9416 9 181
1oi4-assembly1.cif.gz_B crystal structure of yhbo from escherichia coli 0.9394 5 183
ID Description Score Start End Superfamily
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9791 5 186 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.937 9 181 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.932 5 186 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9318 5 186 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9295 8 182 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A3A3YXD2-F1-model_v4 Type 1 glutamine amidotransferase 0.9971 5 186 GO:0016740
AF-A0A2N8PBM3-F1-model_v4 Glutamine amidotransferase 0.996 9 184 GO:0016740
AF-A0A640TCI4-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9954 7 184
AF-A0A542U8F0-F1-model_v4 PfpI family intracellular protease 0.9954 8 185 GO:0006508
GO:0008233
AF-L7L7Q3-F1-model_v4 Peptidase C56 family protein 0.9953 8 185

Map