F346801

General Info

Members Datasets Scaffolds Average Seq Length
234 152 468 101

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100147735|Ga0070675_1001477354
Length 111
Sequence MPPAGPPAEAKDMTIKFTPNDKGNPPGKLADAELHFSGGPLDGLKLVGFAVWERKTGGRNVTFPARQYSVNGERRSFSLLRPIVDSKSQDKLRDLVLDAYKEHEAELAEAS

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 98.72
Stem 0
Stem Tuber 0
Unclassified 31.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100147735 3300005354 Bacteria 2014
2 Ga0065707_10113163 3300005295 Bacteria 2336
3 Ga0070676_11160446 3300005328 Bacteria 586
4 Ga0070683_100655629 3300005329 Bacteria 1005
5 Ga0070690_100335348 3300005330 Unclassified 1094
6 Ga0070670_101047442 3300005331 Bacteria 743
7 Ga0070666_10693031 3300005335 Bacteria 747
8 Ga0070680_101919308 3300005336 Unclassified 513
9 Ga0068868_101138592 3300005338 Bacteria 719
10 Ga0070689_100042237 3300005340 Bacteria 3501
11 Ga0070689_100071451 3300005340 Bacteria 2711
12 Ga0070691_11074535 3300005341 Bacteria 506
13 Ga0070668_100095115 3300005347 Unclassified 2353
14 Ga0070668_101743321 3300005347 Unclassified 572
15 Ga0070669_100665116 3300005353 Unclassified 877
16 Ga0070675_100669299 3300005354 Bacteria 944
17 Ga0070675_100728292 3300005354 Unclassified 904
18 Ga0070675_101623895 3300005354 Bacteria 596
19 Ga0070673_101579946 3300005364 Unclassified 619
20 Ga0070673_102272838 3300005364 Unclassified 515
21 Ga0070688_100062181 3300005365 Unclassified 2363
22 Ga0070667_100043766 3300005367 Bacteria 3759
23 Ga0070701_10343441 3300005438 Unclassified 930
24 Ga0070705_101231862 3300005440 Bacteria 618
25 Ga0070662_101878290 3300005457 Unclassified 517
26 Ga0068867_100815499 3300005459 Bacteria 833
27 Ga0070698_100246062 3300005471 Bacteria 1721
28 Ga0070698_101277430 3300005471 Unclassified 684
29 Ga0070699_100090298 3300005518 Bacteria 2678
30 Ga0070672_100926500 3300005543 Bacteria 770
31 Ga0070686_100959431 3300005544 Unclassified 699
32 Ga0068859_100018072 3300005617 Bacteria 7085
33 Ga0068864_102081439 3300005618 Unclassified 574
34 Ga0068861_100069186 3300005719 Unclassified 2730
35 Ga0068861_101551956 3300005719 Bacteria 651
36 Ga0068863_100916274 3300005841 Unclassified 877
37 Ga0068863_102185723 3300005841 Unclassified 563
38 Ga0068858_101756376 3300005842 Unclassified 613
39 Ga0068860_100165565 3300005843 Unclassified 2134
40 Ga0081455_10414624 3300005937 Unclassified 930
41 Ga0070716_101738663 3300006173 Bacteria 515
42 Ga0097621_102108531 3300006237 Bacteria 539
43 Ga0068871_100394162 3300006358 Unclassified 1232
44 Ga0075428_100076754 3300006844 Bacteria 3648
45 Ga0075428_100142593 3300006844 Bacteria 2605
46 Ga0075430_101189312 3300006846 Unclassified 628
47 Ga0075433_10124537 3300006852 Bacteria 2289
48 Ga0075433_10867866 3300006852 Bacteria 787
49 Ga0075433_11132542 3300006852 Unclassified 680
50 Ga0075434_100536435 3300006871 Bacteria 1190
51 Ga0075429_101264000 3300006880 Bacteria 644
52 Ga0075429_101839608 3300006880 Unclassified 525
53 Ga0068865_100267389 3300006881 Bacteria 1356
54 Ga0075436_100060664 3300006914 Bacteria 2613
55 Ga0097620_100018072 3300006931 Bacteria 7085
56 Ga0097620_101875816 3300006931 Bacteria 662
57 Ga0075435_100529439 3300007076 Bacteria 1020
58 Ga0111539_10000602 3300009094 Bacteria 46554
59 Ga0111539_10006519 3300009094 Bacteria 15037
60 Ga0111539_10326663 3300009094 Bacteria 1785
61 Ga0105245_10454184 3300009098 Bacteria 1290
62 Ga0105245_11804435 3300009098 Bacteria 664
63 Ga0105247_10089418 3300009101 Bacteria 1953
64 Ga0114129_10000047 3300009147 Bacteria 104957
65 Ga0114129_10121396 3300009147 Unclassified 3596
66 Ga0114129_11108376 3300009147 Unclassified 991
67 Ga0114129_12440966 3300009147 Unclassified 626
68 Ga0114129_13007340 3300009147 Unclassified 554
69 Ga0105243_10575804 3300009148 Bacteria 1080
70 Ga0105243_10709705 3300009148 Bacteria 981
71 Ga0105248_11708275 3300009177 Bacteria 714
72 Ga0105249_11037122 3300009553 Bacteria 889
73 Ga0157378_12973790 3300013297 Bacteria 526
74 Ga0157375_11077951 3300013308 Unclassified 940
75 Ga0157375_13640514 3300013308 Unclassified 512
76 Ga0157380_10032259 3300014326 Bacteria 4028
77 Ga0157380_10101838 3300014326 Bacteria 2394
78 Ga0157380_11838921 3300014326 Bacteria 665
79 Ga0157376_10102836 3300014969 Bacteria 2500
80 Ga0157376_10375061 3300014969 Bacteria 1369
81 Ga0163161_10457654 3300017792 Unclassified 1032
82 Ga0207699_11261513 3300025906 Bacteria 547
83 Ga0207643_10165817 3300025908 Bacteria 1331
84 Ga0207650_10637639 3300025925 Bacteria 898
85 Ga0207686_10622147 3300025934 Unclassified 852
86 Ga0207709_11324684 3300025935 Bacteria 595
87 Ga0207670_10195419 3300025936 Unclassified 1533
88 Ga0207670_10258265 3300025936 Bacteria 1349
89 Ga0207670_10717301 3300025936 Bacteria 829
90 Ga0207704_10698170 3300025938 Unclassified 840
91 Ga0207691_11247494 3300025940 Bacteria 615
92 Ga0207711_10029530 3300025941 Bacteria 4626
93 Ga0207651_11861807 3300025960 Unclassified 541
94 Ga0207668_10098448 3300025972 Unclassified 2167
95 Ga0207658_10046117 3300025986 Unclassified 3181
96 Ga0207703_10170959 3300026035 Unclassified 1911
97 Ga0207708_10880322 3300026075 Bacteria 774
98 Ga0207641_11532343 3300026088 Unclassified 668
99 Ga0207675_100126132 3300026118 Unclassified 2424
100 Ga0207675_101397754 3300026118 Bacteria 721
101 Ga0207675_101543612 3300026118 Bacteria 685
102 Ga0207675_102127250 3300026118 Unclassified 577
103 Ga0209970_1113697 3300027614 Unclassified 522
104 Ga0207428_10001302 3300027907 Bacteria 26596
105 Ga0207428_10014988 3300027907 Bacteria 6717
106 Ga0207428_10017205 3300027907 Bacteria 6209
107 Ga0268266_11435577 3300028379 Unclassified 666
108 Ga0268265_11593900 3300028380 Unclassified 658
109 Ga0268264_10147291 3300028381 Unclassified 2107
110 Ga0307408_100385401 3300031548 Bacteria 1199
111 Ga0307412_10107710 3300031911 Bacteria 1984
112 Ga0307412_10871173 3300031911 Bacteria 787
113 Ga0307416_100462628 3300032002 Bacteria 1324
114 Ga0307416_100708337 3300032002 Bacteria 1096
115 Ga0307414_10078492 3300032004 Bacteria 2407
116 Ga0307411_11049794 3300032005 Bacteria 732
117 Ga0307415_100986219 3300032126 Unclassified 782
118 Ga0307415_101960333 3300032126 Unclassified 570
119 Ga0373945_0373122 3300035116 Unclassified 622
120 Ga0373924_0110126 3300035410 Bacteria 1190
121 Ga0373933_0387635 3300035724 Bacteria 910
122 Ga0373947_0839423 3300035725 Unclassified 627
123 Ga0373937_0984412 3300036401 Bacteria 792
124 Ga0436365_1562309 3300039437 Unclassified 515
125 Ga0451845_0032397 3300041501 Bacteria 601
126 Ga0439455_0172526 3300042012 Unclassified 621
127 Ga0439435_0209877 3300042436 Bacteria 645
128 Ga0439460_0094393 3300042461 Unclassified 954
129 Ga0451576_0998628 3300045051 Bacteria 877
130 Ga0495592_0017993 3300046454 Bacteria 5368
131 Ga0495592_0217027 3300046454 Unclassified 1281
132 Ga0495603_0680437 3300046455 Bacteria 588
133 Ga0495629_0773548 3300046459 Bacteria 634
134 Ga0495651_0659938 3300046462 Bacteria 655
135 Ga0495653_0084693 3300046463 Bacteria 2334
136 Ga0495594_0391213 3300046499 Bacteria 791
137 Ga0495628_0000403 3300046516 Bacteria 39673
138 Ga0495666_0002251 3300046526 Bacteria 9605
139 Ga0495635_0460493 3300046663 Unclassified 840
140 Ga0495647_0010263 3300046681 Viruses 3188
141 Ga0495670_0765750 3300046691 Bacteria 527
142 Ga0495674_1085743 3300047319 Bacteria 610
143 Ga0495684_0703271 3300047471 Bacteria 670
144 Ga0496110_0155304 3300048913 Unclassified 2073
145 Ga0501031_0013710 3300049568 Bacteria 5282
146 Ga0501032_0217661 3300049569 Bacteria 1243
147 Ga0501032_0347516 3300049569 Unclassified 956
148 Ga0501033_0027621 3300049570 Bacteria 4266
149 Ga0501033_0509605 3300049570 Bacteria 832
150 Ga0501034_0023006 3300049571 Bacteria 6350
151 Ga0501034_1301501 3300049571 Unclassified 604
152 Ga0501036_0008804 3300049572 Bacteria 8284
153 Ga0501037_0001648 3300049573 Bacteria 16237
154 Ga0501037_0713946 3300049573 Bacteria 666
155 Ga0501038_0013770 3300049574 Bacteria 7370
156 Ga0501038_0191004 3300049574 Bacteria 1648
157 Ga0501039_0025527 3300049575 Bacteria 4540
158 Ga0501040_0064139 3300049576 Unclassified 2529
159 Ga0501041_0756794 3300049577 Bacteria 622
160 Ga0501042_0003549 3300049578 Bacteria 9818
161 Ga0501042_0411198 3300049578 Bacteria 980
162 Ga0501042_0608769 3300049578 Bacteria 794
163 Ga0501043_0039477 3300049579 Bacteria 3709
164 Ga0501043_0360138 3300049579 Bacteria 1104
165 Ga0501046_0000887 3300049580 Bacteria 29123
166 Ga0501047_0014503 3300049581 Bacteria 7494
167 Ga0501047_0345263 3300049581 Bacteria 1326
168 Ga0501047_1069546 3300049581 Unclassified 620
169 Ga0501048_0009483 3300049582 Bacteria 7307
170 Ga0501067_0009767 3300049583 Bacteria 5311
171 Ga0501068_0009510 3300049584 Bacteria 5444
172 Ga0501069_0001461 3300049585 Bacteria 11617
173 Ga0501070_0015073 3300049586 Bacteria 6505
174 Ga0501070_0446384 3300049586 Bacteria 1043
175 Ga0501071_0076320 3300049587 Bacteria 2447
176 Ga0501071_1202456 3300049587 Bacteria 586
177 Ga0501072_0113412 3300049588 Bacteria 2158
178 Ga0501072_0306162 3300049588 Bacteria 1263
179 Ga0501073_0043715 3300049589 Bacteria 3158
180 Ga0501074_0016520 3300049590 Bacteria 5357
181 Ga0501074_0042604 3300049590 Bacteria 3285
182 Ga0501075_0041313 3300049591 Bacteria 3456
183 Ga0501075_0111697 3300049591 Unclassified 2078
184 Ga0501076_0061721 3300049592 Bacteria 2983
185 Ga0501076_0441291 3300049592 Bacteria 1071
186 Ga0501076_0498805 3300049592 Bacteria 1003
187 Ga0501079_0008610 3300049741 Bacteria 7743
188 Ga0501079_0615099 3300049741 Unclassified 855
189 Ga0501080_0023045 3300049742 Bacteria 5773
190 Ga0501080_0558360 3300049742 Plasmid 1019
191 Ga0501080_1267448 3300049742 Unclassified 632
192 Ga0501081_0035281 3300049743 Bacteria 3405
193 Ga0501081_0089292 3300049743 Bacteria 2166
194 Ga0501081_0494718 3300049743 Bacteria 911
195 Ga0501083_0176800 3300049744 Bacteria 1394
196 Ga0501035_0019083 3300049822 Bacteria 6311
197 Ga0501035_0119576 3300049822 Bacteria 2304
198 Ga0501035_1386879 3300049822 Unclassified 539
199 Ga0501035_1461614 3300049822 Bacteria 522
200 Ga0501044_0060535 3300049823 Bacteria 3876
201 Ga0501045_0005367 3300049824 Bacteria 8881
202 Ga0501045_0072650 3300049824 Unclassified 2533
203 Ga0501045_0838524 3300049824 Unclassified 676
204 nmdc:mga05p37_1707541_c1 3300050507 Unclassified 613
205 nmdc:mga05p37_180_c1 3300050507 Bacteria 61836
206 nmdc:mga05p37_23383_c2 3300050507 Viruses 1797
207 nmdc:mga09592_322903_c1 3300050508 Bacteria 1337
208 nmdc:mga09592_454022_c1 3300050508 Unclassified 1105
209 nmdc:mga09592_45712_c1 3300050508 Bacteria 3688
210 nmdc:mga0qj67_335931_c1 3300050509 Bacteria 1222
211 nmdc:mga06r32_234675_c1 3300050510 Bacteria 1822
212 nmdc:mga08y16_156642_c1 3300050511 Bacteria 2367
213 nmdc:mga08y16_181025_c1 3300050511 Bacteria 2189
214 nmdc:mga08y16_1978590_c1 3300050511 Unclassified 532
215 nmdc:mga08y16_25349_c1 3300050511 Bacteria 6253
216 nmdc:mga08y16_351_c1 3300050511 Bacteria 41528
217 nmdc:mga0n895_2050040_c1 3300050512 Bacteria 529
218 nmdc:mga0rr50_233260_c1 3300050513 Bacteria 1523
219 nmdc:mga0rr50_646466_c1 3300050513 Unclassified 902
220 nmdc:mga0a205_121782_c1 3300050515 Bacteria 2508
221 nmdc:mga0a205_1283701_c1 3300050515 Unclassified 580
222 nmdc:mga0a205_31821_c1 3300050515 Bacteria 5057
223 nmdc:mga0a205_93950_c1 3300050515 Bacteria 2897
224 nmdc:mga0a205_944783_c1 3300050515 Unclassified 709
225 Ga0495601_0020167 3300053077 Bacteria 4070
226 Ga0495601_0129558 3300053077 Unclassified 1643
227 Ga0495601_0254698 3300053077 Bacteria 1146
228 Ga0495619_0108260 3300053085 Unclassified 1897
229 Ga0501084_0044940 3300054114 Bacteria 3698
230 Ga0501084_0871119 3300054114 Bacteria 758
231 Ga0501084_0977462 3300054114 Unclassified 712
232 Ga0501082_0012400 3300060353 Bacteria 7325
233 Ga0501082_0139887 3300060353 Bacteria 2101
234 Ga0530510_0016229 3300061734 Bacteria 5267
235 Ga0070675_100147735
236 Ga0065707_10113163
237 Ga0070676_11160446
238 Ga0070683_100655629
239 Ga0070690_100335348
240 Ga0070670_101047442
241 Ga0070666_10693031
242 Ga0070680_101919308
243 Ga0068868_101138592
244 Ga0070689_100042237
245 Ga0070689_100071451
246 Ga0070691_11074535
247 Ga0070668_100095115
248 Ga0070668_101743321
249 Ga0070669_100665116
250 Ga0070675_100669299
251 Ga0070675_100728292
252 Ga0070675_101623895
253 Ga0070673_101579946
254 Ga0070673_102272838
255 Ga0070688_100062181
256 Ga0070667_100043766
257 Ga0070701_10343441
258 Ga0070705_101231862
259 Ga0070662_101878290
260 Ga0068867_100815499
261 Ga0070698_100246062
262 Ga0070698_101277430
263 Ga0070699_100090298
264 Ga0070672_100926500
265 Ga0070686_100959431
266 Ga0068859_100018072
267 Ga0068864_102081439
268 Ga0068861_100069186
269 Ga0068861_101551956
270 Ga0068863_100916274
271 Ga0068863_102185723
272 Ga0068858_101756376
273 Ga0068860_100165565
274 Ga0081455_10414624
275 Ga0070716_101738663
276 Ga0097621_102108531
277 Ga0068871_100394162
278 Ga0075428_100076754
279 Ga0075428_100142593
280 Ga0075430_101189312
281 Ga0075433_10124537
282 Ga0075433_10867866
283 Ga0075433_11132542
284 Ga0075434_100536435
285 Ga0075429_101264000
286 Ga0075429_101839608
287 Ga0068865_100267389
288 Ga0075436_100060664
289 Ga0097620_100018072
290 Ga0097620_101875816
291 Ga0075435_100529439
292 Ga0111539_10000602
293 Ga0111539_10006519
294 Ga0111539_10326663
295 Ga0105245_10454184
296 Ga0105245_11804435
297 Ga0105247_10089418
298 Ga0114129_10000047
299 Ga0114129_10121396
300 Ga0114129_11108376
301 Ga0114129_12440966
302 Ga0114129_13007340
303 Ga0105243_10575804
304 Ga0105243_10709705
305 Ga0105248_11708275
306 Ga0105249_11037122
307 Ga0157378_12973790
308 Ga0157375_11077951
309 Ga0157375_13640514
310 Ga0157380_10032259
311 Ga0157380_10101838
312 Ga0157380_11838921
313 Ga0157376_10102836
314 Ga0157376_10375061
315 Ga0163161_10457654
316 Ga0207699_11261513
317 Ga0207643_10165817
318 Ga0207650_10637639
319 Ga0207686_10622147
320 Ga0207709_11324684
321 Ga0207670_10195419
322 Ga0207670_10258265
323 Ga0207670_10717301
324 Ga0207704_10698170
325 Ga0207691_11247494
326 Ga0207711_10029530
327 Ga0207651_11861807
328 Ga0207668_10098448
329 Ga0207658_10046117
330 Ga0207703_10170959
331 Ga0207708_10880322
332 Ga0207641_11532343
333 Ga0207675_100126132
334 Ga0207675_101397754
335 Ga0207675_101543612
336 Ga0207675_102127250
337 Ga0209970_1113697
338 Ga0207428_10001302
339 Ga0207428_10014988
340 Ga0207428_10017205
341 Ga0268266_11435577
342 Ga0268265_11593900
343 Ga0268264_10147291
344 Ga0307408_100385401
345 Ga0307412_10107710
346 Ga0307412_10871173
347 Ga0307416_100462628
348 Ga0307416_100708337
349 Ga0307414_10078492
350 Ga0307411_11049794
351 Ga0307415_100986219
352 Ga0307415_101960333
353 Ga0373945_0373122
354 Ga0373924_0110126
355 Ga0373933_0387635
356 Ga0373947_0839423
357 Ga0373937_0984412
358 Ga0436365_1562309
359 Ga0451845_0032397
360 Ga0439455_0172526
361 Ga0439435_0209877
362 Ga0439460_0094393
363 Ga0451576_0998628
364 Ga0495592_0017993
365 Ga0495592_0217027
366 Ga0495603_0680437
367 Ga0495629_0773548
368 Ga0495651_0659938
369 Ga0495653_0084693
370 Ga0495594_0391213
371 Ga0495628_0000403
372 Ga0495666_0002251
373 Ga0495635_0460493
374 Ga0495647_0010263
375 Ga0495670_0765750
376 Ga0495674_1085743
377 Ga0495684_0703271
378 Ga0496110_0155304
379 Ga0501031_0013710
380 Ga0501032_0217661
381 Ga0501032_0347516
382 Ga0501033_0027621
383 Ga0501033_0509605
384 Ga0501034_0023006
385 Ga0501034_1301501
386 Ga0501036_0008804
387 Ga0501037_0001648
388 Ga0501037_0713946
389 Ga0501038_0013770
390 Ga0501038_0191004
391 Ga0501039_0025527
392 Ga0501040_0064139
393 Ga0501041_0756794
394 Ga0501042_0003549
395 Ga0501042_0411198
396 Ga0501042_0608769
397 Ga0501043_0039477
398 Ga0501043_0360138
399 Ga0501046_0000887
400 Ga0501047_0014503
401 Ga0501047_0345263
402 Ga0501047_1069546
403 Ga0501048_0009483
404 Ga0501067_0009767
405 Ga0501068_0009510
406 Ga0501069_0001461
407 Ga0501070_0015073
408 Ga0501070_0446384
409 Ga0501071_0076320
410 Ga0501071_1202456
411 Ga0501072_0113412
412 Ga0501072_0306162
413 Ga0501073_0043715
414 Ga0501074_0016520
415 Ga0501074_0042604
416 Ga0501075_0041313
417 Ga0501075_0111697
418 Ga0501076_0061721
419 Ga0501076_0441291
420 Ga0501076_0498805
421 Ga0501079_0008610
422 Ga0501079_0615099
423 Ga0501080_0023045
424 Ga0501080_0558360
425 Ga0501080_1267448
426 Ga0501081_0035281
427 Ga0501081_0089292
428 Ga0501081_0494718
429 Ga0501083_0176800
430 Ga0501035_0019083
431 Ga0501035_0119576
432 Ga0501035_1386879
433 Ga0501035_1461614
434 Ga0501044_0060535
435 Ga0501045_0005367
436 Ga0501045_0072650
437 Ga0501045_0838524
438 nmdc:mga05p37_1707541_c1
439 nmdc:mga05p37_180_c1
440 nmdc:mga05p37_23383_c2
441 nmdc:mga09592_322903_c1
442 nmdc:mga09592_454022_c1
443 nmdc:mga09592_45712_c1
444 nmdc:mga0qj67_335931_c1
445 nmdc:mga06r32_234675_c1
446 nmdc:mga08y16_156642_c1
447 nmdc:mga08y16_181025_c1
448 nmdc:mga08y16_1978590_c1
449 nmdc:mga08y16_25349_c1
450 nmdc:mga08y16_351_c1
451 nmdc:mga0n895_2050040_c1
452 nmdc:mga0rr50_233260_c1
453 nmdc:mga0rr50_646466_c1
454 nmdc:mga0a205_121782_c1
455 nmdc:mga0a205_1283701_c1
456 nmdc:mga0a205_31821_c1
457 nmdc:mga0a205_93950_c1
458 nmdc:mga0a205_944783_c1
459 Ga0495601_0020167
460 Ga0495601_0129558
461 Ga0495601_0254698
462 Ga0495619_0108260
463 Ga0501084_0044940
464 Ga0501084_0871119
465 Ga0501084_0977462
466 Ga0501082_0012400
467 Ga0501082_0139887
468 Ga0530510_0016229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mto-assembly1.cif.gz_A-2 crystal structure of set/i2pp2a/taf-1beta core 0.5252 3 49
6jqv-assembly1.cif.gz_A crystal structure of arabidopsis thaliana nrp2 0.5095 2 50
6anz-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein from neisseria gonorrhoeae 0.4609 15 63
8fvj-assembly1.cif.gz_6 dimeric form of hiv-1 vif in complex with human cbf-beta, elob, eloc, and cul5 0.4453 3 69
7e2w-assembly2.cif.gz_C crystal structure of isocitrate dehydrogenase from ostreococcus tauri in complex with isocitrate and magnesium(ii) 0.4453 2 50
ID Description Score Start End Superfamily
af_Q22963_13_216_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5374 3 52 3.40.50.300
af_K7KCS2_1_110_3.30.1120.90 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain;Nucleosome assembly protein 0.5063 2 50 3.30.1120.90
af_P0DME0_103_248_3.30.1120.90 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain;Nucleosome assembly protein 0.4755 1 49 3.30.1120.90
af_A0A0P0Y2K7_5_134_2.100.10.30 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.4646 37 66 2.100.10.30
af_A0A0P0V2W0_1_140_2.100.10.30 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.4628 37 68 2.100.10.30
ID Description Score Start End GO Terms
AF-A0A1F2RCQ4-F1-model_v4 SpoVG family protein 0.9848 2 99
AF-A0A843SYZ2-F1-model_v4 SpoVG family protein 0.9827 3 94
AF-A0A1F2T6M0-F1-model_v4 SpoVG family protein 0.9781 1 99
AF-A0A1E3YFH4-F1-model_v4 SpoVG family protein 0.9766 1 99
AF-A0A2V8J1I0-F1-model_v4 Uncharacterized protein 0.9764 1 98

Map