F346479

General Info

Members Datasets Scaffolds Average Seq Length
233 178 159 228

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0055303|Ga0496123_0055303_287_1039
Length 250
Sequence MGGANAAKTSRRPTKDRRDVLYDRELEDLPPELRWREWMMRVEAVIFASTEPVSRETLARVVGKDCSIELLIDDLIVELRDRPYELVSVAGGWQHRTRPRFAETICASAAPTRGGAAALSEFEAMVLVAVGYFQPVTRGELSKIFGKEVSRDTIASLRGAGFLASGPRSPTTGAPYTYVTTNHFLSAFGMETLRDFPDIEALDDAGLLSRKRLLASEAPTGRMNGDHADEDEPPGDAGGDEFKFREQDDT

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
3 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
4 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
5 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
6 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
7 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
8 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
9 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
10 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
11 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
12 2643221558 Rhizobium sp. Root149 Isolate Unclassified
13 2643221568 Rhizobium sp. Root564 Isolate Unclassified
14 2643221582 Rhizobium sp. Root651 Isolate Unclassified
15 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
16 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
17 2643221688 Rhizobium sp. Root482 Isolate Unclassified
18 2643221718 Rhizobium sp. Root268 Isolate Unclassified
19 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
20 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
21 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
22 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
23 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
24 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
25 2802429634 Rhizobium anhuiense S10 Isolate Nodule
26 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
27 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
28 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
29 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
30 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
31 2854911287 Brucella lupini LUP21 Isolate Unclassified
32 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
33 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
34 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
35 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
36 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
37 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
38 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
39 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
40 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
41 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
42 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
43 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
44 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
45 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
46 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
47 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
48 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
49 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
50 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
51 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
52 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
53 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
54 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
55 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
56 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
57 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
58 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
59 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
60 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
61 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
62 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
72 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
91 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
100 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
163 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
171 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
172 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
173 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
174 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
175 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
176 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
177 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
178 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.1
Metatranscriptomes 0
Isolates 30.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.45
Nodule 21.89
Rhizoplane 2.15
Rhizosphere 32.62
Stem 0
Stem Tuber 0
Unclassified 30.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002357 3300003187 Bacteria 11483
2 Ga0055531_10000677 3300003794 Bacteria 29093
3 Ga0058692_1000019 3300003856 Bacteria 255580
4 Ga0079104_1002158 3300006946 Bacteria 11140
5 Ga0099826_10000032 3300006948 Bacteria 122288
6 Ga0099826_10007609 3300006948 Bacteria 8004
7 Ga0123342_1004453 3300009766 Bacteria 21363
8 Ga0157373_10001005 3300013100 Bacteria 21809
9 Ga0157370_10074421 3300013104 Bacteria 3204
10 Ga0157369_10141655 3300013105 Bacteria 2544
11 Ga0171462_1049 3300013250 Bacteria 41263
12 Ga0228710_1004297 3300022740 Bacteria 22520
13 Ga0228710_1010703 3300022740 Bacteria 12148
14 Ga0209677_100454 3300025253 Bacteria 23786
15 Ga0209233_1000216 3300025261 Bacteria 108123
16 Ga0209025_1000062 3300025294 Bacteria 304236
17 Ga0209025_1000416 3300025294 Bacteria 85510
18 Ga0209758_1000168 3300025297 Bacteria 150965
19 Ga0209257_1002393 3300025304 Bacteria 18775
20 Ga0209281_1001478 3300027111 Bacteria 13626
21 Ga0209281_1023451 3300027111 Bacteria 1169
22 Ga0209371_1000107 3300027312 Bacteria 141889
23 Ga0209371_1005578 3300027312 Bacteria 4952
24 Ga0209282_1000586 3300027666 Bacteria 17834
25 Ga0209282_1001568 3300027666 Bacteria 12612
26 Ga0307515_10119848 3300028794 Bacteria 2989
27 Ga0268256_1000093 3300030500 Bacteria 141889
28 Ga0307513_10123398 3300031456 Bacteria 2552
29 Ga0307513_10134642 3300031456 Bacteria 2409
30 Ga0307514_10036986 3300031649 Bacteria 3875
31 Ga0307412_10357101 3300031911 Bacteria 1175
32 Ga0315914_1003640 3300031967 Bacteria 23373
33 Ga0307409_100227577 3300031995 Bacteria 1688
34 Ga0307416_100416729 3300032002 Bacteria 1386
35 Ga0307414_10080758 3300032004 Bacteria 2379
36 Ga0315913_1003595 3300033430 Bacteria 18647
37 Ga0315915_1003681 3300033464 Bacteria 19414
38 Ga0395905_0004879 3300037471 Bacteria 13822
39 Ga0237819_10211 3300038705 Bacteria 1233
40 Ga0451833_0375069 3300041491 Bacteria 4923
41 Ga0451833_0897165 3300041491 Bacteria 1136
42 Ga0451835_0831983 3300041492 Bacteria 5006
43 Ga0451837_0644336 3300041494 Bacteria 4980
44 Ga0451839_0123994 3300041496 Bacteria 4027
45 Ga0451841_1103938 3300041498 Bacteria 4191
46 Ga0451845_0505411 3300041501 Bacteria 2923
47 Ga0451847_0867042 3300041503 Bacteria 6057
48 Ga0451849_0290272 3300041505 Bacteria 4214
49 Ga0451851_0059373 3300041507 Bacteria 6876
50 Ga0451843_0690124 3300041509 Bacteria 6857
51 Ga0451855_1144933 3300041511 Bacteria 3099
52 Ga0451853_0772694 3300041512 Bacteria 6365
53 Ga0451853_3356979 3300041512 Bacteria 1431
54 Ga0495590_0009970 3300046457 Bacteria 3591
55 Ga0495638_0107627 3300046460 Bacteria 1660
56 Ga0495650_0134661 3300046471 Bacteria 898
57 Ga0495607_0205509 3300046501 Bacteria 972
58 Ga0495583_0000991 3300046506 Bacteria 32505
59 Ga0495606_0006318 3300046507 Bacteria 10975
60 Ga0495610_0004859 3300046512 Bacteria 9773
61 Ga0495620_0004918 3300046515 Bacteria 7494
62 Ga0495620_0006825 3300046515 Bacteria 6242
63 Ga0495628_0094518 3300046516 Bacteria 2311
64 Ga0495632_0000386 3300046519 Bacteria 42002
65 Ga0495632_0031046 3300046519 Bacteria 2767
66 Ga0495632_0034967 3300046519 Bacteria 2568
67 Ga0495643_0224464 3300046522 Unclassified 889
68 Ga0495643_0281627 3300046522 Bacteria 765
69 Ga0495654_0000200 3300046530 Bacteria 57799
70 Ga0495654_0042812 3300046530 Bacteria 2246
71 Ga0495640_0049551 3300046533 Bacteria 2895
72 Ga0495587_0074247 3300046536 Bacteria 1975
73 Ga0495597_0002865 3300046542 Bacteria 10537
74 Ga0495668_0008929 3300046616 Bacteria 6196
75 Ga0495625_0001932 3300046660 Bacteria 23427
76 Ga0495625_0021607 3300046660 Bacteria 4950
77 Ga0495625_0106144 3300046660 Bacteria 1923
78 Ga0495670_0286009 3300046691 Bacteria 882
79 Ga0495660_0008003 3300046810 Bacteria 6207
80 Ga0495604_0001206 3300047317 Bacteria 21329
81 Ga0495604_0005603 3300047317 Bacteria 9960
82 Ga0495604_0040117 3300047317 Bacteria 3677
83 Ga0495687_008227 3300047443 Bacteria 6006
84 Ga0495687_016825 3300047443 Bacteria 3668
85 Ga0495681_0105057 3300047470 Bacteria 1230
86 Ga0495686_0005300 3300047472 Bacteria 10220
87 Ga0495686_0049343 3300047472 Bacteria 2649
88 Ga0495626_0026266 3300048091 Bacteria 2840
89 Ga0496104_0068125 3300048907 Bacteria 3382
90 Ga0496106_0000073 3300048909 Bacteria 80498
91 Ga0496113_0035065 3300048916 Bacteria 3666
92 Ga0496117_0001193 3300048920 Bacteria 39104
93 Ga0496117_0016786 3300048920 Bacteria 6153
94 Ga0496117_0082486 3300048920 Bacteria 2106
95 Ga0496119_0000569 3300048922 Bacteria 49819
96 Ga0496119_0000615 3300048922 Bacteria 48067
97 Ga0496119_0014284 3300048922 Bacteria 6232
98 Ga0496119_0023449 3300048922 Bacteria 4375
99 Ga0496120_0000305 3300048923 Bacteria 81934
100 Ga0496120_0012024 3300048923 Bacteria 5914
101 Ga0496120_0047064 3300048923 Bacteria 2489
102 Ga0496121_0000635 3300048924 Bacteria 65524
103 Ga0496121_0000836 3300048924 Bacteria 55869
104 Ga0496121_0004696 3300048924 Bacteria 18098
105 Ga0496122_0000266 3300048925 Bacteria 117021
106 Ga0496122_0001076 3300048925 Bacteria 47372
107 Ga0496123_0000018 3300048926 Bacteria 404553
108 Ga0496123_0000046 3300048926 Bacteria 244844
109 Ga0496123_0033838 3300048926 Bacteria 3671
110 Ga0496123_0041820 3300048926 Bacteria 3171
111 Ga0496123_0055303 3300048926 Bacteria 2605
112 Ga0496124_0000227 3300048927 Bacteria 110314
113 Ga0496124_0002508 3300048927 Bacteria 23884
114 Ga0496124_0022540 3300048927 Bacteria 5769
115 Ga0496125_0000034 3300048928 Bacteria 348231
116 Ga0496125_0000411 3300048928 Bacteria 80323
117 Ga0496125_0002100 3300048928 Bacteria 26751
118 Ga0496125_0138169 3300048928 Bacteria 1700
119 Ga0496126_0001062 3300048929 Bacteria 46308
120 Ga0496126_0062456 3300048929 Bacteria 3342
121 Ga0496126_0170783 3300048929 Bacteria 1852
122 Ga0501031_0000068 3300049568 Bacteria 56283
123 Ga0501032_0000103 3300049569 Bacteria 72143
124 Ga0501033_0000865 3300049570 Bacteria 27668
125 Ga0501034_0000365 3300049571 Bacteria 77224
126 Ga0501034_0264847 3300049571 Bacteria 1661
127 Ga0501036_0000058 3300049572 Bacteria 72516
128 Ga0501037_0000157 3300049573 Bacteria 63800
129 Ga0501038_0000091 3300049574 Bacteria 77224
130 Ga0501038_0420931 3300049574 Bacteria 1031
131 Ga0501039_0000071 3300049575 Bacteria 77224
132 Ga0501040_0003724 3300049576 Bacteria 9882
133 Ga0501043_0041357 3300049579 Bacteria 3621
134 Ga0501047_0007886 3300049581 Bacteria 10039
135 Ga0501070_0154018 3300049586 Bacteria 1896
136 Ga0501035_0000503 3300049822 Bacteria 44064
137 Ga0501044_0000225 3300049823 Bacteria 71586
138 Ga0501045_0355515 3300049824 Bacteria 1090
139 nmdc:mga00v17_1527_c1 3300050491 Bacteria 12075
140 nmdc:mga0yw44_228_c1 3300050492 Bacteria 19215
141 nmdc:mga0yw44_710_c2 3300050492 Bacteria 8475
142 Ga0500578_0035990 3300053086 Bacteria 3180
143 Ga0500644_0002264 3300053088 Bacteria 4854
144 Ga0500644_0003817 3300053088 Bacteria 3744
145 Ga0500651_0091430 3300053093 Bacteria 1873
146 Ga0500569_000739 3300053109 Bacteria 5697
147 Ga0500594_0029249 3300053118 Bacteria 1439
148 Ga0500608_009833 3300053122 Bacteria 4078
149 Ga0500618_000019 3300053125 Bacteria 161916
150 Ga0500618_000097 3300053125 Bacteria 71932
151 Ga0500618_000130 3300053125 Bacteria 62583
152 Ga0500658_0014278 3300053134 Bacteria 2939
153 Ga0500559_0003553 3300053136 Bacteria 7631
154 Ga0500616_0000108 3300053153 Bacteria 152917
155 Ga0500616_0036408 3300053153 Bacteria 2670
156 Ga0500622_0000064 3300053156 Bacteria 127531
157 Ga0500622_0000772 3300053156 Bacteria 27803
158 Ga0500622_0000946 3300053156 Bacteria 24704
159 Ga0500624_000495 3300053157 Bacteria 11514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 639633055 639650633 185
2 3300048926 Ga0496123_0033838 Ga0496123_0033838_1897_2505 196
3 3300031456 Ga0307513_10134642 Ga0307513_101346422 202
4 iso_pu_bacteria 2643221623 2644130253 202
5 iso_pu_bacteria 2855872281 2855876234 202
6 iso_pu_bacteria 3005409236 3005411869 203
7 3300048928 Ga0496125_0002100 Ga0496125_0002100_3646_4272 205
8 3300046516 Ga0495628_0094518 Ga0495628_0094518_60_689 206
9 3300046533 Ga0495640_0049551 Ga0495640_0049551_1339_1968 206
10 3300046536 Ga0495587_0074247 Ga0495587_0074247_482_1111 206
11 3300047317 Ga0495604_0005603 Ga0495604_0005603_3702_4331 206
12 iso_pu_bacteria 2775507049 2776910246 207
13 iso_pu_bacteria 2854911287 2854911476 208
14 iso_pu_bacteria 2935675223 2935684633 208
15 3300053118 Ga0500594_0029249 Ga0500594_0029249_743_1375 209
16 iso_pu_bacteria 2838029111 2838033504 209
17 iso_pu_bacteria 2842475841 2842480225 209
18 iso_pu_bacteria 2842502639 2842508104 209
19 iso_pu_bacteria 2899803654 2899804615 209
20 iso_pu_bacteria 3003930520 3003935448 210
21 iso_pu_bacteria 2917699015 2917705762 211
22 iso_pu_bacteria 8019638758 8019648073 211
23 3300006948 Ga0099826_10000032 Ga0099826_1000003294 212
24 3300013100 Ga0157373_10001005 Ga0157373_100010052 212
25 3300013104 Ga0157370_10074421 Ga0157370_100744214 212
26 3300013105 Ga0157369_10141655 Ga0157369_101416551 212
27 3300027666 Ga0209282_1001568 Ga0209282_100156810 212
28 iso_pu_bacteria 2876808645 2876816828 212
29 iso_pu_bacteria 2879110137 2879116639 212
30 iso_pu_bacteria 2917699015 2917705264 212
31 iso_pu_bacteria 8005688590 8005689697 212
32 iso_pu_bacteria 8016511872 8016511943 212
33 iso_pu_bacteria 8017057580 8017066519 212
34 3300041512 Ga0451853_3356979 Ga0451853_3356979_323_1030 213
35 3300013250 Ga0171462_1049 Ga0171462_104939 214
36 3300048924 Ga0496121_0004696 Ga0496121_0004696_11491_12144 214
37 3300032004 Ga0307414_10080758 Ga0307414_100807582 215
38 3300038705 Ga0237819_10211 Ga0237819_10211_208_891 215
39 3300046660 Ga0495625_0106144 Ga0495625_0106144_292_981 215
40 iso_pu_bacteria 2643221637 2644209180 217
41 iso_pu_bacteria 2643221718 2644652654 217
42 iso_pu_bacteria 2515154107 2515611294 218
43 iso_pu_bacteria 2802429634 2806055703 219
44 iso_pu_bacteria 2802429635 2806062582 219
45 iso_pu_bacteria 2842509118 2842512446 219
46 3300046530 Ga0495654_0000200 Ga0495654_0000200_23869_24543 220
47 3300053153 Ga0500616_0000108 Ga0500616_0000108_136651_137367 220
48 iso_pu_bacteria 2643221558 2643810564 220
49 iso_pu_bacteria 2724679232 2725946981 220
50 3300041491 Ga0451833_0375069 Ga0451833_0375069_1176_1862 221
51 3300041492 Ga0451835_0831983 Ga0451835_0831983_3117_3803 221
52 3300041494 Ga0451837_0644336 Ga0451837_0644336_3117_3803 221
53 3300041496 Ga0451839_0123994 Ga0451839_0123994_3055_3741 221
54 3300041501 Ga0451845_0505411 Ga0451845_0505411_555_1241 221
55 3300041503 Ga0451847_0867042 Ga0451847_0867042_2196_2882 221
56 3300041505 Ga0451849_0290272 Ga0451849_0290272_2356_3042 221
57 3300041507 Ga0451851_0059373 Ga0451851_0059373_3117_3803 221
58 3300041509 Ga0451843_0690124 Ga0451843_0690124_3074_3760 221
59 3300041511 Ga0451855_1144933 Ga0451855_1144933_1253_1939 221
60 iso_pu_bacteria 2582581866 2585395042 221
61 iso_pu_bacteria 2643221568 2643858415 221
62 iso_pu_bacteria 2791355253 2793283275 221
63 iso_pu_bacteria 2929138655 2929142707 221
64 iso_pu_bacteria 2989349275 2989350725 221
65 3300049568 Ga0501031_0000068 Ga0501031_0000068_9924_10688 222
66 3300049569 Ga0501032_0000103 Ga0501032_0000103_9952_10716 222
67 3300049570 Ga0501033_0000865 Ga0501033_0000865_9951_10715 222
68 3300049571 Ga0501034_0000365 Ga0501034_0000365_66509_67273 222
69 3300049572 Ga0501036_0000058 Ga0501036_0000058_9952_10716 222
70 3300049573 Ga0501037_0000157 Ga0501037_0000157_9952_10716 222
71 3300049574 Ga0501038_0000091 Ga0501038_0000091_66509_67273 222
72 3300049575 Ga0501039_0000071 Ga0501039_0000071_9952_10716 222
73 3300049576 Ga0501040_0003724 Ga0501040_0003724_1199_1963 222
74 3300049579 Ga0501043_0041357 Ga0501043_0041357_2710_3474 222
75 3300049581 Ga0501047_0007886 Ga0501047_0007886_5004_5768 222
76 3300049586 Ga0501070_0154018 Ga0501070_0154018_288_1052 222
77 3300049822 Ga0501035_0000503 Ga0501035_0000503_33349_34113 222
78 3300049823 Ga0501044_0000225 Ga0501044_0000225_60871_61635 222
79 3300049824 Ga0501045_0355515 Ga0501045_0355515_228_992 222
80 iso_pu_bacteria 2791355091 2792624668 222
81 3300031911 Ga0307412_10357101 Ga0307412_103571012 223
82 3300031995 Ga0307409_100227577 Ga0307409_1002275772 223
83 3300032002 Ga0307416_100416729 Ga0307416_1004167292 223
84 3300048927 Ga0496124_0002508 Ga0496124_0002508_22986_23696 223
85 iso_pu_bacteria 2513237086 2513588814 223
86 iso_pu_bacteria 2582581306 2585269267 223
87 iso_pu_bacteria 2582581865 2585390737 223
88 iso_pu_bacteria 2585427526 2585530359 223
89 iso_pu_bacteria 2600254933 2600377324 223
90 iso_pu_bacteria 2791355082 2792579859 223
91 iso_pu_bacteria 2791355092 2792630787 223
92 iso_pu_bacteria 2855839649 2855846568 223
93 iso_pu_bacteria 2919166419 2919169100 223
94 iso_pu_bacteria 2957498199 2957499074 223
95 iso_pu_bacteria 2964643177 2964646094 223
96 3300003856 Ga0058692_1000019 Ga0058692_1000019112 224
97 3300003856 Ga0058692_1000019 Ga0058692_1000019249 224
98 3300025297 Ga0209758_1000168 Ga0209758_100016826 224
99 3300027312 Ga0209371_1000107 Ga0209371_100010717 224
100 3300030500 Ga0268256_1000093 Ga0268256_100009317 224
101 3300046522 Ga0495643_0224464 Ga0495643_0224464_154_852 224
102 3300048922 Ga0496119_0023449 Ga0496119_0023449_1176_1859 224
103 3300048923 Ga0496120_0047064 Ga0496120_0047064_1124_1807 224
104 iso_pu_bacteria 2643221582 2643919777 224
105 iso_pu_bacteria 2643221688 2644492823 224
106 iso_pu_bacteria 8003570095 8003575157 224
107 3300031649 Ga0307514_10036986 Ga0307514_100369862 225
108 3300046460 Ga0495638_0107627 Ga0495638_0107627_856_1554 225
109 3300046471 Ga0495650_0134661 Ga0495650_0134661_181_867 225
110 3300046501 Ga0495607_0205509 Ga0495607_0205509_236_922 225
111 3300046507 Ga0495606_0006318 Ga0495606_0006318_5571_6257 225
112 3300046512 Ga0495610_0004859 Ga0495610_0004859_4253_4939 225
113 3300046515 Ga0495620_0004918 Ga0495620_0004918_2552_3238 225
114 3300046519 Ga0495632_0034967 Ga0495632_0034967_1252_1938 225
115 3300046530 Ga0495654_0042812 Ga0495654_0042812_1258_1944 225
116 3300046542 Ga0495597_0002865 Ga0495597_0002865_3863_4549 225
117 3300046616 Ga0495668_0008929 Ga0495668_0008929_4692_5378 225
118 3300046660 Ga0495625_0021607 Ga0495625_0021607_3270_3956 225
119 3300046691 Ga0495670_0286009 Ga0495670_0286009_28_744 225
120 3300046810 Ga0495660_0008003 Ga0495660_0008003_4541_5227 225
121 3300047443 Ga0495687_016825 Ga0495687_016825_2371_3057 225
122 3300047470 Ga0495681_0105057 Ga0495681_0105057_301_987 225
123 3300047472 Ga0495686_0005300 Ga0495686_0005300_4627_5313 225
124 3300048091 Ga0495626_0026266 Ga0495626_0026266_1678_2364 225
125 3300048920 Ga0496117_0016786 Ga0496117_0016786_2669_3364 225
126 3300048922 Ga0496119_0014284 Ga0496119_0014284_3646_4341 225
127 3300048923 Ga0496120_0012024 Ga0496120_0012024_1159_1854 225
128 3300048924 Ga0496121_0000836 Ga0496121_0000836_5784_6479 225
129 3300048926 Ga0496123_0041820 Ga0496123_0041820_826_1524 225
130 3300048927 Ga0496124_0022540 Ga0496124_0022540_2994_3680 225
131 3300048928 Ga0496125_0000034 Ga0496125_0000034_259124_259822 225
132 3300048929 Ga0496126_0170783 Ga0496126_0170783_1003_1698 225
133 3300049571 Ga0501034_0264847 Ga0501034_0264847_778_1461 225
134 3300050491 nmdc:mga00v17_1527_c1 nmdc:mga00v17_1527_c1_7043_7738 225
135 3300053086 Ga0500578_0035990 Ga0500578_0035990_1470_2156 225
136 3300053088 Ga0500644_0002264 Ga0500644_0002264_2846_3562 225
137 3300053088 Ga0500644_0003817 Ga0500644_0003817_992_1690 225
138 3300053093 Ga0500651_0091430 Ga0500651_0091430_769_1455 225
139 3300053109 Ga0500569_000739 Ga0500569_000739_1516_2202 225
140 3300053125 Ga0500618_000130 Ga0500618_000130_13913_14626 225
141 3300053134 Ga0500658_0014278 Ga0500658_0014278_1171_1857 225
142 3300053153 Ga0500616_0036408 Ga0500616_0036408_961_1647 225
143 3300053156 Ga0500622_0000064 Ga0500622_0000064_57127_57813 225
144 3300053156 Ga0500622_0000772 Ga0500622_0000772_11308_12006 225
145 3300053156 Ga0500622_0000946 Ga0500622_0000946_21122_21838 225
146 iso_pu_bacteria 2508501122 2509111246 225
147 iso_pu_bacteria 2513237140 2513885903 225
148 iso_pu_bacteria 2599185236 2599722973 225
149 iso_pu_bacteria 2643221582 2643918376 225
150 iso_pu_bacteria 2915993759 2915994794 225
151 iso_pu_bacteria 2921201388 2921201969 225
152 iso_pu_bacteria 2921296804 2921302908 225
153 iso_pu_bacteria 2924150972 2924151799 225
154 iso_pu_bacteria 2937056579 2937057674 225
155 iso_pu_bacteria 2937091812 2937094562 225
156 iso_pu_bacteria 2937106411 2937112769 225
157 iso_pu_bacteria 2957443900 2957450561 225
158 iso_pu_bacteria 2960652885 2960654461 225
159 iso_pu_bacteria 2960660292 2960667358 225
160 iso_pu_bacteria 2964607997 2964608394 225
161 iso_pu_bacteria 2964656573 2964657034 225
162 iso_pu_bacteria 2964705432 2964709725 225
163 iso_pu_bacteria 2967664464 2967665354 225
164 iso_pu_bacteria 2970184632 2970185632 225
165 iso_pu_bacteria 8005619151 8005625973 225
166 iso_pu_bacteria 8057874678 8057880188 225
167 3300047317 Ga0495604_0001206 Ga0495604_0001206_10529_11212 226
168 iso_pu_bacteria 2891373044 2891373929 226
169 3300006946 Ga0079104_1002158 Ga0079104_10021582 227
170 3300006948 Ga0099826_10007609 Ga0099826_1000760910 227
171 3300022740 Ga0228710_1004297 Ga0228710_100429724 227
172 3300022740 Ga0228710_1010703 Ga0228710_10107033 227
173 3300025253 Ga0209677_100454 Ga0209677_10045414 227
174 3300025261 Ga0209233_1000216 Ga0209233_100021693 227
175 3300027111 Ga0209281_1001478 Ga0209281_100147812 227
176 3300027666 Ga0209282_1000586 Ga0209282_100058616 227
177 3300031456 Ga0307513_10123398 Ga0307513_101233983 227
178 3300031967 Ga0315914_1003640 Ga0315914_10036406 227
179 3300033430 Ga0315913_1003595 Ga0315913_10035958 227
180 3300033464 Ga0315915_1003681 Ga0315915_100368116 227
181 3300037471 Ga0395905_0004879 Ga0395905_0004879_12511_13215 227
182 3300041491 Ga0451833_0897165 Ga0451833_0897165_304_990 227
183 3300041498 Ga0451841_1103938 Ga0451841_1103938_1165_1851 227
184 3300041512 Ga0451853_0772694 Ga0451853_0772694_2954_3640 227
185 3300046515 Ga0495620_0006825 Ga0495620_0006825_2445_3131 227
186 3300047317 Ga0495604_0040117 Ga0495604_0040117_1440_2132 227
187 3300048920 Ga0496117_0082486 Ga0496117_0082486_1126_1812 227
188 3300048924 Ga0496121_0000635 Ga0496121_0000635_18081_18776 227
189 3300048929 Ga0496126_0062456 Ga0496126_0062456_942_1628 227
190 3300053125 Ga0500618_000097 Ga0500618_000097_46617_47306 227
191 3300053157 Ga0500624_000495 Ga0500624_000495_7892_8596 227
192 iso_pu_bacteria 8003570095 8003575360 227
193 3300027111 Ga0209281_1023451 Ga0209281_10234512 228
194 3300028794 Ga0307515_10119848 Ga0307515_101198483 228
195 3300048909 Ga0496106_0000073 Ga0496106_0000073_45271_45966 228
196 3300053122 Ga0500608_009833 Ga0500608_009833_1480_2187 228
197 3300053136 Ga0500559_0003553 Ga0500559_0003553_1183_1887 228
198 iso_pu_bacteria 2582581867 2585399342 228
199 3300009766 Ga0123342_1004453 Ga0123342_10044534 229
200 3300025294 Ga0209025_1000416 Ga0209025_100041615 229
201 3300027312 Ga0209371_1005578 Ga0209371_10055785 229
202 3300048920 Ga0496117_0001193 Ga0496117_0001193_1356_2054 229
203 3300048925 Ga0496122_0000266 Ga0496122_0000266_6051_6749 229
204 3300048926 Ga0496123_0000018 Ga0496123_0000018_184096_184794 229
205 3300048928 Ga0496125_0138169 Ga0496125_0138169_952_1656 229
206 3300048929 Ga0496126_0001062 Ga0496126_0001062_22598_23302 229
207 3300053125 Ga0500618_000019 Ga0500618_000019_127509_128216 229
208 3300003794 Ga0055531_10000677 Ga0055531_1000067716 230
209 3300025304 Ga0209257_1002393 Ga0209257_10023934 230
210 3300046457 Ga0495590_0009970 Ga0495590_0009970_1563_2273 230
211 3300046506 Ga0495583_0000991 Ga0495583_0000991_1685_2395 230
212 3300046519 Ga0495632_0000386 Ga0495632_0000386_18250_18966 230
213 3300046519 Ga0495632_0031046 Ga0495632_0031046_377_1087 230
214 3300046522 Ga0495643_0281627 Ga0495643_0281627_12_722 230
215 3300046660 Ga0495625_0001932 Ga0495625_0001932_536_1246 230
216 3300047443 Ga0495687_008227 Ga0495687_008227_1652_2362 230
217 3300047472 Ga0495686_0049343 Ga0495686_0049343_1086_1796 230
218 3300048907 Ga0496104_0068125 Ga0496104_0068125_266_973 230
219 3300048916 Ga0496113_0035065 Ga0496113_0035065_2284_2991 230
220 3300048922 Ga0496119_0000569 Ga0496119_0000569_30318_31028 230
221 3300048922 Ga0496119_0000615 Ga0496119_0000615_8093_8800 230
222 3300048923 Ga0496120_0000305 Ga0496120_0000305_27316_28023 230
223 3300048925 Ga0496122_0001076 Ga0496122_0001076_27303_28010 230
224 3300048926 Ga0496123_0000046 Ga0496123_0000046_149237_149944 230
225 3300048926 Ga0496123_0000046 Ga0496123_0000046_28512_29219 230
226 3300048926 Ga0496123_0055303 Ga0496123_0055303_287_1039 230
227 3300048927 Ga0496124_0000227 Ga0496124_0000227_89996_90703 230
228 3300048928 Ga0496125_0000411 Ga0496125_0000411_59002_59709 230
229 3300049574 Ga0501038_0420931 Ga0501038_0420931_285_998 230
230 3300050492 nmdc:mga0yw44_228_c1 nmdc:mga0yw44_228_c1_370_1080 230
231 3300050492 nmdc:mga0yw44_710_c2 nmdc:mga0yw44_710_c2_5540_6250 230
232 3300003187 JGI25151J46595_10002357 JGI25151J46595_100023575 231
233 3300025294 Ga0209025_1000062 Ga0209025_1000062185 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04079

SMC_ScpB

Segregation and condensation complex subunit ScpB

40

199

0.96

Feature Viewer

pLDDT pTM Quality
77.73 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map