F346368

General Info

Members Datasets Scaffolds Average Seq Length
233 169 466 151

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0005362|Ga0453684_0005362_22905_23429
Length 174
Sequence MPRPFKIPESVLVVIHTAQREVLLIERADQPGAWQSVTGSRDSVDEPFFETAVREVAEETGIVLTDDPVGVLGAPPSLARPRGGAAANVVPRSALRDWGLRNVYEIFPVWAHRYAPGVTHNTEHVYGLTVPRDIAVTLSPREHLNHRWLPWRDAADACFSFSNAEAILQLPRFL

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
72 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
89 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
165 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
166 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 2547132512 Azospira oryzae 6a3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 2.58
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0005362 3300044712 Bacteria 25509
2 Ga0055530_10009627 3300003791 Bacteria 3689
3 Ga0070658_10409232 3300005327 Bacteria 1166
4 Ga0070658_10453258 3300005327 Bacteria 1105
5 Ga0070683_100841464 3300005329 Bacteria 880
6 Ga0070690_100412797 3300005330 Bacteria 994
7 Ga0068868_100477773 3300005338 Bacteria 1088
8 Ga0070661_100190305 3300005344 Bacteria 1565
9 Ga0070674_100269980 3300005356 Bacteria 1344
10 Ga0070709_11573132 3300005434 Bacteria 535
11 Ga0070714_100027078 3300005435 Bacteria 4744
12 Ga0070714_100231602 3300005435 Bacteria 1702
13 Ga0070713_100820828 3300005436 Bacteria 892
14 Ga0070713_100972865 3300005436 Bacteria 818
15 Ga0070710_10067896 3300005437 Bacteria 2047
16 Ga0070694_100956234 3300005444 Bacteria 709
17 Ga0068867_100491667 3300005459 Unclassified 1053
18 Ga0068867_100795281 3300005459 Bacteria 843
19 Ga0070685_10557663 3300005466 Bacteria 819
20 Ga0070706_100084380 3300005467 Bacteria 2943
21 Ga0070696_100031236 3300005546 Bacteria 3650
22 Ga0068855_100001703 3300005563 Bacteria 27502
23 Ga0068855_100026963 3300005563 Bacteria 6874
24 Ga0068855_100055311 3300005563 Bacteria 4662
25 Ga0070664_100672466 3300005564 Bacteria 963
26 Ga0068856_100768817 3300005614 Bacteria 983
27 Ga0068852_100028171 3300005616 Bacteria 4593
28 Ga0068852_100044655 3300005616 Bacteria 3766
29 Ga0068859_100250887 3300005617 Bacteria 1860
30 Ga0068859_101195698 3300005617 Bacteria 837
31 Ga0068851_10372597 3300005834 Bacteria 835
32 Ga0068863_100035761 3300005841 Bacteria 4730
33 Ga0068860_100171640 3300005843 Bacteria 2095
34 Ga0075432_10076442 3300006058 Bacteria 1209
35 Ga0070712_100645584 3300006175 Bacteria 899
36 Ga0097621_100293229 3300006237 Bacteria 1435
37 Ga0075428_100042265 3300006844 Bacteria 5012
38 Ga0075431_100224497 3300006847 Bacteria 1915
39 Ga0075431_100627536 3300006847 Bacteria 1057
40 Ga0075429_100032756 3300006880 Bacteria 4516
41 Ga0075429_100221591 3300006880 Bacteria 1657
42 Ga0097620_100250905 3300006931 Bacteria 1860
43 Ga0097620_101195782 3300006931 Bacteria 837
44 Ga0075435_100580745 3300007076 Unclassified 971
45 Ga0105240_10011887 3300009093 Bacteria 12078
46 Ga0105240_10204690 3300009093 Bacteria 2311
47 Ga0105240_10208266 3300009093 Bacteria 2287
48 Ga0105240_11076255 3300009093 Bacteria 857
49 Ga0111539_10003186 3300009094 Bacteria 21711
50 Ga0111539_10258018 3300009094 Bacteria 2029
51 Ga0114129_10180567 3300009147 Bacteria 2872
52 Ga0114129_11084857 3300009147 Bacteria 1003
53 Ga0105243_10980310 3300009148 Bacteria 846
54 Ga0105241_10263247 3300009174 Bacteria 1466
55 Ga0105248_10314295 3300009177 Bacteria 1764
56 Ga0105248_11191904 3300009177 Bacteria 861
57 Ga0105238_11102671 3300009551 Bacteria 816
58 Ga0157342_1020900 3300012507 Unclassified 760
59 Ga0157370_10009853 3300013104 Bacteria 10127
60 Ga0157370_10051028 3300013104 Bacteria 3952
61 Ga0157374_11111824 3300013296 Bacteria 811
62 Ga0157372_10550734 3300013307 Bacteria 1345
63 Ga0163163_11286851 3300014325 Bacteria 793
64 Ga0157380_10033673 3300014326 Bacteria 3947
65 Ga0157376_10686076 3300014969 Bacteria 1028
66 Ga0163161_10019069 3300017792 Bacteria 4807
67 Ga0163161_11503596 3300017792 Bacteria 591
68 Ga0206356_11511803 3300020070 Bacteria 668
69 Ga0209050_1000143 3300025298 Bacteria 171806
70 Ga0209051_1058507 3300025303 Bacteria 1228
71 Ga0207699_11162889 3300025906 Bacteria 571
72 Ga0207705_10269378 3300025909 Bacteria 1302
73 Ga0207684_10054299 3300025910 Bacteria 3399
74 Ga0207695_10018479 3300025913 Bacteria 8060
75 Ga0207695_10143844 3300025913 Bacteria 2331
76 Ga0207695_10407443 3300025913 Bacteria 1244
77 Ga0207694_10342877 3300025924 Bacteria 1236
78 Ga0207700_10731031 3300025928 Bacteria 884
79 Ga0207664_10023831 3300025929 Bacteria 4593
80 Ga0207665_10277924 3300025939 Bacteria 1245
81 Ga0207711_10029797 3300025941 Bacteria 4604
82 Ga0207661_10588340 3300025944 Bacteria 1021
83 Ga0207661_10957816 3300025944 Bacteria 788
84 Ga0207679_10600465 3300025945 Bacteria 992
85 Ga0207667_10001903 3300025949 Bacteria 26201
86 Ga0207667_10005011 3300025949 Bacteria 16187
87 Ga0207667_10309942 3300025949 Bacteria 1612
88 Ga0207677_11030628 3300026023 Bacteria 747
89 Ga0207702_10773028 3300026078 Bacteria 949
90 Ga0207641_10075280 3300026088 Bacteria 2915
91 Ga0207698_10338974 3300026142 Bacteria 1415
92 Ga0209970_1003122 3300027614 Bacteria 2799
93 Ga0207428_10002577 3300027907 Bacteria 18107
94 Ga0207428_10452552 3300027907 Unclassified 936
95 Ga0268266_10192306 3300028379 Bacteria 1864
96 Ga0316177_1001375 3300030731 Bacteria 3812
97 Ga0316180_1028929 3300030736 Bacteria 2325
98 Ga0265332_10000039 3300031238 Bacteria 128373
99 Ga0265316_10228227 3300031344 Bacteria 1372
100 Ga0307408_101373840 3300031548 Bacteria 664
101 Ga0265342_10275983 3300031712 Bacteria 891
102 Ga0307413_10300668 3300031824 Bacteria 1217
103 Ga0307410_10814200 3300031852 Bacteria 795
104 Ga0307409_100978895 3300031995 Bacteria 863
105 Ga0307416_100305887 3300032002 Bacteria 1583
106 Ga0307416_100394610 3300032002 Bacteria 1419
107 Ga0307416_101001774 3300032002 Unclassified 938
108 Ga0307416_101176996 3300032002 Bacteria 872
109 Ga0307416_103103267 3300032002 Bacteria 556
110 Ga0373953_0086790 3300035117 Bacteria 1306
111 Ga0373960_0185297 3300035121 Bacteria 729
112 Ga0373931_0080024 3300035691 Bacteria 1801
113 Ga0373947_0354139 3300035725 Bacteria 985
114 Ga0373937_0006446 3300036401 Bacteria 10128
115 Ga0395900_0256121 3300037418 Bacteria 1749
116 Ga0436365_1081725 3300039437 Bacteria 2899
117 Ga0451802_0008328 3300041460 Bacteria 2217
118 Ga0451835_0664081 3300041492 Bacteria 747
119 Ga0451839_0289282 3300041496 Bacteria 509
120 Ga0439441_038785 3300042001 Bacteria 948
121 Ga0439435_0260995 3300042436 Bacteria 585
122 Ga0451577_0002123 3300042876 Bacteria 24368
123 Ga0451577_0326086 3300042876 Bacteria 1392
124 Ga0453683_0801493 3300044673 Bacteria 620
125 Ga0453684_0433195 3300044712 Bacteria 1466
126 Ga0451576_0416349 3300045051 Bacteria 1410
127 Ga0451576_0946577 3300045051 Bacteria 903
128 Ga0495592_0001423 3300046454 Bacteria 16610
129 Ga0495590_0028684 3300046457 Bacteria 1951
130 Ga0495629_0262803 3300046459 Bacteria 1186
131 Ga0495629_0416947 3300046459 Bacteria 911
132 Ga0495641_0071762 3300046461 Bacteria 1554
133 Ga0495662_0435778 3300046476 Bacteria 643
134 Ga0495596_0027930 3300046500 Bacteria 2266
135 Ga0495583_0001941 3300046506 Bacteria 19112
136 Ga0495606_0027129 3300046507 Bacteria 4067
137 Ga0495608_0001583 3300046511 Bacteria 16261
138 Ga0495628_0003548 3300046516 Bacteria 13983
139 Ga0495630_0010099 3300046517 Bacteria 6803
140 Ga0495642_0064750 3300046528 Bacteria 1521
141 Ga0495652_0100292 3300046529 Bacteria 2349
142 Ga0495640_0009117 3300046533 Bacteria 7744
143 Ga0495640_0119373 3300046533 Bacteria 1716
144 Ga0495586_0004507 3300046535 Bacteria 7439
145 Ga0495598_0006541 3300046537 Bacteria 2636
146 Ga0495609_0053925 3300046538 Bacteria 1786
147 Ga0495597_0007154 3300046542 Bacteria 5700
148 Ga0495667_0001541 3300046559 Bacteria 15260
149 Ga0495656_0708972 3300046615 Bacteria 542
150 Ga0495668_0538666 3300046616 Bacteria 644
151 Ga0495634_0001358 3300046642 Bacteria 22247
152 Ga0495635_0008086 3300046663 Bacteria 7349
153 Ga0495658_0062566 3300046683 Bacteria 2140
154 Ga0495613_0008377 3300046689 Bacteria 7678
155 Ga0495624_0087989 3300046690 Bacteria 1918
156 Ga0495581_0261589 3300047315 Bacteria 1012
157 Ga0495604_0013501 3300047317 Bacteria 6510
158 Ga0495680_0003760 3300047322 Bacteria 14773
159 Ga0495675_0349760 3300047444 Bacteria 869
160 Ga0495677_0003575 3300047445 Bacteria 6027
161 Ga0495593_0281840 3300047673 Bacteria 831
162 Ga0496101_0144785 3300048904 Bacteria 1814
163 Ga0496107_0251965 3300048910 Bacteria 1314
164 Ga0496110_0276901 3300048913 Bacteria 1528
165 Ga0496110_0876848 3300048913 Bacteria 803
166 Ga0496114_0900205 3300048917 Bacteria 766
167 Ga0501031_0029344 3300049568 Bacteria 3588
168 Ga0501031_0442415 3300049568 Bacteria 840
169 Ga0501032_0055928 3300049569 Bacteria 2653
170 Ga0501033_0000063 3300049570 Bacteria 101552
171 Ga0501033_0031339 3300049570 Bacteria 3995
172 Ga0501033_0440186 3300049570 Bacteria 906
173 Ga0501036_0031547 3300049572 Bacteria 4477
174 Ga0501036_0527668 3300049572 Bacteria 982
175 Ga0501037_0226526 3300049573 Bacteria 1313
176 Ga0501038_0004288 3300049574 Bacteria 13262
177 Ga0501038_0126908 3300049574 Bacteria 2099
178 Ga0501038_0153795 3300049574 Bacteria 1874
179 Ga0501038_0424473 3300049574 Bacteria 1025
180 Ga0501039_0022488 3300049575 Bacteria 4840
181 Ga0501039_0095236 3300049575 Bacteria 2321
182 Ga0501040_0032192 3300049576 Bacteria 3548
183 Ga0501041_0015543 3300049577 Bacteria 4521
184 Ga0501042_0069577 3300049578 Bacteria 2517
185 Ga0501042_0240662 3300049578 Bacteria 1306
186 Ga0501043_0000057 3300049579 Bacteria 103997
187 Ga0501043_0019493 3300049579 Bacteria 5324
188 Ga0501043_0025029 3300049579 Bacteria 4682
189 Ga0501046_0000075 3300049580 Bacteria 104000
190 Ga0501046_0025864 3300049580 Bacteria 4798
191 Ga0501046_0155050 3300049580 Bacteria 1726
192 Ga0501047_0000081 3300049581 Bacteria 122697
193 Ga0501047_0201524 3300049581 Bacteria 1851
194 Ga0501047_0440767 3300049581 Bacteria 1132
195 Ga0501048_0012902 3300049582 Bacteria 6206
196 Ga0501069_0007748 3300049585 Bacteria 5636
197 Ga0501070_0001843 3300049586 Bacteria 18698
198 Ga0501072_0061556 3300049588 Bacteria 2961
199 Ga0501073_0000321 3300049589 Bacteria 32033
200 Ga0501073_0315764 3300049589 Bacteria 1078
201 Ga0501074_0000097 3300049590 Bacteria 42311
202 Ga0501076_0801398 3300049592 Bacteria 777
203 Ga0501079_0051112 3300049741 Bacteria 3190
204 Ga0501079_0072463 3300049741 Bacteria 2662
205 Ga0501083_0002426 3300049744 Bacteria 12758
206 Ga0501035_0014416 3300049822 Bacteria 7295
207 Ga0501035_0286864 3300049822 Bacteria 1390
208 Ga0501044_0052515 3300049823 Bacteria 4200
209 Ga0501044_0112814 3300049823 Bacteria 2725
210 Ga0501044_0123525 3300049823 Bacteria 2587
211 Ga0501044_0471039 3300049823 Bacteria 1160
212 Ga0501044_0581622 3300049823 Bacteria 1014
213 Ga0501044_0589669 3300049823 Bacteria 1005
214 Ga0501044_1503545 3300049823 Bacteria 538
215 nmdc:mga0k408_269105_c1 3300050493 Bacteria 1017
216 nmdc:mga05p37_233300_c1 3300050507 Bacteria 2216
217 nmdc:mga09592_140264_c1 3300050508 Bacteria 2083
218 nmdc:mga09592_17806_c1 3300050508 Bacteria 5821
219 nmdc:mga0qj67_217153_c1 3300050509 Bacteria 1552
220 nmdc:mga0qj67_351628_c1 3300050509 Bacteria 1191
221 nmdc:mga06r32_145487_c1 3300050510 Bacteria 2348
222 nmdc:mga06r32_625590_c1 3300050510 Bacteria 1046
223 nmdc:mga08y16_362020_c1 3300050511 Unclassified 1489
224 nmdc:mga08y16_585_c1 3300050511 Bacteria 33898
225 nmdc:mga0rr50_1719914_c1 3300050513 Bacteria 528
226 Ga0495601_0003890 3300053077 Bacteria 8596
227 Ga0500593_036062 3300053117 Bacteria 2213
228 Ga0500597_321072 3300053120 Bacteria 612
229 Ga0500561_0022630 3300053137 Bacteria 1496
230 Ga0590075_040201 3300059424 Bacteria 1194
231 Ga0501082_0044159 3300060353 Bacteria 3845
232 Ga0501082_0102175 3300060353 Bacteria 2480
233 2548848751 2547132512 Bacteria 3416496
234 Ga0453684_0005362
235 Ga0055530_10009627
236 Ga0070658_10409232
237 Ga0070658_10453258
238 Ga0070683_100841464
239 Ga0070690_100412797
240 Ga0068868_100477773
241 Ga0070661_100190305
242 Ga0070674_100269980
243 Ga0070709_11573132
244 Ga0070714_100027078
245 Ga0070714_100231602
246 Ga0070713_100820828
247 Ga0070713_100972865
248 Ga0070710_10067896
249 Ga0070694_100956234
250 Ga0068867_100491667
251 Ga0068867_100795281
252 Ga0070685_10557663
253 Ga0070706_100084380
254 Ga0070696_100031236
255 Ga0068855_100001703
256 Ga0068855_100026963
257 Ga0068855_100055311
258 Ga0070664_100672466
259 Ga0068856_100768817
260 Ga0068852_100028171
261 Ga0068852_100044655
262 Ga0068859_100250887
263 Ga0068859_101195698
264 Ga0068851_10372597
265 Ga0068863_100035761
266 Ga0068860_100171640
267 Ga0075432_10076442
268 Ga0070712_100645584
269 Ga0097621_100293229
270 Ga0075428_100042265
271 Ga0075431_100224497
272 Ga0075431_100627536
273 Ga0075429_100032756
274 Ga0075429_100221591
275 Ga0097620_100250905
276 Ga0097620_101195782
277 Ga0075435_100580745
278 Ga0105240_10011887
279 Ga0105240_10204690
280 Ga0105240_10208266
281 Ga0105240_11076255
282 Ga0111539_10003186
283 Ga0111539_10258018
284 Ga0114129_10180567
285 Ga0114129_11084857
286 Ga0105243_10980310
287 Ga0105241_10263247
288 Ga0105248_10314295
289 Ga0105248_11191904
290 Ga0105238_11102671
291 Ga0157342_1020900
292 Ga0157370_10009853
293 Ga0157370_10051028
294 Ga0157374_11111824
295 Ga0157372_10550734
296 Ga0163163_11286851
297 Ga0157380_10033673
298 Ga0157376_10686076
299 Ga0163161_10019069
300 Ga0163161_11503596
301 Ga0206356_11511803
302 Ga0209050_1000143
303 Ga0209051_1058507
304 Ga0207699_11162889
305 Ga0207705_10269378
306 Ga0207684_10054299
307 Ga0207695_10018479
308 Ga0207695_10143844
309 Ga0207695_10407443
310 Ga0207694_10342877
311 Ga0207700_10731031
312 Ga0207664_10023831
313 Ga0207665_10277924
314 Ga0207711_10029797
315 Ga0207661_10588340
316 Ga0207661_10957816
317 Ga0207679_10600465
318 Ga0207667_10001903
319 Ga0207667_10005011
320 Ga0207667_10309942
321 Ga0207677_11030628
322 Ga0207702_10773028
323 Ga0207641_10075280
324 Ga0207698_10338974
325 Ga0209970_1003122
326 Ga0207428_10002577
327 Ga0207428_10452552
328 Ga0268266_10192306
329 Ga0316177_1001375
330 Ga0316180_1028929
331 Ga0265332_10000039
332 Ga0265316_10228227
333 Ga0307408_101373840
334 Ga0265342_10275983
335 Ga0307413_10300668
336 Ga0307410_10814200
337 Ga0307409_100978895
338 Ga0307416_100305887
339 Ga0307416_100394610
340 Ga0307416_101001774
341 Ga0307416_101176996
342 Ga0307416_103103267
343 Ga0373953_0086790
344 Ga0373960_0185297
345 Ga0373931_0080024
346 Ga0373947_0354139
347 Ga0373937_0006446
348 Ga0395900_0256121
349 Ga0436365_1081725
350 Ga0451802_0008328
351 Ga0451835_0664081
352 Ga0451839_0289282
353 Ga0439441_038785
354 Ga0439435_0260995
355 Ga0451577_0002123
356 Ga0451577_0326086
357 Ga0453683_0801493
358 Ga0453684_0433195
359 Ga0451576_0416349
360 Ga0451576_0946577
361 Ga0495592_0001423
362 Ga0495590_0028684
363 Ga0495629_0262803
364 Ga0495629_0416947
365 Ga0495641_0071762
366 Ga0495662_0435778
367 Ga0495596_0027930
368 Ga0495583_0001941
369 Ga0495606_0027129
370 Ga0495608_0001583
371 Ga0495628_0003548
372 Ga0495630_0010099
373 Ga0495642_0064750
374 Ga0495652_0100292
375 Ga0495640_0009117
376 Ga0495640_0119373
377 Ga0495586_0004507
378 Ga0495598_0006541
379 Ga0495609_0053925
380 Ga0495597_0007154
381 Ga0495667_0001541
382 Ga0495656_0708972
383 Ga0495668_0538666
384 Ga0495634_0001358
385 Ga0495635_0008086
386 Ga0495658_0062566
387 Ga0495613_0008377
388 Ga0495624_0087989
389 Ga0495581_0261589
390 Ga0495604_0013501
391 Ga0495680_0003760
392 Ga0495675_0349760
393 Ga0495677_0003575
394 Ga0495593_0281840
395 Ga0496101_0144785
396 Ga0496107_0251965
397 Ga0496110_0276901
398 Ga0496110_0876848
399 Ga0496114_0900205
400 Ga0501031_0029344
401 Ga0501031_0442415
402 Ga0501032_0055928
403 Ga0501033_0000063
404 Ga0501033_0031339
405 Ga0501033_0440186
406 Ga0501036_0031547
407 Ga0501036_0527668
408 Ga0501037_0226526
409 Ga0501038_0004288
410 Ga0501038_0126908
411 Ga0501038_0153795
412 Ga0501038_0424473
413 Ga0501039_0022488
414 Ga0501039_0095236
415 Ga0501040_0032192
416 Ga0501041_0015543
417 Ga0501042_0069577
418 Ga0501042_0240662
419 Ga0501043_0000057
420 Ga0501043_0019493
421 Ga0501043_0025029
422 Ga0501046_0000075
423 Ga0501046_0025864
424 Ga0501046_0155050
425 Ga0501047_0000081
426 Ga0501047_0201524
427 Ga0501047_0440767
428 Ga0501048_0012902
429 Ga0501069_0007748
430 Ga0501070_0001843
431 Ga0501072_0061556
432 Ga0501073_0000321
433 Ga0501073_0315764
434 Ga0501074_0000097
435 Ga0501076_0801398
436 Ga0501079_0051112
437 Ga0501079_0072463
438 Ga0501083_0002426
439 Ga0501035_0014416
440 Ga0501035_0286864
441 Ga0501044_0052515
442 Ga0501044_0112814
443 Ga0501044_0123525
444 Ga0501044_0471039
445 Ga0501044_0581622
446 Ga0501044_0589669
447 Ga0501044_1503545
448 nmdc:mga0k408_269105_c1
449 nmdc:mga05p37_233300_c1
450 nmdc:mga09592_140264_c1
451 nmdc:mga09592_17806_c1
452 nmdc:mga0qj67_217153_c1
453 nmdc:mga0qj67_351628_c1
454 nmdc:mga06r32_145487_c1
455 nmdc:mga06r32_625590_c1
456 nmdc:mga08y16_362020_c1
457 nmdc:mga08y16_585_c1
458 nmdc:mga0rr50_1719914_c1
459 Ga0495601_0003890
460 Ga0500593_036062
461 Ga0500597_321072
462 Ga0500561_0022630
463 Ga0590075_040201
464 Ga0501082_0044159
465 Ga0501082_0102175
466 2548848751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

6

90

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o1c-assembly2.cif.gz_B structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase 0.8983 2 150
2o1c-assembly2.cif.gz_B structure of the e. coli dihydroneopterin triphosphate pyrophosphohydrolase 0.8751 2 150
5xd2-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with ap5a, atp and manganese 0.8566 5 147
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.8475 5 151
5gg7-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp, 8-oxo-dgmp and pyrophosphate (i) 0.8439 5 151
ID Description Score Start End Superfamily
2o1cB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8983 2 150 3.90.79.10
2o1cB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8751 2 150 3.90.79.10
af_A0A1D6LP98_107_156_1.10.10.1050 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Dcp2, box A domain 0.8411 6 52 1.10.10.1050
4nfwI00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8212 5 151 3.90.79.10
af_Q19427_210_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8204 5 127 3.90.79.10
ID Description Score Start End GO Terms
AF-G0AEW2-F1-model_v4 Dihydroneopterin triphosphate pyrophosphohydolase type 2 (EC 3.6.1.-) 0.9887 2 146 GO:0008828
GO:0019177
GO:0046656
GO:0046872
AF-A0A226XAV1-F1-model_v4 Dihydroneopterin triphosphate pyrophosphohydrolase type 2 0.9806 2 146 GO:0008828
GO:0019177
GO:0046656
GO:0046872
AF-A0A7U4AC52-F1-model_v4 deleted 0.9799 2 146
AF-A0A3P0N672-F1-model_v4 Dihydroneopterin triphosphate diphosphatase (EC 3.6.1.67) 0.9794 2 146 GO:0008828
GO:0019177
GO:0046656
GO:0046872
AF-A0A228HQ19-F1-model_v4 Dihydroneopterin triphosphate diphosphatase 0.9792 2 146 GO:0008828
GO:0019177
GO:0046656
GO:0046872

Map