F346074

General Info

Members Datasets Scaffolds Average Seq Length
233 149 231 287

Family's Representative Sequence

Representative Sequence 3300009984|Ga0105029_100020|Ga0105029_1000206
Length 297
Sequence MGGQLTLKQLEQKANQVRQDIISMLVAAGSGHSAGPLDLADIMTALYFDIMNIDPSKPEWPERDVFFLSNGHCVPVQYAVMAERGYFPVEELQTLRKFGSRLQGHPERTKLPGLENTSGPLGSGLSQAAGYAYSLQYLEKVRHRWVYAVTGDGELNEGNIWEAAMFAGKYKLSQLIVFIDRNNIQIDGSTEDVMPLEDLHAKWESFGWHVQEIDGHNIESVIDAASMARAISNKPSVIIAHTIAGKGVDFMEYDYHWHGNPPGTIEPEGAPPKSDQARVALNKLRTLDGKITSGDIH

Samples

Sample ID Description Type Environment
1 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
47 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
48 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
49 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
81 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
82 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
83 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
84 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
94 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
99 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
100 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
101 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
147 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
148 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
149 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.18
Nodule 0
Rhizoplane 2.58
Rhizosphere 68.24
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000781 3300001915 Bacteria 9552
2 JGI24740J21852_10004732 3300001979 Bacteria 5818
3 JGI24740J21852_10013952 3300001979 Unclassified 2979
4 JGI24740J21852_10020873 3300001979 Bacteria 2278
5 JGI24739J22299_10003045 3300001989 Bacteria 6401
6 JGI24737J22298_10000426 3300001990 Bacteria 14485
7 JGI24743J22301_10013573 3300001991 Bacteria 1493
8 JGI24735J21928_10000035 3300002067 Bacteria 66299
9 JGI24738J21930_10001946 3300002075 Bacteria 5567
10 JGI24033J26618_1010173 3300002155 Unclassified 1105
11 rootH1_10002936 3300003316 Bacteria 45055
12 rootL2_10039152 3300003322 Bacteria 8737
13 rootL2_10153929 3300003322 Unclassified 3216
14 rootH1_10068879 3300003323 Bacteria 13350
15 JGI25405J52794_10000208 3300003911 Bacteria 7663
16 Ga0065715_10093450 3300005293 Bacteria 4675
17 Ga0070658_10000038 3300005327 Bacteria 137159
18 Ga0070683_100003442 3300005329 Bacteria 12849
19 Ga0070683_100408334 3300005329 Bacteria 1295
20 Ga0068869_100348648 3300005334 Unclassified 1206
21 Ga0070682_100091732 3300005337 Bacteria 1989
22 Ga0070660_100000078 3300005339 Bacteria 58990
23 Ga0070661_100006618 3300005344 Bacteria 7993
24 Ga0070661_100008867 3300005344 Bacteria 6963
25 Ga0070659_100001424 3300005366 Bacteria 17256
26 Ga0070662_100002601 3300005457 Bacteria 11130
27 Ga0068855_100000002 3300005563 Bacteria 616881
28 Ga0068855_100000011 3300005563 Bacteria 244140
29 Ga0068855_100011901 3300005563 Bacteria 10519
30 Ga0070664_100000215 3300005564 Bacteria 41073
31 Ga0068857_100000899 3300005577 Bacteria 22465
32 Ga0068857_100004295 3300005577 Bacteria 12019
33 Ga0068856_100000016 3300005614 Bacteria 155667
34 Ga0068856_100000059 3300005614 Bacteria 101763
35 Ga0068852_100000001 3300005616 Bacteria 716526
36 Ga0068852_100000030 3300005616 Bacteria 102901
37 Ga0068852_100190899 3300005616 Unclassified 1933
38 Ga0081455_10000001 3300005937 Bacteria 603871
39 Ga0075365_10000001 3300006038 Bacteria 371589
40 Ga0075365_10000014 3300006038 Bacteria 79945
41 Ga0075365_10016993 3300006038 Bacteria 4443
42 Ga0075365_10112544 3300006038 Bacteria 1872
43 Ga0075368_10000476 3300006042 Bacteria 11899
44 Ga0075363_100016305 3300006048 Bacteria 3669
45 Ga0075364_10004369 3300006051 Bacteria 8116
46 Ga0075364_10009942 3300006051 Bacteria 5723
47 Ga0075362_10017201 3300006177 Bacteria 2976
48 Ga0075362_10044873 3300006177 Unclassified 1962
49 Ga0075367_10000484 3300006178 Bacteria 14907
50 Ga0075369_10001586 3300006186 Bacteria 7812
51 Ga0075366_10001205 3300006195 Bacteria 12830
52 Ga0075366_10023860 3300006195 Unclassified 3565
53 Ga0097621_100024354 3300006237 Bacteria 4726
54 Ga0075370_10103877 3300006353 Bacteria 1646
55 Ga0075370_10152641 3300006353 Unclassified 1354
56 Ga0068871_100028100 3300006358 Bacteria 4406
57 Ga0075428_100002734 3300006844 Bacteria 19194
58 Ga0075428_100225469 3300006844 Bacteria 2023
59 Ga0068865_100009069 3300006881 Bacteria 6154
60 Ga0105240_10000004 3300009093 Bacteria 708156
61 Ga0105240_10000501 3300009093 Bacteria 72270
62 Ga0105241_10023216 3300009174 Bacteria 4599
63 Ga0105241_10112347 3300009174 Unclassified 2182
64 Ga0105241_10293207 3300009174 Bacteria 1393
65 Ga0105237_10000001 3300009545 Bacteria 1009213
66 Ga0105237_10000002 3300009545 Bacteria 702357
67 Ga0105238_10038386 3300009551 Bacteria 4864
68 Ga0105032_100001 3300009979 Bacteria 472394
69 Ga0105032_100793 3300009979 Bacteria 3006
70 Ga0105032_100966 3300009979 Bacteria 2682
71 Ga0105032_104810 3300009979 Unclassified 1146
72 Ga0105029_100020 3300009984 Bacteria 8175
73 Ga0105033_102539 3300009986 Bacteria 1510
74 Ga0105028_100029 3300009993 Bacteria 16907
75 Ga0105239_10000411 3300010375 Bacteria 62529
76 Ga0105239_10004097 3300010375 Bacteria 17527
77 Ga0105246_10000299 3300011119 Bacteria 26103
78 Ga0105246_10000411 3300011119 Bacteria 22903
79 Ga0105246_10001269 3300011119 Bacteria 14825
80 Ga0157373_10000606 3300013100 Bacteria 27931
81 Ga0157373_10000708 3300013100 Bacteria 26130
82 Ga0157373_10015558 3300013100 Bacteria 5561
83 Ga0157371_10001418 3300013102 Bacteria 24913
84 Ga0157371_10196677 3300013102 Unclassified 1444
85 Ga0157370_10000115 3300013104 Bacteria 92585
86 Ga0157370_10000538 3300013104 Bacteria 47433
87 Ga0157370_10020311 3300013104 Bacteria 6634
88 Ga0157369_10000029 3300013105 Bacteria 206955
89 Ga0157369_10000063 3300013105 Bacteria 147327
90 Ga0157369_10000413 3300013105 Bacteria 56589
91 Ga0157369_10000657 3300013105 Bacteria 44727
92 Ga0157369_10001676 3300013105 Bacteria 27019
93 Ga0157369_10158069 3300013105 Unclassified 2393
94 Ga0157374_10097691 3300013296 Bacteria 2811
95 Ga0157374_10731782 3300013296 Bacteria 1003
96 Ga0157372_10000002 3300013307 Bacteria 687862
97 Ga0157372_10000086 3300013307 Bacteria 96247
98 Ga0157372_10198813 3300013307 Bacteria 2322
99 Ga0157372_10515838 3300013307 Unclassified 1393
100 Ga0157372_10912285 3300013307 Bacteria 1019
101 Ga0157377_10000130 3300014745 Bacteria 48543
102 Ga0157376_10000027 3300014969 Bacteria 204157
103 Ga0207647_10001382 3300025904 Bacteria 18643
104 Ga0207647_10031484 3300025904 Bacteria 3413
105 Ga0207705_10000051 3300025909 Bacteria 169369
106 Ga0207654_10007261 3300025911 Bacteria 5584
107 Ga0207654_10038245 3300025911 Bacteria 2691
108 Ga0207695_10000009 3300025913 Bacteria 1034276
109 Ga0207695_10001249 3300025913 Bacteria 43466
110 Ga0207695_10043167 3300025913 Unclassified 4807
111 Ga0207671_10000003 3300025914 Bacteria 1065461
112 Ga0207671_10000008 3300025914 Bacteria 798229
113 Ga0207657_10001305 3300025919 Bacteria 26462
114 Ga0207657_10003164 3300025919 Bacteria 17610
115 Ga0207649_10009388 3300025920 Bacteria 5352
116 Ga0207694_10182100 3300025924 Bacteria 1704
117 Ga0207690_10010134 3300025932 Bacteria 5597
118 Ga0207706_10000180 3300025933 Bacteria 70244
119 Ga0207704_10000542 3300025938 Bacteria 16818
120 Ga0207661_10003138 3300025944 Bacteria 11456
121 Ga0207679_10139448 3300025945 Bacteria 1958
122 Ga0207667_10000005 3300025949 Bacteria 715503
123 Ga0207667_10000042 3300025949 Bacteria 263461
124 Ga0207667_10011128 3300025949 Bacteria 10474
125 Ga0207702_10000015 3300026078 Bacteria 250830
126 Ga0207702_10000123 3300026078 Bacteria 91295
127 Ga0207674_10006929 3300026116 Bacteria 13279
128 Ga0207674_10008732 3300026116 Bacteria 11666
129 Ga0207698_10000001 3300026142 Bacteria 625389
130 Ga0207698_10000060 3300026142 Bacteria 74527
131 Ga0207698_10087816 3300026142 Unclassified 2534
132 Ga0210002_1002331 3300027617 Bacteria 2742
133 Ga0209813_10001089 3300027866 Bacteria 6080
134 Ga0209974_10000277 3300027876 Bacteria 16714
135 Ga0316176_1060359 3300030732 Bacteria 1455
136 Ga0316176_1202152 3300030732 Unclassified 1782
137 Ga0316179_1054898 3300030734 Bacteria 14330
138 Ga0316180_1013958 3300030736 Bacteria 5476
139 Ga0316183_1119442 3300030742 Bacteria 20659
140 Ga0316182_1059726 3300030745 Bacteria 44312
141 Ga0316182_1062337 3300030745 Bacteria 5635
142 Ga0307516_10004034 3300031730 Bacteria 18404
143 Ga0307405_10307534 3300031731 Unclassified 1205
144 Ga0307406_10000001 3300031901 Bacteria 638191
145 Ga0307406_10002163 3300031901 Bacteria 10702
146 Ga0307412_10005722 3300031911 Bacteria 6985
147 Ga0395899_0035259 3300037312 Bacteria 3756
148 Ga0395900_0000001 3300037418 Bacteria 931146
149 Ga0395898_0000002 3300037466 Bacteria 931013
150 Ga0395901_0000060 3300038443 Bacteria 152235
151 Ga0439438_003952 3300041405 Bacteria 5835
152 Ga0439461_0003393 3300041410 Bacteria 2619
153 Ga0439431_0010733 3300041997 Bacteria 2083
154 Ga0439442_001240 3300042002 Bacteria 5070
155 Ga0439442_028368 3300042002 Bacteria 1167
156 Ga0439445_0007453 3300042004 Bacteria 2538
157 Ga0450919_004230 3300042121 Bacteria 1761
158 Ga0450920_007711 3300042122 Bacteria 1953
159 Ga0450920_013591 3300042122 Bacteria 1534
160 Ga0450906_002119 3300042145 Bacteria 4340
161 Ga0450907_004095 3300042146 Bacteria 2527
162 Ga0439446_0000001 3300042156 Bacteria 275840
163 Ga0439446_0003144 3300042156 Unclassified 4062
164 Ga0439434_0006504 3300042435 Unclassified 3414
165 Ga0439434_0006942 3300042435 Bacteria 3307
166 Ga0439464_0000006 3300042439 Bacteria 45358
167 Ga0450918_017882 3300042531 Bacteria 1235
168 Ga0466972_0012754 3300044658 Bacteria 4220
169 Ga0466965_0000423 3300044683 Bacteria 14639
170 Ga0451576_0016844 3300045051 Bacteria 8057
171 Ga0451576_0161751 3300045051 Bacteria 2337
172 Ga0495638_0000227 3300046460 Bacteria 77425
173 Ga0495588_0030452 3300046674 Bacteria 2713
174 Ga0495660_0000005 3300046810 Bacteria 574567
175 Ga0495686_0044366 3300047472 Unclassified 2815
176 Ga0496101_0111058 3300048904 Bacteria 2063
177 Ga0496103_0176142 3300048906 Bacteria 1374
178 Ga0496104_0193566 3300048907 Bacteria 1945
179 Ga0496114_0233716 3300048917 Bacteria 1615
180 Ga0496115_0000798 3300048918 Bacteria 23095
181 Ga0496115_0073580 3300048918 Bacteria 2773
182 Ga0496119_0039014 3300048922 Bacteria 3058
183 Ga0496126_0135396 3300048929 Bacteria 2125
184 Ga0501034_0000241 3300049571 Bacteria 101160
185 Ga0501034_0001444 3300049571 Bacteria 31518
186 Ga0501034_0003938 3300049571 Bacteria 16687
187 Ga0501037_0000001 3300049573 Bacteria 753276
188 nmdc:mga03683_706_c1 3300050489 Unclassified 4705
189 nmdc:mga00v17_245_c1 3300050491 Bacteria 31982
190 nmdc:mga00v17_47275_c1 3300050491 Bacteria 2606
191 nmdc:mga0yw44_147815_c1 3300050492 Bacteria 1531
192 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
193 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
194 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
195 nmdc:mga0k408_1216_c1 3300050493 Bacteria 14098
196 nmdc:mga0k408_1619_c1 3300050493 Bacteria 4503
197 nmdc:mga06z11_304_c1 3300050494 Bacteria 18803
198 nmdc:mga04h51_8891_c1 3300050495 Bacteria 2702
199 nmdc:mga07m45_158486_c1 3300050496 Unclassified 1313
200 nmdc:mga07m45_200_c2 3300050496 Bacteria 15843
201 nmdc:mga07m45_258735_c1 3300050496 Bacteria 1013
202 nmdc:mga0sz30_2546_c1 3300050516 Bacteria 6499
203 nmdc:mga0sz30_5938_c1 3300050516 Bacteria 4504
204 Ga0500643_001206 3300053087 Bacteria 15437
205 Ga0500643_010563 3300053087 Bacteria 3424
206 Ga0500644_0000555 3300053088 Bacteria 14996
207 Ga0500644_0004978 3300053088 Bacteria 3343
208 Ga0500646_0000011 3300053090 Bacteria 87823
209 Ga0500646_0003129 3300053090 Bacteria 4247
210 Ga0500583_0001027 3300053092 Bacteria 7965
211 Ga0500583_0056270 3300053092 Bacteria 1842
212 Ga0500583_0096989 3300053092 Bacteria 1440
213 Ga0500651_0000001 3300053093 Bacteria 529808
214 Ga0500641_0000001 3300053096 Bacteria 1115973
215 Ga0500650_0066191 3300053098 Bacteria 1688
216 Ga0500555_000006 3300053103 Bacteria 304416
217 Ga0500569_000006 3300053109 Bacteria 77425
218 Ga0500593_063549 3300053117 Bacteria 1617
219 Ga0500594_0000044 3300053118 Bacteria 39879
220 Ga0500652_000001 3300053131 Bacteria 946868
221 Ga0500655_001152 3300053133 Bacteria 5039
222 Ga0500577_0000427 3300053142 Bacteria 10827
223 Ga0500577_0025886 3300053142 Bacteria 1990
224 Ga0500577_0029211 3300053142 Bacteria 1907
225 Ga0500588_0000011 3300053146 Bacteria 48690
226 Ga0500616_0000012 3300053153 Bacteria 681798
227 Ga0500616_0007466 3300053153 Bacteria 6939
228 Ga0500570_007578 3300053724 Bacteria 5955
229 Ga0500570_035196 3300053724 Bacteria 2671
230 Ga0500656_002510 3300053732 Bacteria 1663
231 Ga0500613_000257 3300053738 Bacteria 2621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0030452 Ga0495588_0030452_1928_2656 236
2 3300009979 Ga0105032_104810 Ga0105032_1048101 259
3 3300031730 Ga0307516_10004034 Ga0307516_100040349 263
4 3300041410 Ga0439461_0003393 Ga0439461_0003393_21_815 263
5 3300053087 Ga0500643_010563 Ga0500643_010563_2599_3393 263
6 3300030745 Ga0316182_1062337 Ga0316182_10623375 272
7 3300001979 JGI24740J21852_10004732 JGI24740J21852_100047323 275
8 3300009979 Ga0105032_100793 Ga0105032_1007931 276
9 3300005337 Ga0070682_100091732 Ga0070682_1000917323 279
10 3300013307 Ga0157372_10198813 Ga0157372_101988133 279
11 3300025904 Ga0207647_10031484 Ga0207647_100314844 279
12 3300048904 Ga0496101_0111058 Ga0496101_0111058_914_1807 279
13 3300048906 Ga0496103_0176142 Ga0496103_0176142_198_1091 279
14 3300048907 Ga0496104_0193566 Ga0496104_0193566_942_1787 279
15 3300048917 Ga0496114_0233716 Ga0496114_0233716_708_1601 279
16 3300048918 Ga0496115_0073580 Ga0496115_0073580_160_1053 279
17 3300048922 Ga0496119_0039014 Ga0496119_0039014_940_1785 279
18 3300048929 Ga0496126_0135396 Ga0496126_0135396_924_1769 279
19 iso_pu_bacteria 2852646457 2852648132 279
20 iso_pu_bacteria 8004021418 8004021770 279
21 3300041405 Ga0439438_003952 Ga0439438_003952_1964_2809 280
22 3300041997 Ga0439431_0010733 Ga0439431_0010733_1134_1979 280
23 3300042002 Ga0439442_001240 Ga0439442_001240_2585_3439 280
24 3300042002 Ga0439442_028368 Ga0439442_028368_121_966 280
25 3300042121 Ga0450919_004230 Ga0450919_004230_209_1054 280
26 3300042122 Ga0450920_007711 Ga0450920_007711_898_1752 280
27 3300042122 Ga0450920_013591 Ga0450920_013591_519_1364 280
28 3300042145 Ga0450906_002119 Ga0450906_002119_2632_3477 280
29 3300042146 Ga0450907_004095 Ga0450907_004095_709_1563 280
30 3300042156 Ga0439446_0003144 Ga0439446_0003144_970_1815 280
31 3300042435 Ga0439434_0006504 Ga0439434_0006504_322_1167 280
32 3300042435 Ga0439434_0006942 Ga0439434_0006942_364_1218 280
33 3300042531 Ga0450918_017882 Ga0450918_017882_20_865 280
34 3300045051 Ga0451576_0016844 Ga0451576_0016844_3260_4105 280
35 3300027617 Ga0210002_1002331 Ga0210002_10023313 281
36 3300027876 Ga0209974_10000277 Ga0209974_1000027720 281
37 3300005563 Ga0068855_100000011 Ga0068855_100000011185 282
38 3300025913 Ga0207695_10001249 Ga0207695_1000124910 282
39 3300025949 Ga0207667_10000042 Ga0207667_10000042105 282
40 3300044658 Ga0466972_0012754 Ga0466972_0012754_257_1108 282
41 3300044683 Ga0466965_0000423 Ga0466965_0000423_3312_4163 282
42 3300045051 Ga0451576_0161751 Ga0451576_0161751_728_1582 283
43 3300005616 Ga0068852_100190899 Ga0068852_1001908992 284
44 3300006177 Ga0075362_10044873 Ga0075362_100448732 284
45 3300026142 Ga0207698_10087816 Ga0207698_100878163 284
46 3300049571 Ga0501034_0001444 Ga0501034_0001444_19157_20011 284
47 3300050489 nmdc:mga03683_706_c1 nmdc:mga03683_706_c1_1909_2763 284
48 3300001979 JGI24740J21852_10013952 JGI24740J21852_100139522 285
49 3300005563 Ga0068855_100011901 Ga0068855_1000119014 285
50 3300006038 Ga0075365_10000001 Ga0075365_10000001199 285
51 3300006195 Ga0075366_10023860 Ga0075366_100238603 285
52 3300006844 Ga0075428_100002734 Ga0075428_10000273413 285
53 3300006844 Ga0075428_100225469 Ga0075428_1002254692 285
54 3300009979 Ga0105032_100966 Ga0105032_1009665 285
55 3300009986 Ga0105033_102539 Ga0105033_1025391 285
56 3300009993 Ga0105028_100029 Ga0105028_1000292 285
57 3300013105 Ga0157369_10000063 Ga0157369_10000063104 285
58 3300013105 Ga0157369_10001676 Ga0157369_1000167623 285
59 3300013105 Ga0157369_10158069 Ga0157369_101580692 285
60 3300025949 Ga0207667_10011128 Ga0207667_100111284 285
61 3300030732 Ga0316176_1060359 Ga0316176_10603592 285
62 3300031731 Ga0307405_10307534 Ga0307405_103075342 285
63 3300031911 Ga0307412_10005722 Ga0307412_100057222 285
64 3300042156 Ga0439446_0000001 Ga0439446_0000001_52061_52954 285
65 3300047472 Ga0495686_0044366 Ga0495686_0044366_1447_2307 285
66 3300049571 Ga0501034_0000241 Ga0501034_0000241_61840_62700 285
67 3300049573 Ga0501037_0000001 Ga0501037_0000001_233301_234161 285
68 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_269963_270823 285
69 3300050493 nmdc:mga0k408_1619_c1 nmdc:mga0k408_1619_c1_1413_2273 285
70 3300053087 Ga0500643_001206 Ga0500643_001206_14148_15011 285
71 3300053088 Ga0500644_0000555 Ga0500644_0000555_469_1326 285
72 3300053092 Ga0500583_0096989 Ga0500583_0096989_399_1256 285
73 3300053103 Ga0500555_000006 Ga0500555_000006_70849_71712 285
74 3300053142 Ga0500577_0000427 Ga0500577_0000427_5930_6787 285
75 3300053724 Ga0500570_007578 Ga0500570_007578_44_907 285
76 3300003322 rootL2_10153929 rootL2_101539294 286
77 3300003323 rootH1_10068879 rootH1_100688799 286
78 3300003911 JGI25405J52794_10000208 JGI25405J52794_100002083 286
79 3300005293 Ga0065715_10093450 Ga0065715_100934505 286
80 3300005339 Ga0070660_100000078 Ga0070660_10000007835 286
81 3300005563 Ga0068855_100000002 Ga0068855_100000002245 286
82 3300005937 Ga0081455_10000001 Ga0081455_10000001255 286
83 3300006038 Ga0075365_10000014 Ga0075365_1000001474 286
84 3300006038 Ga0075365_10016993 Ga0075365_100169933 286
85 3300006038 Ga0075365_10112544 Ga0075365_101125442 286
86 3300006042 Ga0075368_10000476 Ga0075368_100004764 286
87 3300006048 Ga0075363_100016305 Ga0075363_1000163053 286
88 3300006051 Ga0075364_10004369 Ga0075364_100043696 286
89 3300006177 Ga0075362_10017201 Ga0075362_100172014 286
90 3300006178 Ga0075367_10000484 Ga0075367_100004845 286
91 3300006186 Ga0075369_10001586 Ga0075369_100015864 286
92 3300006353 Ga0075370_10103877 Ga0075370_101038771 286
93 3300006353 Ga0075370_10152641 Ga0075370_101526412 286
94 3300009093 Ga0105240_10000004 Ga0105240_10000004246 286
95 3300009093 Ga0105240_10000501 Ga0105240_1000050119 286
96 3300009545 Ga0105237_10000001 Ga0105237_10000001679 286
97 3300009979 Ga0105032_100001 Ga0105032_100001246 286
98 3300009984 Ga0105029_100020 Ga0105029_1000206 286
99 3300013102 Ga0157371_10196677 Ga0157371_101966772 286
100 3300013104 Ga0157370_10000115 Ga0157370_1000011562 286
101 3300013105 Ga0157369_10000413 Ga0157369_1000041354 286
102 3300013307 Ga0157372_10000002 Ga0157372_10000002224 286
103 3300013307 Ga0157372_10515838 Ga0157372_105158382 286
104 3300025913 Ga0207695_10000009 Ga0207695_10000009626 286
105 3300025914 Ga0207671_10000003 Ga0207671_10000003682 286
106 3300025919 Ga0207657_10003164 Ga0207657_1000316418 286
107 3300025949 Ga0207667_10000005 Ga0207667_10000005355 286
108 3300027866 Ga0209813_10001089 Ga0209813_100010894 286
109 3300030732 Ga0316176_1202152 Ga0316176_12021522 286
110 3300030734 Ga0316179_1054898 Ga0316179_10548989 286
111 3300030736 Ga0316180_1013958 Ga0316180_10139584 286
112 3300030742 Ga0316183_1119442 Ga0316183_111944215 286
113 3300030745 Ga0316182_1059726 Ga0316182_105972623 286
114 3300031901 Ga0307406_10000001 Ga0307406_10000001172 286
115 3300031901 Ga0307406_10002163 Ga0307406_100021638 286
116 3300042004 Ga0439445_0007453 Ga0439445_0007453_1413_2276 286
117 3300046460 Ga0495638_0000227 Ga0495638_0000227_52550_53428 286
118 3300046810 Ga0495660_0000005 Ga0495660_0000005_76711_77589 286
119 3300048918 Ga0496115_0000798 Ga0496115_0000798_21450_22313 286
120 3300049571 Ga0501034_0003938 Ga0501034_0003938_189_1052 286
121 3300050491 nmdc:mga00v17_245_c1 nmdc:mga00v17_245_c1_10871_11734 286
122 3300050492 nmdc:mga0yw44_147815_c1 nmdc:mga0yw44_147815_c1_601_1464 286
123 3300050492 nmdc:mga0yw44_16_c1 nmdc:mga0yw44_16_c1_19260_20123 286
124 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_358244_359107 286
125 3300050494 nmdc:mga06z11_304_c1 nmdc:mga06z11_304_c1_17387_18250 286
126 3300050495 nmdc:mga04h51_8891_c1 nmdc:mga04h51_8891_c1_403_1266 286
127 3300050496 nmdc:mga07m45_158486_c1 nmdc:mga07m45_158486_c1_358_1221 286
128 3300050496 nmdc:mga07m45_258735_c1 nmdc:mga07m45_258735_c1_122_985 286
129 3300050516 nmdc:mga0sz30_2546_c1 nmdc:mga0sz30_2546_c1_1550_2413 286
130 3300053088 Ga0500644_0004978 Ga0500644_0004978_889_1767 286
131 3300053090 Ga0500646_0000011 Ga0500646_0000011_67188_68066 286
132 3300053090 Ga0500646_0003129 Ga0500646_0003129_1771_2634 286
133 3300053092 Ga0500583_0001027 Ga0500583_0001027_4171_5049 286
134 3300053092 Ga0500583_0056270 Ga0500583_0056270_616_1479 286
135 3300053093 Ga0500651_0000001 Ga0500651_0000001_294910_295773 286
136 3300053096 Ga0500641_0000001 Ga0500641_0000001_125483_126361 286
137 3300053098 Ga0500650_0066191 Ga0500650_0066191_773_1651 286
138 3300053109 Ga0500569_000006 Ga0500569_000006_52550_53428 286
139 3300053117 Ga0500593_063549 Ga0500593_063549_298_1161 286
140 3300053118 Ga0500594_0000044 Ga0500594_0000044_34596_35459 286
141 3300053131 Ga0500652_000001 Ga0500652_000001_236111_236989 286
142 3300053133 Ga0500655_001152 Ga0500655_001152_1115_1978 286
143 3300053142 Ga0500577_0029211 Ga0500577_0029211_314_1177 286
144 3300053146 Ga0500588_0000011 Ga0500588_0000011_32432_33310 286
145 3300053153 Ga0500616_0000012 Ga0500616_0000012_433750_434616 286
146 3300053153 Ga0500616_0007466 Ga0500616_0007466_4651_5514 286
147 3300053724 Ga0500570_035196 Ga0500570_035196_1359_2237 286
148 3300053732 Ga0500656_002510 Ga0500656_002510_744_1622 286
149 3300053738 Ga0500613_000257 Ga0500613_000257_1296_2159 286
150 3300001915 JGI24741J21665_1000781 JGI24741J21665_100078111 287
151 3300001979 JGI24740J21852_10020873 JGI24740J21852_100208732 287
152 3300001989 JGI24739J22299_10003045 JGI24739J22299_100030456 287
153 3300001990 JGI24737J22298_10000426 JGI24737J22298_1000042616 287
154 3300001991 JGI24743J22301_10013573 JGI24743J22301_100135732 287
155 3300002067 JGI24735J21928_10000035 JGI24735J21928_1000003539 287
156 3300002075 JGI24738J21930_10001946 JGI24738J21930_100019462 287
157 3300002155 JGI24033J26618_1010173 JGI24033J26618_10101731 287
158 3300003316 rootH1_10002936 rootH1_100029363 287
159 3300003322 rootL2_10039152 rootL2_100391521 287
160 3300005327 Ga0070658_10000038 Ga0070658_1000003847 287
161 3300005329 Ga0070683_100003442 Ga0070683_1000034424 287
162 3300005329 Ga0070683_100408334 Ga0070683_1004083342 287
163 3300005334 Ga0068869_100348648 Ga0068869_1003486482 287
164 3300005344 Ga0070661_100006618 Ga0070661_1000066184 287
165 3300005344 Ga0070661_100008867 Ga0070661_1000088673 287
166 3300005366 Ga0070659_100001424 Ga0070659_10000142414 287
167 3300005457 Ga0070662_100002601 Ga0070662_1000026018 287
168 3300005564 Ga0070664_100000215 Ga0070664_10000021513 287
169 3300005577 Ga0068857_100000899 Ga0068857_1000008999 287
170 3300005577 Ga0068857_100004295 Ga0068857_10000429511 287
171 3300005614 Ga0068856_100000016 Ga0068856_10000001674 287
172 3300005614 Ga0068856_100000059 Ga0068856_10000005923 287
173 3300005616 Ga0068852_100000001 Ga0068852_100000001494 287
174 3300005616 Ga0068852_100000030 Ga0068852_10000003061 287
175 3300006051 Ga0075364_10009942 Ga0075364_100099424 287
176 3300006195 Ga0075366_10001205 Ga0075366_100012053 287
177 3300006237 Ga0097621_100024354 Ga0097621_1000243544 287
178 3300006358 Ga0068871_100028100 Ga0068871_1000281002 287
179 3300006881 Ga0068865_100009069 Ga0068865_1000090693 287
180 3300009174 Ga0105241_10023216 Ga0105241_100232165 287
181 3300009174 Ga0105241_10112347 Ga0105241_101123473 287
182 3300009174 Ga0105241_10293207 Ga0105241_102932072 287
183 3300009545 Ga0105237_10000002 Ga0105237_10000002387 287
184 3300009551 Ga0105238_10038386 Ga0105238_100383862 287
185 3300010375 Ga0105239_10000411 Ga0105239_1000041116 287
186 3300010375 Ga0105239_10004097 Ga0105239_1000409713 287
187 3300011119 Ga0105246_10000299 Ga0105246_100002998 287
188 3300011119 Ga0105246_10000411 Ga0105246_1000041115 287
189 3300011119 Ga0105246_10001269 Ga0105246_1000126912 287
190 3300013100 Ga0157373_10000606 Ga0157373_1000060628 287
191 3300013100 Ga0157373_10000708 Ga0157373_100007085 287
192 3300013100 Ga0157373_10015558 Ga0157373_100155585 287
193 3300013102 Ga0157371_10001418 Ga0157371_100014182 287
194 3300013104 Ga0157370_10000538 Ga0157370_1000053843 287
195 3300013104 Ga0157370_10020311 Ga0157370_100203117 287
196 3300013105 Ga0157369_10000029 Ga0157369_1000002943 287
197 3300013105 Ga0157369_10000657 Ga0157369_1000065715 287
198 3300013296 Ga0157374_10097691 Ga0157374_100976912 287
199 3300013296 Ga0157374_10731782 Ga0157374_107317821 287
200 3300013307 Ga0157372_10000086 Ga0157372_1000008651 287
201 3300013307 Ga0157372_10912285 Ga0157372_109122852 287
202 3300014745 Ga0157377_10000130 Ga0157377_100001308 287
203 3300014969 Ga0157376_10000027 Ga0157376_10000027175 287
204 3300025904 Ga0207647_10001382 Ga0207647_1000138216 287
205 3300025909 Ga0207705_10000051 Ga0207705_10000051143 287
206 3300025911 Ga0207654_10007261 Ga0207654_100072613 287
207 3300025911 Ga0207654_10038245 Ga0207654_100382454 287
208 3300025913 Ga0207695_10043167 Ga0207695_100431674 287
209 3300025914 Ga0207671_10000008 Ga0207671_10000008492 287
210 3300025919 Ga0207657_10001305 Ga0207657_100013052 287
211 3300025920 Ga0207649_10009388 Ga0207649_100093884 287
212 3300025924 Ga0207694_10182100 Ga0207694_101821002 287
213 3300025932 Ga0207690_10010134 Ga0207690_100101342 287
214 3300025933 Ga0207706_10000180 Ga0207706_1000018028 287
215 3300025938 Ga0207704_10000542 Ga0207704_1000054213 287
216 3300025944 Ga0207661_10003138 Ga0207661_100031389 287
217 3300025945 Ga0207679_10139448 Ga0207679_101394482 287
218 3300026078 Ga0207702_10000015 Ga0207702_10000015191 287
219 3300026078 Ga0207702_10000123 Ga0207702_1000012358 287
220 3300026116 Ga0207674_10006929 Ga0207674_100069299 287
221 3300026116 Ga0207674_10008732 Ga0207674_100087324 287
222 3300026142 Ga0207698_10000001 Ga0207698_10000001445 287
223 3300026142 Ga0207698_10000060 Ga0207698_100000606 287
224 3300037312 Ga0395899_0035259 Ga0395899_0035259_1697_2566 287
225 3300037418 Ga0395900_0000001 Ga0395900_0000001_183194_184063 287
226 3300037466 Ga0395898_0000002 Ga0395898_0000002_921943_922812 287
227 3300038443 Ga0395901_0000060 Ga0395901_0000060_53634_54503 287
228 3300042439 Ga0439464_0000006 Ga0439464_0000006_43595_44464 287
229 3300050491 nmdc:mga00v17_47275_c1 nmdc:mga00v17_47275_c1_154_1023 287
230 3300050493 nmdc:mga0k408_1216_c1 nmdc:mga0k408_1216_c1_6660_7529 287
231 3300050496 nmdc:mga07m45_200_c2 nmdc:mga07m45_200_c2_6539_7408 287
232 3300050516 nmdc:mga0sz30_5938_c1 nmdc:mga0sz30_5938_c1_2586_3455 287
233 3300053142 Ga0500577_0025886 Ga0500577_0025886_859_1725 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

10

269

0.94

PF00676

E1_dh

Dehydrogenase E1 component

89

243

0.84

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

3

193

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.941 10 280
1qgd-assembly1.cif.gz_B transketolase from escherichia coli 0.9077 10 274
5vrb-assembly2.cif.gz_B crystal structure of a transketolase from neisseria gonorrhoeae 0.907 14 274
3uk1-assembly1.cif.gz_B crystal structure of a transketolase from burkholderia thailandensis with an oxidized cysteinesulfonic acid in the active site 0.9063 10 274
8cip-assembly2.cif.gz_D crystal structure of transketolase from geobacillus stearothermophilus 0.9025 6 274
ID Description Score Start End Superfamily
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9338 1 274 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9272 1 274 3.40.50.970
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9171 7 283 3.40.50.970
af_A0A1D6P5P4_1_115_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9048 155 267 3.40.50.970
4c7vA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9011 10 274 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A843LJJ8-F1-model_v4 Transketolase 0.9562 124 276 GO:0006082
GO:0044272
AF-A0A383EWE6-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9515 124 275
AF-R5SC59-F1-model_v4 deleted 0.9495 121 272
AF-A0A800DIR4-F1-model_v4 Transketolase 0.9495 155 273
AF-A0A0F9GTF7-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9486 133 273

Feature Viewer

pLDDT pTM Quality
83.88 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map