F346044

General Info

Members Datasets Scaffolds Average Seq Length
233 135 466 37

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10919929|Ga0105247_109199292
Length 44
Sequence MIWTKRSSSRAANQVRFEVNLVLAKALSLIIPPSLLARADEVIE

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
3 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
4 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
5 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
6 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
32 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
63 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
74 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
75 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 0
Rhizoplane 17.6
Rhizosphere 78.11
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10919929 3300009101 Bacteria 677
2 Ga0070664_100240607 3300005564 Bacteria 1625
3 Ga0068859_101685581 3300005617 Bacteria 700
4 Ga0068864_101372544 3300005618 Bacteria 708
5 Ga0068863_101767341 3300005841 Bacteria 628
6 Ga0068858_100279783 3300005842 Bacteria 1589
7 Ga0068860_100077168 3300005843 Bacteria 3168
8 Ga0081455_10009207 3300005937 Bacteria 10175
9 Ga0081455_10036579 3300005937 Bacteria 4369
10 Ga0081455_10482455 3300005937 Bacteria 838
11 Ga0070717_10676943 3300006028 Bacteria 937
12 Ga0075364_10735352 3300006051 Bacteria 673
13 Ga0075432_10431332 3300006058 Bacteria 575
14 Ga0070715_10686863 3300006163 Bacteria 610
15 Ga0070712_101075650 3300006175 Bacteria 697
16 Ga0075428_100014530 3300006844 Bacteria 8745
17 Ga0075428_100088981 3300006844 Bacteria 3368
18 Ga0075428_102462531 3300006844 Bacteria 533
19 Ga0075430_100072642 3300006846 Bacteria 2885
20 Ga0075430_100882543 3300006846 Bacteria 737
21 Ga0075430_100971365 3300006846 Bacteria 700
22 Ga0075431_100642221 3300006847 Bacteria 1042
23 Ga0075431_101280180 3300006847 Bacteria 694
24 Ga0075431_102001180 3300006847 Bacteria 534
25 Ga0075433_10073434 3300006852 Bacteria 3009
26 Ga0075433_10279063 3300006852 Bacteria 1480
27 Ga0075433_10726024 3300006852 Bacteria 869
28 Ga0075434_100167503 3300006871 Unclassified 2217
29 Ga0075429_100118895 3300006880 Bacteria 2309
30 Ga0075429_100588503 3300006880 Bacteria 975
31 Ga0075436_100746142 3300006914 Bacteria 727
32 Ga0097620_101685926 3300006931 Bacteria 700
33 Ga0075435_101085286 3300007076 Bacteria 700
34 Ga0099794_10026104 3300007265 Bacteria 2697
35 Ga0099795_10404956 3300007788 Bacteria 621
36 Ga0105247_10025341 3300009101 Plasmid 3577
37 Ga0105247_11322815 3300009101 Bacteria 580
38 Ga0114129_10025350 3300009147 Bacteria 8402
39 Ga0114129_10235723 3300009147 Bacteria 2462
40 Ga0105243_10112677 3300009148 Bacteria 2279
41 Ga0105243_10280616 3300009148 Unclassified 1500
42 Ga0105248_11347937 3300009177 Bacteria 807
43 Ga0105238_13080127 3300009551 Bacteria 500
44 Ga0105249_12440463 3300009553 Bacteria 595
45 Ga0105246_10150242 3300011119 Bacteria 1762
46 Ga0105246_10279242 3300011119 Bacteria 1339
47 Ga0105246_12418619 3300011119 Bacteria 515
48 Ga0157329_1001007 3300012491 Bacteria 1324
49 Ga0157339_1033516 3300012505 Bacteria 613
50 Ga0157374_11548580 3300013296 Bacteria 687
51 Ga0163162_11264686 3300013306 Bacteria 838
52 Ga0163162_11724463 3300013306 Unclassified 715
53 Ga0163162_12468297 3300013306 Bacteria 598
54 Ga0157372_11592857 3300013307 Bacteria 752
55 Ga0157375_12387203 3300013308 Bacteria 631
56 Ga0163163_10032425 3300014325 Bacteria 5045
57 Ga0163163_11449441 3300014325 Bacteria 748
58 Ga0157380_10135082 3300014326 Unclassified 2110
59 Ga0157380_10881057 3300014326 Bacteria 920
60 Ga0157380_11288717 3300014326 Bacteria 777
61 Ga0157380_12883924 3300014326 Bacteria 547
62 Ga0157379_10387394 3300014968 Bacteria 1283
63 Ga0157376_11659150 3300014969 Bacteria 674
64 Ga0157376_12460000 3300014969 Bacteria 560
65 Ga0207692_10022977 3300025898 Bacteria 2878
66 Ga0207688_10857841 3300025901 Unclassified 575
67 Ga0207685_10306255 3300025905 Bacteria 788
68 Ga0207699_10085818 3300025906 Unclassified 1964
69 Ga0207684_10307286 3300025910 Bacteria 1367
70 Ga0207693_10064087 3300025915 Bacteria 2879
71 Ga0207694_11834940 3300025924 Unclassified 509
72 Ga0207650_10017785 3300025925 Bacteria 4979
73 Ga0207687_10575500 3300025927 Bacteria 947
74 Ga0207700_10169943 3300025928 Bacteria 1818
75 Ga0207690_10138258 3300025932 Bacteria 1792
76 Ga0207670_10402931 3300025936 Bacteria 1094
77 Ga0207669_10267727 3300025937 Unclassified 1282
78 Ga0207669_10765917 3300025937 Bacteria 798
79 Ga0207665_10184804 3300025939 Bacteria 1511
80 Ga0207665_11132056 3300025939 Bacteria 624
81 Ga0207691_10047674 3300025940 Bacteria 3931
82 Ga0207679_11357003 3300025945 Bacteria 652
83 Ga0207677_10437795 3300026023 Bacteria 1117
84 Ga0207708_10070828 3300026075 Unclassified 2670
85 Ga0209588_1011099 3300027671 Bacteria 2717
86 Ga0207428_10960954 3300027907 Bacteria 602
87 Ga0268264_10395254 3300028381 Bacteria 1327
88 Ga0268264_12328679 3300028381 Bacteria 542
89 Ga0373952_0000440 3300035092 Bacteria 7216
90 Ga0373945_0033226 3300035116 Bacteria 1832
91 Ga0373945_0306659 3300035116 Bacteria 681
92 Ga0373943_0303000 3300035170 Bacteria 908
93 Ga0373943_0358145 3300035170 Bacteria 837
94 Ga0373943_0651708 3300035170 Bacteria 622
95 Ga0373946_0169019 3300035171 Bacteria 1031
96 Ga0373962_0053264 3300035242 Bacteria 1171
97 Ga0373935_0102131 3300035692 Unclassified 1892
98 Ga0373935_0252673 3300035692 Bacteria 1234
99 Ga0373935_0712755 3300035692 Bacteria 738
100 Ga0373935_1483523 3300035692 Bacteria 508
101 Ga0373927_0657537 3300035695 Bacteria 693
102 Ga0373927_0697799 3300035695 Bacteria 670
103 Ga0373927_1080251 3300035695 Bacteria 529
104 Ga0373947_0211046 3300035725 Bacteria 1273
105 Ga0373937_0884328 3300036401 Bacteria 842
106 Ga0373925_0156273 3300037068 Bacteria 1794
107 Ga0373925_0509510 3300037068 Bacteria 988
108 Ga0373925_0522645 3300037068 Bacteria 975
109 Ga0373925_1667358 3300037068 Bacteria 521
110 Ga0373925_1765470 3300037068 Bacteria 505
111 Ga0395901_0123940 3300038443 Bacteria 2715
112 Ga0395901_1827285 3300038443 Bacteria 556
113 Ga0242420_070255 3300038996 Bacteria 711
114 Ga0451847_1003035 3300041503 Bacteria 630
115 Ga0451843_0021168 3300041509 Bacteria 622
116 Ga0439460_0304492 3300042461 Bacteria 557
117 Ga0495603_0247384 3300046455 Bacteria 1027
118 Ga0495603_0248929 3300046455 Bacteria 1023
119 Ga0495603_0566510 3300046455 Bacteria 650
120 Ga0495641_0054533 3300046461 Bacteria 1816
121 Ga0495641_0218759 3300046461 Bacteria 854
122 Ga0495580_0022779 3300046472 Bacteria 4604
123 Ga0495639_0082698 3300046475 Bacteria 1497
124 Ga0495662_0302180 3300046476 Bacteria 787
125 Ga0495662_0516617 3300046476 Bacteria 585
126 Ga0495662_0523080 3300046476 Bacteria 581
127 Ga0495594_0371436 3300046499 Bacteria 814
128 Ga0495607_0536541 3300046501 Unclassified 515
129 Ga0495608_0165270 3300046511 Bacteria 1406
130 Ga0495618_0126812 3300046514 Bacteria 1634
131 Ga0495628_0529822 3300046516 Bacteria 848
132 Ga0495628_0855871 3300046516 Bacteria 633
133 Ga0495628_1209192 3300046516 Bacteria 512
134 Ga0495630_0444045 3300046517 Bacteria 994
135 Ga0495630_0936382 3300046517 Bacteria 659
136 Ga0495652_0600248 3300046529 Bacteria 751
137 Ga0495640_0151919 3300046533 Bacteria 1488
138 Ga0495640_0442758 3300046533 Bacteria 794
139 Ga0495609_0278377 3300046538 Bacteria 685
140 Ga0495656_0050559 3300046615 Bacteria 1775
141 Ga0495656_0074637 3300046615 Bacteria 1515
142 Ga0495634_0034081 3300046642 Bacteria 3495
143 Ga0495659_0322664 3300046664 Bacteria 656
144 Ga0495647_0422384 3300046681 Bacteria 614
145 Ga0495647_0547618 3300046681 Bacteria 541
146 Ga0495658_0101184 3300046683 Bacteria 1720
147 Ga0495658_0408875 3300046683 Bacteria 865
148 Ga0495658_0710552 3300046683 Bacteria 644
149 Ga0495613_0243104 3300046689 Bacteria 1258
150 Ga0495624_0234418 3300046690 Bacteria 1111
151 Ga0495670_0107519 3300046691 Bacteria 1441
152 Ga0495670_0555103 3300046691 Bacteria 625
153 Ga0495670_0614899 3300046691 Bacteria 592
154 Ga0495581_0618911 3300047315 Bacteria 627
155 Ga0495581_0827697 3300047315 Bacteria 530
156 Ga0495676_0166505 3300047321 Bacteria 1554
157 Ga0495676_0291866 3300047321 Bacteria 1102
158 Ga0495675_0202781 3300047444 Bacteria 1207
159 Ga0495684_0913914 3300047471 Unclassified 564
160 Ga0495593_0456028 3300047673 Bacteria 640
161 Ga0496100_0501797 3300048903 Bacteria 935
162 Ga0496100_1504933 3300048903 Bacteria 532
163 Ga0496101_0593212 3300048904 Unclassified 876
164 Ga0496101_0964538 3300048904 Bacteria 671
165 Ga0496102_0064862 3300048905 Bacteria 3346
166 Ga0496102_0082277 3300048905 Bacteria 2969
167 Ga0496103_0157129 3300048906 Bacteria 1458
168 Ga0496103_0211877 3300048906 Bacteria 1246
169 Ga0496103_1044881 3300048906 Bacteria 507
170 Ga0496104_0013707 3300048907 Bacteria 7310
171 Ga0496104_0150249 3300048907 Bacteria 2236
172 Ga0496104_0662747 3300048907 Bacteria 952
173 Ga0496104_1186550 3300048907 Bacteria 666
174 Ga0496104_1549754 3300048907 Bacteria 565
175 Ga0496104_1716305 3300048907 Unclassified 530
176 Ga0496105_0029376 3300048908 Bacteria 4500
177 Ga0496105_0130914 3300048908 Bacteria 2068
178 Ga0496105_0319650 3300048908 Bacteria 1244
179 Ga0496105_0603155 3300048908 Bacteria 852
180 Ga0496106_0118292 3300048909 Bacteria 2069
181 Ga0496106_0340741 3300048909 Bacteria 1204
182 Ga0496108_0030558 3300048911 Bacteria 4464
183 Ga0496108_0654850 3300048911 Bacteria 913
184 Ga0496108_0659215 3300048911 Bacteria 909
185 Ga0496108_0941074 3300048911 Bacteria 740
186 Ga0496109_0000219 3300048912 Bacteria 56194
187 Ga0496109_0003849 3300048912 Bacteria 12537
188 Ga0496109_0773823 3300048912 Bacteria 898
189 Ga0496110_0007523 3300048913 Bacteria 8702
190 Ga0496110_1047876 3300048913 Bacteria 723
191 Ga0496111_1080965 3300048914 Bacteria 572
192 Ga0496112_0718399 3300048915 Bacteria 926
193 Ga0496113_0070995 3300048916 Bacteria 2648
194 Ga0496114_0315606 3300048917 Bacteria 1381
195 Ga0496114_0545348 3300048917 Bacteria 1025
196 Ga0496114_0616044 3300048917 Unclassified 956
197 Ga0496114_1144598 3300048917 Bacteria 663
198 Ga0496114_1729791 3300048917 Unclassified 513
199 Ga0496115_0236622 3300048918 Bacteria 1505
200 Ga0496115_0315182 3300048918 Bacteria 1280
201 Ga0496115_1152561 3300048918 Bacteria 585
202 Ga0501225_0236230 3300049705 Bacteria 595
203 nmdc:mga03n38_118666_c1 3300050490 Bacteria 1297
204 nmdc:mga03n38_381580_c1 3300050490 Bacteria 772
205 nmdc:mga03n38_971851_c1 3300050490 Bacteria 502
206 nmdc:mga00v17_773559_c1 3300050491 Bacteria 613
207 nmdc:mga0yw44_922607_c1 3300050492 Bacteria 592
208 nmdc:mga07m45_51470_c1 3300050496 Bacteria 2322
209 nmdc:mga05p37_1818401_c1 3300050507 Bacteria 587
210 nmdc:mga05p37_1980323_c1 3300050507 Bacteria 552
211 nmdc:mga05p37_249603_c1 3300050507 Unclassified 2129
212 nmdc:mga05p37_572695_c1 3300050507 Bacteria 1281
213 nmdc:mga05p37_668369_c1 3300050507 Bacteria 1160
214 nmdc:mga09592_61853_c1 3300050508 Bacteria 3167
215 nmdc:mga06r32_10598_c1 3300050510 Bacteria 8312
216 nmdc:mga06r32_1437593_c1 3300050510 Bacteria 631
217 nmdc:mga06r32_1441949_c1 3300050510 Bacteria 630
218 nmdc:mga0n895_10550_c1 3300050512 Bacteria 8171
219 nmdc:mga0n895_2084374_c1 3300050512 Unclassified 524
220 nmdc:mga0n895_814174_c1 3300050512 Bacteria 924
221 nmdc:mga0rr50_1033786_c1 3300050513 Bacteria 699
222 nmdc:mga0rr50_223439_c1 3300050513 Bacteria 1556
223 nmdc:mga0rr50_521550_c1 3300050513 Unclassified 1011
224 nmdc:mga0a205_153777_c1 3300050515 Bacteria 2199
225 nmdc:mga0a205_977028_c1 3300050515 Bacteria 694
226 nmdc:mga0sz30_440603_c1 3300050516 Bacteria 584
227 Ga0495601_0043755 3300053077 Bacteria 2812
228 Ga0495601_0553331 3300053077 Bacteria 740
229 Ga0495612_0090178 3300053078 Bacteria 1297
230 Ga0495619_0002548 3300053085 Bacteria 11932
231 Ga0495619_0370179 3300053085 Bacteria 990
232 Ga0501084_1584610 3300054114 Bacteria 548
233 Ga0530510_0977505 3300061734 Bacteria 648
234 Ga0105247_10919929
235 Ga0070664_100240607
236 Ga0068859_101685581
237 Ga0068864_101372544
238 Ga0068863_101767341
239 Ga0068858_100279783
240 Ga0068860_100077168
241 Ga0081455_10009207
242 Ga0081455_10036579
243 Ga0081455_10482455
244 Ga0070717_10676943
245 Ga0075364_10735352
246 Ga0075432_10431332
247 Ga0070715_10686863
248 Ga0070712_101075650
249 Ga0075428_100014530
250 Ga0075428_100088981
251 Ga0075428_102462531
252 Ga0075430_100072642
253 Ga0075430_100882543
254 Ga0075430_100971365
255 Ga0075431_100642221
256 Ga0075431_101280180
257 Ga0075431_102001180
258 Ga0075433_10073434
259 Ga0075433_10279063
260 Ga0075433_10726024
261 Ga0075434_100167503
262 Ga0075429_100118895
263 Ga0075429_100588503
264 Ga0075436_100746142
265 Ga0097620_101685926
266 Ga0075435_101085286
267 Ga0099794_10026104
268 Ga0099795_10404956
269 Ga0105247_10025341
270 Ga0105247_11322815
271 Ga0114129_10025350
272 Ga0114129_10235723
273 Ga0105243_10112677
274 Ga0105243_10280616
275 Ga0105248_11347937
276 Ga0105238_13080127
277 Ga0105249_12440463
278 Ga0105246_10150242
279 Ga0105246_10279242
280 Ga0105246_12418619
281 Ga0157329_1001007
282 Ga0157339_1033516
283 Ga0157374_11548580
284 Ga0163162_11264686
285 Ga0163162_11724463
286 Ga0163162_12468297
287 Ga0157372_11592857
288 Ga0157375_12387203
289 Ga0163163_10032425
290 Ga0163163_11449441
291 Ga0157380_10135082
292 Ga0157380_10881057
293 Ga0157380_11288717
294 Ga0157380_12883924
295 Ga0157379_10387394
296 Ga0157376_11659150
297 Ga0157376_12460000
298 Ga0207692_10022977
299 Ga0207688_10857841
300 Ga0207685_10306255
301 Ga0207699_10085818
302 Ga0207684_10307286
303 Ga0207693_10064087
304 Ga0207694_11834940
305 Ga0207650_10017785
306 Ga0207687_10575500
307 Ga0207700_10169943
308 Ga0207690_10138258
309 Ga0207670_10402931
310 Ga0207669_10267727
311 Ga0207669_10765917
312 Ga0207665_10184804
313 Ga0207665_11132056
314 Ga0207691_10047674
315 Ga0207679_11357003
316 Ga0207677_10437795
317 Ga0207708_10070828
318 Ga0209588_1011099
319 Ga0207428_10960954
320 Ga0268264_10395254
321 Ga0268264_12328679
322 Ga0373952_0000440
323 Ga0373945_0033226
324 Ga0373945_0306659
325 Ga0373943_0303000
326 Ga0373943_0358145
327 Ga0373943_0651708
328 Ga0373946_0169019
329 Ga0373962_0053264
330 Ga0373935_0102131
331 Ga0373935_0252673
332 Ga0373935_0712755
333 Ga0373935_1483523
334 Ga0373927_0657537
335 Ga0373927_0697799
336 Ga0373927_1080251
337 Ga0373947_0211046
338 Ga0373937_0884328
339 Ga0373925_0156273
340 Ga0373925_0509510
341 Ga0373925_0522645
342 Ga0373925_1667358
343 Ga0373925_1765470
344 Ga0395901_0123940
345 Ga0395901_1827285
346 Ga0242420_070255
347 Ga0451847_1003035
348 Ga0451843_0021168
349 Ga0439460_0304492
350 Ga0495603_0247384
351 Ga0495603_0248929
352 Ga0495603_0566510
353 Ga0495641_0054533
354 Ga0495641_0218759
355 Ga0495580_0022779
356 Ga0495639_0082698
357 Ga0495662_0302180
358 Ga0495662_0516617
359 Ga0495662_0523080
360 Ga0495594_0371436
361 Ga0495607_0536541
362 Ga0495608_0165270
363 Ga0495618_0126812
364 Ga0495628_0529822
365 Ga0495628_0855871
366 Ga0495628_1209192
367 Ga0495630_0444045
368 Ga0495630_0936382
369 Ga0495652_0600248
370 Ga0495640_0151919
371 Ga0495640_0442758
372 Ga0495609_0278377
373 Ga0495656_0050559
374 Ga0495656_0074637
375 Ga0495634_0034081
376 Ga0495659_0322664
377 Ga0495647_0422384
378 Ga0495647_0547618
379 Ga0495658_0101184
380 Ga0495658_0408875
381 Ga0495658_0710552
382 Ga0495613_0243104
383 Ga0495624_0234418
384 Ga0495670_0107519
385 Ga0495670_0555103
386 Ga0495670_0614899
387 Ga0495581_0618911
388 Ga0495581_0827697
389 Ga0495676_0166505
390 Ga0495676_0291866
391 Ga0495675_0202781
392 Ga0495684_0913914
393 Ga0495593_0456028
394 Ga0496100_0501797
395 Ga0496100_1504933
396 Ga0496101_0593212
397 Ga0496101_0964538
398 Ga0496102_0064862
399 Ga0496102_0082277
400 Ga0496103_0157129
401 Ga0496103_0211877
402 Ga0496103_1044881
403 Ga0496104_0013707
404 Ga0496104_0150249
405 Ga0496104_0662747
406 Ga0496104_1186550
407 Ga0496104_1549754
408 Ga0496104_1716305
409 Ga0496105_0029376
410 Ga0496105_0130914
411 Ga0496105_0319650
412 Ga0496105_0603155
413 Ga0496106_0118292
414 Ga0496106_0340741
415 Ga0496108_0030558
416 Ga0496108_0654850
417 Ga0496108_0659215
418 Ga0496108_0941074
419 Ga0496109_0000219
420 Ga0496109_0003849
421 Ga0496109_0773823
422 Ga0496110_0007523
423 Ga0496110_1047876
424 Ga0496111_1080965
425 Ga0496112_0718399
426 Ga0496113_0070995
427 Ga0496114_0315606
428 Ga0496114_0545348
429 Ga0496114_0616044
430 Ga0496114_1144598
431 Ga0496114_1729791
432 Ga0496115_0236622
433 Ga0496115_0315182
434 Ga0496115_1152561
435 Ga0501225_0236230
436 nmdc:mga03n38_118666_c1
437 nmdc:mga03n38_381580_c1
438 nmdc:mga03n38_971851_c1
439 nmdc:mga00v17_773559_c1
440 nmdc:mga0yw44_922607_c1
441 nmdc:mga07m45_51470_c1
442 nmdc:mga05p37_1818401_c1
443 nmdc:mga05p37_1980323_c1
444 nmdc:mga05p37_249603_c1
445 nmdc:mga05p37_572695_c1
446 nmdc:mga05p37_668369_c1
447 nmdc:mga09592_61853_c1
448 nmdc:mga06r32_10598_c1
449 nmdc:mga06r32_1437593_c1
450 nmdc:mga06r32_1441949_c1
451 nmdc:mga0n895_10550_c1
452 nmdc:mga0n895_2084374_c1
453 nmdc:mga0n895_814174_c1
454 nmdc:mga0rr50_1033786_c1
455 nmdc:mga0rr50_223439_c1
456 nmdc:mga0rr50_521550_c1
457 nmdc:mga0a205_153777_c1
458 nmdc:mga0a205_977028_c1
459 nmdc:mga0sz30_440603_c1
460 Ga0495601_0043755
461 Ga0495601_0553331
462 Ga0495612_0090178
463 Ga0495619_0002548
464 Ga0495619_0370179
465 Ga0501084_1584610
466 Ga0530510_0977505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map