F345990

General Info

Members Datasets Scaffolds Average Seq Length
233 162 181 274

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100153997|Ga0075429_1001539972
Length 305
Sequence VNARPSGPLGDATTAALADDRGAAALAARGLSLAYDDRLVVDDLSIAVPPEAVTVIVGANACGKSTLLRGLARLLAPRTGTVLLDGHDIHRLPTREVATRLGLLPQQPIAPEGITVADLVARGRHPHQRWYRQWSATDEEAVEAALDATHLTELADRTVDELSGGQRQRVWIALTLAQGTGLMLLDEPTTFLDLAHQVEVLDLLAELNRRERRTIVLVLHDLALACRYAHHLVAMKDGAIVAEGDPAAVITPETVEAVFGLACRVISDPLTGTPLVLPIPAARRAPRDAPPAPSPVGNGAGGRAR

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
5 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
6 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
7 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
8 2643221553 Microbacterium sp. Root553 Isolate Unclassified
9 2643221575 Microbacterium sp. Root61 Isolate Unclassified
10 2643221599 Rhizobium sp. Root708 Isolate Unclassified
11 2643221630 Microbacterium sp. Root322 Isolate Unclassified
12 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
13 2643221692 Nocardia sp. Root136 Isolate Unclassified
14 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
15 2751185800 Brucella pituitosa AA2 Isolate Unclassified
16 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
17 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
18 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
19 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
20 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
21 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
22 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
23 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
24 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
25 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
26 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
27 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
28 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
29 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
30 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
31 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
32 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
33 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
34 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
35 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
36 2922554459 Rhodococcus sp. 66b Isolate Unclassified
37 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
38 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
39 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
40 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
41 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
42 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
43 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
44 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
45 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
46 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
152 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
159 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
160 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
161 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
162 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.68
Metatranscriptomes 0
Isolates 22.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.03
Nodule 1.29
Rhizoplane 0.43
Rhizosphere 46.35
Stem 0
Stem Tuber 0
Unclassified 27.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003492 3300002773 Bacteria 5340
2 JGI25152J39213_1013180 3300002773 Bacteria 1734
3 JGI25150J39212_1012121 3300002774 Bacteria 1537
4 rootL2_10302641 3300003322 Bacteria 2069
5 Ga0055542_1007840 3300003762 Bacteria 2131
6 Ga0065165_1007390 3300005262 Bacteria 5416
7 Ga0070663_100018300 3300005455 Bacteria 4590
8 Ga0070678_100448892 3300005456 Bacteria 1129
9 Ga0070665_100139772 3300005548 Bacteria 2425
10 Ga0081455_10001152 3300005937 Bacteria 33136
11 Ga0081538_10000088 3300005981 Bacteria 88922
12 Ga0075365_10019285 3300006038 Bacteria 4207
13 Ga0075365_10031837 3300006038 Bacteria 3386
14 Ga0075365_10264326 3300006038 Bacteria 1210
15 Ga0075368_10010936 3300006042 Bacteria 3292
16 Ga0075363_100009294 3300006048 Bacteria 4618
17 Ga0075363_100012614 3300006048 Bacteria 4077
18 Ga0075364_10003251 3300006051 Bacteria 9202
19 Ga0075364_10008428 3300006051 Bacteria 6161
20 Ga0075364_10028587 3300006051 Bacteria 3570
21 Ga0075364_10170877 3300006051 Bacteria 1469
22 Ga0075364_10392856 3300006051 Bacteria 946
23 Ga0075367_10005276 3300006178 Bacteria 6392
24 Ga0075367_10009926 3300006178 Bacteria 4988
25 Ga0075369_10037095 3300006186 Bacteria 2076
26 Ga0075366_10159409 3300006195 Bacteria 1367
27 Ga0075370_10000790 3300006353 Bacteria 12649
28 Ga0075370_10269426 3300006353 Bacteria 1011
29 Ga0075430_100011247 3300006846 Bacteria 7592
30 Ga0075431_100002312 3300006847 Bacteria 18308
31 Ga0075431_100276762 3300006847 Bacteria 1700
32 Ga0075429_100001668 3300006880 Bacteria 18367
33 Ga0075429_100153997 3300006880 Bacteria 2013
34 Ga0099826_10034225 3300006948 Bacteria 3632
35 Ga0111539_10003677 3300009094 Bacteria 20199
36 Ga0114129_10173021 3300009147 Bacteria 2943
37 Ga0114129_10309204 3300009147 Bacteria 2104
38 Ga0105248_10000065 3300009177 Bacteria 121445
39 Ga0157370_10140697 3300013104 Bacteria 2248
40 Ga0157369_10034491 3300013105 Bacteria 5553
41 Ga0157375_10610560 3300013308 Bacteria 1249
42 Ga0213875_10014200 3300021388 Bacteria 3891
43 Ga0207425_1008390 3300025245 Bacteria 2649
44 Ga0209148_1011765 3300025254 Bacteria 1617
45 Ga0209129_1000019 3300025258 Bacteria 460802
46 Ga0209129_1003722 3300025258 Bacteria 6455
47 Ga0209129_1003876 3300025258 Bacteria 6229
48 Ga0209025_1000131 3300025294 Bacteria 198190
49 Ga0209025_1000186 3300025294 Bacteria 155131
50 Ga0209025_1025299 3300025294 Bacteria 3027
51 Ga0209758_1000599 3300025297 Bacteria 55985
52 Ga0209758_1001288 3300025297 Bacteria 30861
53 Ga0207692_10125999 3300025898 Bacteria 1440
54 Ga0207711_10000113 3300025941 Bacteria 84359
55 Ga0207678_10013722 3300026067 Bacteria 7117
56 Ga0207683_10088131 3300026121 Bacteria 2761
57 Ga0207683_10096227 3300026121 Bacteria 2640
58 Ga0209371_1012840 3300027312 Bacteria 2395
59 Ga0209282_1026640 3300027666 Bacteria 3599
60 Ga0207428_10031351 3300027907 Bacteria 4387
61 Ga0268266_10133885 3300028379 Bacteria 2219
62 Ga0307515_10076091 3300028794 Bacteria 4460
63 Ga0307515_10117796 3300028794 Bacteria 3036
64 Ga0268256_1013627 3300030500 Bacteria 2452
65 Ga0307513_10041795 3300031456 Bacteria 5055
66 Ga0307514_10026639 3300031649 Bacteria 4675
67 Ga0307405_10048130 3300031731 Bacteria 2628
68 Ga0307405_10093446 3300031731 Bacteria 1998
69 Ga0307405_10146355 3300031731 Bacteria 1655
70 Ga0307413_10072752 3300031824 Bacteria 2171
71 Ga0307410_10010017 3300031852 Bacteria 5348
72 Ga0307406_10001715 3300031901 Bacteria 12044
73 Ga0307406_10088961 3300031901 Bacteria 2073
74 Ga0307407_10070771 3300031903 Bacteria 2075
75 Ga0307412_10032182 3300031911 Bacteria 3320
76 Ga0307412_10105507 3300031911 Bacteria 2002
77 Ga0307409_100016031 3300031995 Bacteria 4942
78 Ga0307409_100088639 3300031995 Bacteria 2527
79 Ga0307409_100146635 3300031995 Bacteria 2042
80 Ga0307415_100055767 3300032126 Bacteria 2706
81 Ga0436364_1277263 3300037853 Bacteria 12643
82 Ga0451853_2361757 3300041512 Bacteria 3212
83 Ga0439462_0024483 3300042015 Bacteria 1586
84 Ga0466972_0006129 3300044658 Bacteria 6041
85 Ga0466965_0002428 3300044683 Bacteria 7913
86 Ga0466965_0050302 3300044683 Bacteria 2066
87 Ga0466971_0163700 3300044719 Bacteria 1042
88 Ga0466970_0012520 3300044765 Bacteria 4340
89 Ga0466970_0201954 3300044765 Bacteria 1106
90 Ga0466957_0033662 3300044842 Bacteria 3075
91 Ga0466960_0001606 3300044901 Bacteria 8274
92 Ga0466960_0173106 3300044901 Bacteria 1166
93 Ga0466967_0338331 3300045976 Bacteria 1455
94 Ga0495627_002321 3300046453 Bacteria 9344
95 Ga0495610_0000609 3300046512 Bacteria 35431
96 Ga0495668_0000167 3300046616 Bacteria 97427
97 Ga0495686_0008721 3300047472 Bacteria 7397
98 Ga0495686_0042631 3300047472 Bacteria 2883
99 Ga0496114_0085530 3300048917 Bacteria 2671
100 Ga0496117_0006867 3300048920 Bacteria 11308
101 Ga0496117_0011722 3300048920 Bacteria 7819
102 Ga0496117_0046151 3300048920 Bacteria 3136
103 Ga0496118_0014442 3300048921 Bacteria 7395
104 Ga0496118_0023337 3300048921 Bacteria 5375
105 Ga0496118_0032982 3300048921 Bacteria 4257
106 Ga0496119_0017463 3300048922 Bacteria 5393
107 Ga0496121_0000005 3300048924 Bacteria 1034486
108 Ga0496121_0000015 3300048924 Bacteria 571958
109 Ga0496121_0031089 3300048924 Bacteria 4888
110 Ga0496121_0097250 3300048924 Bacteria 2282
111 Ga0496122_0001463 3300048925 Bacteria 38046
112 Ga0496122_0009718 3300048925 Bacteria 10055
113 Ga0496122_0021643 3300048925 Bacteria 5747
114 Ga0496122_0048943 3300048925 Bacteria 3245
115 Ga0496122_0050427 3300048925 Bacteria 3174
116 Ga0496123_0057348 3300048926 Bacteria 2535
117 Ga0496123_0138920 3300048926 Bacteria 1332
118 Ga0496124_0007535 3300048927 Bacteria 11549
119 Ga0496124_0236636 3300048927 Bacteria 1361
120 Ga0496124_0250718 3300048927 Bacteria 1310
121 Ga0496125_0000086 3300048928 Bacteria 216489
122 Ga0496125_0000107 3300048928 Bacteria 197483
123 Ga0496125_0000275 3300048928 Bacteria 103052
124 Ga0496125_0004665 3300048928 Bacteria 15628
125 Ga0496126_0027855 3300048929 Bacteria 5390
126 Ga0496126_0072079 3300048929 Bacteria 3073
127 Ga0501032_0038862 3300049569 Bacteria 3239
128 Ga0501032_0179276 3300049569 Bacteria 1387
129 Ga0501033_0001347 3300049570 Bacteria 21858
130 Ga0501033_0195347 3300049570 Bacteria 1447
131 Ga0501034_0127940 3300049571 Bacteria 2525
132 Ga0501034_0339151 3300049571 Bacteria 1433
133 Ga0501038_0039499 3300049574 Bacteria 4128
134 Ga0501039_0184439 3300049575 Bacteria 1641
135 Ga0501040_0351132 3300049576 Bacteria 1057
136 Ga0501042_0326836 3300049578 Bacteria 1108
137 Ga0501043_0016002 3300049579 Bacteria 5880
138 Ga0501043_0273305 3300049579 Bacteria 1297
139 Ga0501047_0041838 3300049581 Bacteria 4427
140 Ga0501047_0146817 3300049581 Bacteria 2235
141 Ga0501068_0152263 3300049584 Bacteria 1454
142 Ga0501069_0030955 3300049585 Bacteria 2941
143 Ga0501077_0166384 3300049593 Bacteria 1401
144 Ga0501077_0356242 3300049593 Bacteria 934
145 Ga0501080_0091185 3300049742 Bacteria 2831
146 Ga0501081_0271720 3300049743 Bacteria 1240
147 Ga0501035_0128573 3300049822 Bacteria 2210
148 Ga0501044_0006369 3300049823 Bacteria 13046
149 Ga0501044_0153655 3300049823 Bacteria 2282
150 Ga0501044_0329929 3300049823 Bacteria 1449
151 Ga0501045_0109374 3300049824 Bacteria 2049
152 nmdc:mga00v17_256592_c1 3300050491 Bacteria 1134
153 nmdc:mga00v17_30118_c1 3300050491 Bacteria 3191
154 nmdc:mga00v17_304701_c1 3300050491 Bacteria 1035
155 nmdc:mga00v17_321709_c1 3300050491 Bacteria 1005
156 nmdc:mga00v17_329083_c1 3300050491 Bacteria 993
157 nmdc:mga00v17_56334_c1 3300050491 Bacteria 2403
158 nmdc:mga00v17_6191_c1 3300050491 Bacteria 6344
159 nmdc:mga0yw44_104402_c1 3300050492 Bacteria 1809
160 nmdc:mga0yw44_211_c1 3300050492 Bacteria 20687
161 nmdc:mga0yw44_29189_c1 3300050492 Bacteria 3182
162 nmdc:mga0yw44_9492_c1 3300050492 Bacteria 4925
163 nmdc:mga0k408_11895_c1 3300050493 Bacteria 4748
164 nmdc:mga06z11_4396_c1 3300050494 Bacteria 5547
165 nmdc:mga06z11_89213_c1 3300050494 Bacteria 1671
166 nmdc:mga09592_10687_c1 3300050508 Bacteria 7472
167 nmdc:mga0qj67_682_c1 3300050509 Bacteria 23124
168 nmdc:mga06r32_262870_c1 3300050510 Bacteria 1713
169 nmdc:mga06r32_6401_c1 3300050510 Bacteria 10579
170 nmdc:mga08y16_1284_c1 3300050511 Bacteria 24926
171 nmdc:mga0sz30_51637_c1 3300050516 Bacteria 1744
172 Ga0500566_0009903 3300053094 Bacteria 5628
173 Ga0500554_020117 3300053102 Bacteria 1830
174 Ga0500658_0001709 3300053134 Bacteria 8680
175 Ga0500568_0000300 3300053139 Bacteria 40139
176 Ga0500568_0000571 3300053139 Bacteria 26959
177 Ga0500568_0043578 3300053139 Bacteria 1793
178 Ga0500616_0001381 3300053153 Bacteria 23493
179 Ga0500636_0000034 3300053177 Bacteria 72555
180 Ga0500636_0002504 3300053177 Bacteria 10200
181 Ga0501082_0705572 3300060353 Bacteria 883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0339151 Ga0501034_0339151_671_1420 247
2 3300027312 Ga0209371_1012840 Ga0209371_10128403 252
3 3300030500 Ga0268256_1013627 Ga0268256_10136273 252
4 3300005262 Ga0065165_1007390 Ga0065165_10073904 256
5 iso_pu_bacteria 2643221715 2644637657 257
6 3300049578 Ga0501042_0326836 Ga0501042_0326836_219_1016 258
7 3300053177 Ga0500636_0000034 Ga0500636_0000034_36815_37591 258
8 iso_pu_bacteria 2643221692 2644515964 258
9 iso_pu_bacteria 2643221692 2644518172 258
10 iso_pu_bacteria 2857531043 2857536898 258
11 3300006051 Ga0075364_10008428 Ga0075364_100084286 259
12 3300050491 nmdc:mga00v17_30118_c1 nmdc:mga00v17_30118_c1_1398_2204 259
13 3300005937 Ga0081455_10001152 Ga0081455_1000115224 260
14 3300031903 Ga0307407_10070771 Ga0307407_100707712 260
15 3300031995 Ga0307409_100088639 Ga0307409_1000886393 260
16 iso_pu_bacteria 2862507626 2862516277 260
17 3300050491 nmdc:mga00v17_304701_c1 nmdc:mga00v17_304701_c1_146_961 261
18 iso_pu_bacteria 2751185800 2753361127 261
19 iso_pu_bacteria 2758568016 2758637860 261
20 iso_pu_bacteria 8056207758 8056209911 261
21 3300031731 Ga0307405_10093446 Ga0307405_100934463 262
22 3300044683 Ga0466965_0002428 Ga0466965_0002428_3216_4043 262
23 3300044765 Ga0466970_0012520 Ga0466970_0012520_2271_3098 262
24 3300044842 Ga0466957_0033662 Ga0466957_0033662_1638_2465 262
25 3300044901 Ga0466960_0001606 Ga0466960_0001606_1673_2500 262
26 3300050510 nmdc:mga06r32_262870_c1 nmdc:mga06r32_262870_c1_588_1430 262
27 iso_pu_bacteria 2551306166 2552114162 262
28 iso_pu_bacteria 2643221553 2643784130 262
29 iso_pu_bacteria 2643221630 2644172439 262
30 iso_pu_bacteria 2808606447 2809227219 262
31 iso_pu_bacteria 2852643534 2852643900 262
32 iso_pu_bacteria 2854896431 2854901522 262
33 iso_pu_bacteria 2857723135 2857725620 262
34 iso_pu_bacteria 2870622029 2870624547 262
35 iso_pu_bacteria 2891326441 2891330025 262
36 iso_pu_bacteria 2928521798 2928525256 262
37 iso_pu_bacteria 2929138655 2929143495 262
38 iso_pu_bacteria 2966921586 2966924189 262
39 iso_pu_bacteria 8003314358 8003322482 262
40 iso_pu_bacteria 8055034563 8055037129 262
41 3300005981 Ga0081538_10000088 Ga0081538_100000887 263
42 3300049593 Ga0501077_0356242 Ga0501077_0356242_27_851 263
43 3300049743 Ga0501081_0271720 Ga0501081_0271720_46_870 263
44 3300049824 Ga0501045_0109374 Ga0501045_0109374_838_1662 263
45 3300060353 Ga0501082_0705572 Ga0501082_0705572_30_854 263
46 iso_pu_bacteria 2512047086 2512530430 263
47 iso_pu_bacteria 2928121344 2928122774 263
48 iso_pu_bacteria 2937843397 2937847454 263
49 iso_pu_bacteria 2956939328 2956940022 263
50 3300044658 Ga0466972_0006129 Ga0466972_0006129_2089_2901 264
51 3300044765 Ga0466970_0201954 Ga0466970_0201954_218_1030 264
52 3300044901 Ga0466960_0173106 Ga0466960_0173106_310_1122 264
53 iso_pu_bacteria 2857733635 2857736322 264
54 3300006051 Ga0075364_10170877 Ga0075364_101708772 265
55 3300013104 Ga0157370_10140697 Ga0157370_101406972 265
56 3300025898 Ga0207692_10125999 Ga0207692_101259992 265
57 3300028794 Ga0307515_10117796 Ga0307515_101177962 265
58 3300031649 Ga0307514_10026639 Ga0307514_100266392 265
59 3300031824 Ga0307413_10072752 Ga0307413_100727522 265
60 3300031901 Ga0307406_10001715 Ga0307406_100017158 265
61 3300031911 Ga0307412_10032182 Ga0307412_100321822 265
62 3300042015 Ga0439462_0024483 Ga0439462_0024483_268_1068 265
63 3300046453 Ga0495627_002321 Ga0495627_002321_1445_2245 265
64 3300048924 Ga0496121_0000015 Ga0496121_0000015_563578_564378 265
65 3300048924 Ga0496121_0097250 Ga0496121_0097250_1070_1870 265
66 3300048925 Ga0496122_0021643 Ga0496122_0021643_2772_3572 265
67 3300048925 Ga0496122_0048943 Ga0496122_0048943_2385_3182 265
68 3300048926 Ga0496123_0138920 Ga0496123_0138920_380_1180 265
69 3300048927 Ga0496124_0250718 Ga0496124_0250718_253_1053 265
70 3300048928 Ga0496125_0000086 Ga0496125_0000086_52670_53536 265
71 3300048928 Ga0496125_0000275 Ga0496125_0000275_4894_5691 265
72 3300048928 Ga0496125_0004665 Ga0496125_0004665_5424_6224 265
73 3300048929 Ga0496126_0027855 Ga0496126_0027855_807_1607 265
74 3300050491 nmdc:mga00v17_321709_c1 nmdc:mga00v17_321709_c1_34_834 265
75 3300050491 nmdc:mga00v17_329083_c1 nmdc:mga00v17_329083_c1_48_848 265
76 3300050491 nmdc:mga00v17_56334_c1 nmdc:mga00v17_56334_c1_213_1013 265
77 3300050516 nmdc:mga0sz30_51637_c1 nmdc:mga0sz30_51637_c1_674_1474 265
78 3300053102 Ga0500554_020117 Ga0500554_020117_893_1693 265
79 3300053139 Ga0500568_0000300 Ga0500568_0000300_18896_19696 265
80 iso_pu_bacteria 2510917030 2511193681 265
81 iso_pu_bacteria 2582581294 2585200977 265
82 iso_pu_bacteria 2582581298 2585226163 265
83 iso_pu_bacteria 2585427529 2585548917 265
84 iso_pu_bacteria 2585427594 2585842305 265
85 iso_pu_bacteria 2643221599 2644004922 265
86 iso_pu_bacteria 2758568522 2760306876 265
87 iso_pu_bacteria 2837651117 2837653092 265
88 iso_pu_bacteria 2919100787 2919108506 265
89 iso_pu_bacteria 2922554459 2922555899 265
90 iso_pu_bacteria 2939657138 2939657725 265
91 iso_pu_bacteria 2995392953 2995393911 265
92 iso_pu_bacteria 3005452660 3005458295 265
93 3300003762 Ga0055542_1007840 Ga0055542_10078402 266
94 3300005455 Ga0070663_100018300 Ga0070663_1000183002 266
95 3300005456 Ga0070678_100448892 Ga0070678_1004488922 266
96 3300006038 Ga0075365_10019285 Ga0075365_100192853 266
97 3300006038 Ga0075365_10031837 Ga0075365_100318372 266
98 3300006038 Ga0075365_10264326 Ga0075365_102643262 266
99 3300006051 Ga0075364_10028587 Ga0075364_100285872 266
100 3300006051 Ga0075364_10392856 Ga0075364_103928561 266
101 3300013105 Ga0157369_10034491 Ga0157369_100344912 266
102 3300025254 Ga0209148_1011765 Ga0209148_10117652 266
103 3300026067 Ga0207678_10013722 Ga0207678_100137226 266
104 3300026121 Ga0207683_10088131 Ga0207683_100881314 266
105 3300048920 Ga0496117_0006867 Ga0496117_0006867_8697_9509 266
106 3300048922 Ga0496119_0017463 Ga0496119_0017463_3774_4586 266
107 3300048924 Ga0496121_0000005 Ga0496121_0000005_511232_512044 266
108 3300048925 Ga0496122_0050427 Ga0496122_0050427_1633_2445 266
109 3300048926 Ga0496123_0057348 Ga0496123_0057348_854_1666 266
110 3300048927 Ga0496124_0007535 Ga0496124_0007535_3661_4473 266
111 3300048928 Ga0496125_0000107 Ga0496125_0000107_189787_190599 266
112 3300048929 Ga0496126_0072079 Ga0496126_0072079_2165_2977 266
113 3300049569 Ga0501032_0179276 Ga0501032_0179276_21_848 266
114 3300049574 Ga0501038_0039499 Ga0501038_0039499_1631_2458 266
115 3300049575 Ga0501039_0184439 Ga0501039_0184439_759_1586 266
116 3300049576 Ga0501040_0351132 Ga0501040_0351132_193_1008 266
117 3300049581 Ga0501047_0146817 Ga0501047_0146817_442_1269 266
118 3300049593 Ga0501077_0166384 Ga0501077_0166384_344_1159 266
119 3300049742 Ga0501080_0091185 Ga0501080_0091185_1755_2585 266
120 3300049823 Ga0501044_0153655 Ga0501044_0153655_1432_2262 266
121 3300050491 nmdc:mga00v17_6191_c1 nmdc:mga00v17_6191_c1_3202_4014 266
122 3300050492 nmdc:mga0yw44_104402_c1 nmdc:mga0yw44_104402_c1_886_1692 266
123 3300050492 nmdc:mga0yw44_211_c1 nmdc:mga0yw44_211_c1_121_948 266
124 3300050492 nmdc:mga0yw44_29189_c1 nmdc:mga0yw44_29189_c1_1662_2465 266
125 3300050492 nmdc:mga0yw44_9492_c1 nmdc:mga0yw44_9492_c1_1526_2338 266
126 iso_pu_bacteria 2643221673 2644403553 266
127 iso_pu_bacteria 2775507049 2776910683 266
128 iso_pu_bacteria 2811994880 2812364433 266
129 iso_pu_bacteria 2852677369 2852679652 266
130 iso_pu_bacteria 2857729791 2857732435 266
131 iso_pu_bacteria 2862290372 2862295770 266
132 iso_pu_bacteria 2875391855 2875392207 266
133 iso_pu_bacteria 2946045630 2946052683 266
134 iso_pu_bacteria 8008485437 8008488543 266
135 iso_pu_bacteria 8025524527 8025525060 266
136 3300006042 Ga0075368_10010936 Ga0075368_100109362 267
137 3300006048 Ga0075363_100012614 Ga0075363_1000126143 267
138 3300006353 Ga0075370_10000790 Ga0075370_100007906 267
139 3300006847 Ga0075431_100276762 Ga0075431_1002767622 267
140 3300006948 Ga0099826_10034225 Ga0099826_100342252 267
141 3300009177 Ga0105248_10000065 Ga0105248_1000006525 267
142 3300021388 Ga0213875_10014200 Ga0213875_100142001 267
143 3300025941 Ga0207711_10000113 Ga0207711_1000011360 267
144 3300027666 Ga0209282_1026640 Ga0209282_10266402 267
145 3300028794 Ga0307515_10076091 Ga0307515_100760913 267
146 3300031456 Ga0307513_10041795 Ga0307513_100417955 267
147 3300031852 Ga0307410_10010017 Ga0307410_100100172 267
148 3300031911 Ga0307412_10105507 Ga0307412_101055072 267
149 3300031995 Ga0307409_100016031 Ga0307409_1000160314 267
150 3300032126 Ga0307415_100055767 Ga0307415_1000557671 267
151 3300037853 Ga0436364_1277263 Ga0436364_1277263_10525_11328 267
152 3300048917 Ga0496114_0085530 Ga0496114_0085530_217_1053 267
153 3300048920 Ga0496117_0011722 Ga0496117_0011722_2960_3811 267
154 3300048920 Ga0496117_0046151 Ga0496117_0046151_619_1485 267
155 3300048921 Ga0496118_0014442 Ga0496118_0014442_4243_5094 267
156 3300048921 Ga0496118_0023337 Ga0496118_0023337_2278_3144 267
157 3300048925 Ga0496122_0001463 Ga0496122_0001463_20217_21083 267
158 3300049570 Ga0501033_0195347 Ga0501033_0195347_229_1062 267
159 3300049579 Ga0501043_0273305 Ga0501043_0273305_154_987 267
160 3300049585 Ga0501069_0030955 Ga0501069_0030955_140_946 267
161 3300049822 Ga0501035_0128573 Ga0501035_0128573_234_1067 267
162 3300050491 nmdc:mga00v17_256592_c1 nmdc:mga00v17_256592_c1_139_1056 267
163 3300050493 nmdc:mga0k408_11895_c1 nmdc:mga0k408_11895_c1_3075_3917 267
164 3300050494 nmdc:mga06z11_89213_c1 nmdc:mga06z11_89213_c1_83_925 267
165 3300053153 Ga0500616_0001381 Ga0500616_0001381_5222_6034 267
166 3300006051 Ga0075364_10003251 Ga0075364_100032512 268
167 3300006846 Ga0075430_100011247 Ga0075430_1000112478 268
168 3300006847 Ga0075431_100002312 Ga0075431_1000023127 268
169 3300006880 Ga0075429_100001668 Ga0075429_1000016686 268
170 3300006880 Ga0075429_100153997 Ga0075429_1001539972 268
171 3300009094 Ga0111539_10003677 Ga0111539_1000367713 268
172 3300009147 Ga0114129_10173021 Ga0114129_101730212 268
173 3300009147 Ga0114129_10309204 Ga0114129_103092042 268
174 3300026121 Ga0207683_10096227 Ga0207683_100962273 268
175 3300027907 Ga0207428_10031351 Ga0207428_100313515 268
176 3300031731 Ga0307405_10146355 Ga0307405_101463552 268
177 3300041512 Ga0451853_2361757 Ga0451853_2361757_1638_2453 268
178 3300046616 Ga0495668_0000167 Ga0495668_0000167_29571_30386 268
179 3300049570 Ga0501033_0001347 Ga0501033_0001347_3960_4769 268
180 3300049823 Ga0501044_0006369 Ga0501044_0006369_9064_9873 268
181 3300049823 Ga0501044_0329929 Ga0501044_0329929_61_870 268
182 3300050508 nmdc:mga09592_10687_c1 nmdc:mga09592_10687_c1_4334_5194 268
183 3300050509 nmdc:mga0qj67_682_c1 nmdc:mga0qj67_682_c1_7324_8184 268
184 3300050510 nmdc:mga06r32_6401_c1 nmdc:mga06r32_6401_c1_7664_8524 268
185 3300050511 nmdc:mga08y16_1284_c1 nmdc:mga08y16_1284_c1_16023_16940 268
186 3300053094 Ga0500566_0009903 Ga0500566_0009903_3865_4674 268
187 iso_pu_bacteria 2643221575 2643885191 268
188 3300002773 JGI25152J39213_1003492 JGI25152J39213_10034923 269
189 3300002773 JGI25152J39213_1013180 JGI25152J39213_10131802 269
190 3300002774 JGI25150J39212_1012121 JGI25150J39212_10121212 269
191 3300003322 rootL2_10302641 rootL2_103026412 269
192 3300005548 Ga0070665_100139772 Ga0070665_1001397722 269
193 3300006048 Ga0075363_100009294 Ga0075363_1000092944 269
194 3300006178 Ga0075367_10005276 Ga0075367_100052768 269
195 3300006178 Ga0075367_10009926 Ga0075367_100099263 269
196 3300006186 Ga0075369_10037095 Ga0075369_100370952 269
197 3300006195 Ga0075366_10159409 Ga0075366_101594092 269
198 3300006353 Ga0075370_10269426 Ga0075370_102694261 269
199 3300013308 Ga0157375_10610560 Ga0157375_106105602 269
200 3300025245 Ga0207425_1008390 Ga0207425_10083903 269
201 3300025258 Ga0209129_1000019 Ga0209129_1000019228 269
202 3300025258 Ga0209129_1003722 Ga0209129_10037224 269
203 3300025258 Ga0209129_1003876 Ga0209129_10038764 269
204 3300025294 Ga0209025_1000131 Ga0209025_1000131164 269
205 3300025294 Ga0209025_1000186 Ga0209025_100018699 269
206 3300025294 Ga0209025_1025299 Ga0209025_10252993 269
207 3300025297 Ga0209758_1000599 Ga0209758_100059923 269
208 3300025297 Ga0209758_1001288 Ga0209758_100128824 269
209 3300028379 Ga0268266_10133885 Ga0268266_101338852 269
210 3300031731 Ga0307405_10048130 Ga0307405_100481302 269
211 3300031901 Ga0307406_10088961 Ga0307406_100889612 269
212 3300031995 Ga0307409_100146635 Ga0307409_1001466352 269
213 3300044683 Ga0466965_0050302 Ga0466965_0050302_976_1794 269
214 3300044719 Ga0466971_0163700 Ga0466971_0163700_200_1018 269
215 3300045976 Ga0466967_0338331 Ga0466967_0338331_189_1007 269
216 3300046512 Ga0495610_0000609 Ga0495610_0000609_7241_8068 269
217 3300047472 Ga0495686_0008721 Ga0495686_0008721_2418_3245 269
218 3300047472 Ga0495686_0042631 Ga0495686_0042631_963_1805 269
219 3300048921 Ga0496118_0032982 Ga0496118_0032982_555_1397 269
220 3300048924 Ga0496121_0031089 Ga0496121_0031089_2966_3808 269
221 3300048925 Ga0496122_0009718 Ga0496122_0009718_3363_4205 269
222 3300048927 Ga0496124_0236636 Ga0496124_0236636_145_987 269
223 3300049569 Ga0501032_0038862 Ga0501032_0038862_2070_2912 269
224 3300049571 Ga0501034_0127940 Ga0501034_0127940_1048_1890 269
225 3300049579 Ga0501043_0016002 Ga0501043_0016002_2961_3803 269
226 3300049581 Ga0501047_0041838 Ga0501047_0041838_2177_3019 269
227 3300049584 Ga0501068_0152263 Ga0501068_0152263_515_1357 269
228 3300050494 nmdc:mga06z11_4396_c1 nmdc:mga06z11_4396_c1_2836_3672 269
229 3300053134 Ga0500658_0001709 Ga0500658_0001709_2199_3041 269
230 3300053139 Ga0500568_0000571 Ga0500568_0000571_20583_21437 269
231 3300053139 Ga0500568_0043578 Ga0500568_0043578_221_1033 269
232 3300053177 Ga0500636_0002504 Ga0500636_0002504_798_1640 269
233 iso_pu_bacteria 2773857762 2774393720 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

190

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9292 6 239
7lb8-assembly1.cif.gz_C structure of a ferrichrome importer fhucdb from e. coli 0.9252 6 258
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9203 6 229
1l7v-assembly1.cif.gz_D bacterial abc transporter involved in b12 uptake 0.9191 5 241
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9182 5 231
ID Description Score Start End Superfamily
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9841 6 255 3.40.50.300
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9763 6 255 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9684 7 257 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9683 6 260 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9609 7 257 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I6IZ31-F1-model_v4 Iron complex transport system ATP-binding protein 0.9656 1 258 GO:0005524
GO:0005886
GO:0016887
AF-A0A1V6IK79-F1-model_v4 Putative siderophore transport system ATP-binding protein YusV 0.953 5 240 GO:0005524
GO:0016887
AF-A0A3S4YU32-F1-model_v4 Probable siderophore transport system ATP-binding protein YusV 0.9455 1 120 GO:0005524
GO:0005886
GO:0006811
GO:0016887
AF-A0A3D2CY35-F1-model_v4 deleted 0.9444 1 153
AF-A0A7C6ZN50-F1-model_v4 ABC transporter ATP-binding protein 0.9438 5 120 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map