F345981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 233 | 159 | 217 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100054884|Ga0075430_1000548842 |
| Length | 272 |
| Sequence | VGPTFLSASWDGLLANRQGTTAPHCLARNRRGSASEVRLDRFRAPLQEISDLLVVTDLTKEYPTPRGFLPVLSSIHFSLQRGEAASIMGPSGSGKSTLLYVLGTLEPPTSGTVTLDGQDPFRLDERALAAFRNEKVGFVFQDHCLLPQLSVLENVLAPTLVGKRDNGVVDRARDLLSQVGLDQRLDHRPAELSGGEKQRVALARGLIRQPALLLCDEPTGNLDRRSADAVAALLLDLHRTRQTILVVVTHSPELAARFPLRFEIQEQQLKRM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 2 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 3 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 4 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 5 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 6 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 7 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 8 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 9 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 10 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 11 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 12 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 13 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 80 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 85 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 95 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 102 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 104 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 105 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 106 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 107 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 108 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 109 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 110 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 111 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 112 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 117 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 118 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 119 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 120 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 121 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 122 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 123 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 146 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 147 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 155 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 157 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 158 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 159 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.13 |
| Metatranscriptomes | 0 |
| Isolates | 6.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.58 |
| Nodule | 0.86 |
| Rhizoplane | 0.43 |
| Rhizosphere | 90.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10116307 | 3300005289 | Bacteria | 1856 |
| 2 | Ga0070670_100654966 | 3300005331 | Bacteria | 942 |
| 3 | Ga0070677_10347316 | 3300005333 | Bacteria | 768 |
| 4 | Ga0068869_100354653 | 3300005334 | Bacteria | 1196 |
| 5 | Ga0070689_100203080 | 3300005340 | Bacteria | 1619 |
| 6 | Ga0070689_100315208 | 3300005340 | Bacteria | 1305 |
| 7 | Ga0070692_10184961 | 3300005345 | Bacteria | 1210 |
| 8 | Ga0070668_100930607 | 3300005347 | Bacteria | 778 |
| 9 | Ga0070669_100178212 | 3300005353 | Bacteria | 1661 |
| 10 | Ga0070675_100300704 | 3300005354 | Bacteria | 1413 |
| 11 | Ga0070674_100038331 | 3300005356 | Bacteria | 3229 |
| 12 | Ga0070688_100009468 | 3300005365 | Bacteria | 5329 |
| 13 | Ga0070688_100227986 | 3300005365 | Bacteria | 1316 |
| 14 | Ga0070713_100014795 | 3300005436 | Bacteria | 5807 |
| 15 | Ga0070705_100001697 | 3300005440 | Bacteria | 11497 |
| 16 | Ga0070705_100176563 | 3300005440 | Bacteria | 1443 |
| 17 | Ga0070705_100348451 | 3300005440 | Bacteria | 1079 |
| 18 | Ga0070700_100716679 | 3300005441 | Bacteria | 797 |
| 19 | Ga0070694_100002103 | 3300005444 | Bacteria | 11807 |
| 20 | Ga0070694_100251844 | 3300005444 | Bacteria | 1336 |
| 21 | Ga0070694_100485774 | 3300005444 | Bacteria | 981 |
| 22 | Ga0070707_100347865 | 3300005468 | Bacteria | 1440 |
| 23 | Ga0070698_100318723 | 3300005471 | Bacteria | 1485 |
| 24 | Ga0070699_100000013 | 3300005518 | Bacteria | 241303 |
| 25 | Ga0070699_100503994 | 3300005518 | Bacteria | 1100 |
| 26 | Ga0070696_100000046 | 3300005546 | Bacteria | 56631 |
| 27 | Ga0070693_100004072 | 3300005547 | Bacteria | 6881 |
| 28 | Ga0070664_100353704 | 3300005564 | Bacteria | 1337 |
| 29 | Ga0068857_100107491 | 3300005577 | Bacteria | 2506 |
| 30 | Ga0068859_100223901 | 3300005617 | Bacteria | 1969 |
| 31 | Ga0068864_100068502 | 3300005618 | Unclassified | 3083 |
| 32 | Ga0068864_100282641 | 3300005618 | Bacteria | 1549 |
| 33 | Ga0068862_100029410 | 3300005844 | Bacteria | 4630 |
| 34 | Ga0068862_100344464 | 3300005844 | Bacteria | 1381 |
| 35 | Ga0081455_10009032 | 3300005937 | Bacteria | 10289 |
| 36 | Ga0081455_10014083 | 3300005937 | Bacteria | 7860 |
| 37 | Ga0070717_10117305 | 3300006028 | Bacteria | 2277 |
| 38 | Ga0075364_10010528 | 3300006051 | Bacteria | 5590 |
| 39 | Ga0075428_100001335 | 3300006844 | Bacteria | 26174 |
| 40 | Ga0075428_100177017 | 3300006844 | Bacteria | 2310 |
| 41 | Ga0075428_100278456 | 3300006844 | Bacteria | 1800 |
| 42 | Ga0075428_100292805 | 3300006844 | Bacteria | 1751 |
| 43 | Ga0075428_100732318 | 3300006844 | Bacteria | 1052 |
| 44 | Ga0075430_100054884 | 3300006846 | Unclassified | 3352 |
| 45 | Ga0075430_100097383 | 3300006846 | Bacteria | 2458 |
| 46 | Ga0075431_100074387 | 3300006847 | Unclassified | 3505 |
| 47 | Ga0075431_100097152 | 3300006847 | Bacteria | 3041 |
| 48 | Ga0075431_100270585 | 3300006847 | Bacteria | 1722 |
| 49 | Ga0075433_10071516 | 3300006852 | Bacteria | 3049 |
| 50 | Ga0075433_10092144 | 3300006852 | Bacteria | 2680 |
| 51 | Ga0075433_10152661 | 3300006852 | Bacteria | 2054 |
| 52 | Ga0075433_10212169 | 3300006852 | Bacteria | 1720 |
| 53 | Ga0075434_100188533 | 3300006871 | Bacteria | 2082 |
| 54 | Ga0075429_100035260 | 3300006880 | Bacteria | 4351 |
| 55 | Ga0075429_100788035 | 3300006880 | Bacteria | 832 |
| 56 | Ga0097620_100223907 | 3300006931 | Bacteria | 1969 |
| 57 | Ga0079104_1001968 | 3300006946 | Bacteria | 12102 |
| 58 | Ga0105251_10000459 | 3300009011 | Bacteria | 38899 |
| 59 | Ga0105251_10001761 | 3300009011 | Bacteria | 18051 |
| 60 | Ga0105251_10002284 | 3300009011 | Bacteria | 15190 |
| 61 | Ga0105244_10002389 | 3300009036 | Bacteria | 14223 |
| 62 | Ga0111539_10069238 | 3300009094 | Bacteria | 4167 |
| 63 | Ga0111539_10092661 | 3300009094 | Unclassified | 3550 |
| 64 | Ga0111539_10152729 | 3300009094 | Bacteria | 2702 |
| 65 | Ga0111539_10263498 | 3300009094 | Bacteria | 2006 |
| 66 | Ga0111539_10375333 | 3300009094 | Bacteria | 1655 |
| 67 | Ga0105245_10042233 | 3300009098 | Bacteria | 4068 |
| 68 | Ga0105247_10000087 | 3300009101 | Bacteria | 99467 |
| 69 | Ga0114129_10000922 | 3300009147 | Bacteria | 38366 |
| 70 | Ga0114129_10007241 | 3300009147 | Bacteria | 15797 |
| 71 | Ga0114129_10653360 | 3300009147 | Bacteria | 1357 |
| 72 | Ga0114129_11037285 | 3300009147 | Bacteria | 1030 |
| 73 | Ga0105243_10771034 | 3300009148 | Bacteria | 945 |
| 74 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 75 | Ga0105248_10888576 | 3300009177 | Unclassified | 1006 |
| 76 | Ga0105249_10153195 | 3300009553 | Bacteria | 2221 |
| 77 | Ga0157373_10003930 | 3300013100 | Bacteria | 11225 |
| 78 | Ga0157378_10029193 | 3300013297 | Bacteria | 4868 |
| 79 | Ga0157375_10562013 | 3300013308 | Bacteria | 1302 |
| 80 | Ga0182008_10001728 | 3300014497 | Bacteria | 14336 |
| 81 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 82 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 83 | Ga0207655_1000037 | 3300025728 | Bacteria | 354473 |
| 84 | Ga0207713_1000090 | 3300025735 | Bacteria | 151060 |
| 85 | Ga0207713_1000291 | 3300025735 | Bacteria | 57789 |
| 86 | Ga0207713_1004286 | 3300025735 | Bacteria | 9301 |
| 87 | Ga0207653_10000166 | 3300025885 | Bacteria | 46688 |
| 88 | Ga0207710_10000052 | 3300025900 | Bacteria | 181113 |
| 89 | Ga0207684_10000184 | 3300025910 | Bacteria | 100205 |
| 90 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 91 | Ga0207646_10454898 | 3300025922 | Bacteria | 1155 |
| 92 | Ga0207700_10009956 | 3300025928 | Bacteria | 5970 |
| 93 | Ga0207670_10008991 | 3300025936 | Bacteria | 5668 |
| 94 | Ga0207670_10450886 | 3300025936 | Bacteria | 1037 |
| 95 | Ga0207669_10025931 | 3300025937 | Bacteria | 3179 |
| 96 | Ga0207679_10819061 | 3300025945 | Bacteria | 849 |
| 97 | Ga0207668_10857112 | 3300025972 | Bacteria | 807 |
| 98 | Ga0207674_10309351 | 3300026116 | Bacteria | 1529 |
| 99 | Ga0207674_10640907 | 3300026116 | Bacteria | 1026 |
| 100 | Ga0209281_1000027 | 3300027111 | Bacteria | 463409 |
| 101 | Ga0207428_10002703 | 3300027907 | Bacteria | 17677 |
| 102 | Ga0207428_10029037 | 3300027907 | Bacteria | 4589 |
| 103 | Ga0207428_10084103 | 3300027907 | Bacteria | 2480 |
| 104 | Ga0268265_10011025 | 3300028380 | Bacteria | 6105 |
| 105 | Ga0268265_10221448 | 3300028380 | Bacteria | 1656 |
| 106 | Ga0265338_10006267 | 3300028800 | Bacteria | 15221 |
| 107 | Ga0265332_10061573 | 3300031238 | Bacteria | 1604 |
| 108 | Ga0265325_10000351 | 3300031241 | Bacteria | 32491 |
| 109 | Ga0265339_10000211 | 3300031249 | Bacteria | 47974 |
| 110 | Ga0265331_10000311 | 3300031250 | Bacteria | 53260 |
| 111 | Ga0307408_100006281 | 3300031548 | Bacteria | 7888 |
| 112 | Ga0265313_10000323 | 3300031595 | Bacteria | 52193 |
| 113 | Ga0265314_10000161 | 3300031711 | Bacteria | 101910 |
| 114 | Ga0265342_10009433 | 3300031712 | Bacteria | 6882 |
| 115 | Ga0307405_10005136 | 3300031731 | Bacteria | 6272 |
| 116 | Ga0307413_10025687 | 3300031824 | Bacteria | 3233 |
| 117 | Ga0307410_10024854 | 3300031852 | Bacteria | 3748 |
| 118 | Ga0307406_10032250 | 3300031901 | Bacteria | 3197 |
| 119 | Ga0307407_10005302 | 3300031903 | Bacteria | 5577 |
| 120 | Ga0307412_10035676 | 3300031911 | Bacteria | 3179 |
| 121 | Ga0307409_100019925 | 3300031995 | Bacteria | 4556 |
| 122 | Ga0307416_100045281 | 3300032002 | Bacteria | 3463 |
| 123 | Ga0307416_100175578 | 3300032002 | Bacteria | 2001 |
| 124 | Ga0307416_100321767 | 3300032002 | Bacteria | 1549 |
| 125 | Ga0307414_10033537 | 3300032004 | Bacteria | 3395 |
| 126 | Ga0307411_10017500 | 3300032005 | Bacteria | 4086 |
| 127 | Ga0307411_10035821 | 3300032005 | Bacteria | 3103 |
| 128 | Ga0373955_0221206 | 3300035172 | Bacteria | 1131 |
| 129 | Ga0373937_0004595 | 3300036401 | Bacteria | 11716 |
| 130 | Ga0439461_0025708 | 3300041410 | Bacteria | 1197 |
| 131 | Ga0439466_0012623 | 3300041411 | Bacteria | 3107 |
| 132 | Ga0439431_0004548 | 3300041997 | Bacteria | 3049 |
| 133 | Ga0439433_0039786 | 3300041999 | Bacteria | 1092 |
| 134 | Ga0439432_030774 | 3300042006 | Bacteria | 1739 |
| 135 | Ga0450923_008276 | 3300042125 | Bacteria | 1785 |
| 136 | Ga0439446_0012742 | 3300042156 | Bacteria | 2299 |
| 137 | Ga0439434_0006449 | 3300042435 | Bacteria | 3427 |
| 138 | Ga0453684_0794911 | 3300044712 | Bacteria | 1021 |
| 139 | Ga0495627_000093 | 3300046453 | Bacteria | 108767 |
| 140 | Ga0495654_0001122 | 3300046530 | Bacteria | 19324 |
| 141 | Ga0495654_0202578 | 3300046530 | Bacteria | 848 |
| 142 | Ga0495589_0000004 | 3300046794 | Bacteria | 439891 |
| 143 | Ga0495684_0078913 | 3300047471 | Bacteria | 2499 |
| 144 | Ga0496106_0562216 | 3300048909 | Bacteria | 915 |
| 145 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 146 | Ga0496117_0016347 | 3300048920 | Bacteria | 6264 |
| 147 | Ga0496117_0066837 | 3300048920 | Bacteria | 2436 |
| 148 | Ga0496118_0018223 | 3300048921 | Bacteria | 6343 |
| 149 | Ga0496119_0006779 | 3300048922 | Bacteria | 10503 |
| 150 | Ga0496119_0015718 | 3300048922 | Bacteria | 5804 |
| 151 | Ga0496120_0001534 | 3300048923 | Bacteria | 27135 |
| 152 | Ga0496120_0001978 | 3300048923 | Bacteria | 22352 |
| 153 | Ga0496124_0000021 | 3300048927 | Bacteria | 432123 |
| 154 | Ga0501034_0097182 | 3300049571 | Bacteria | 2941 |
| 155 | Ga0501036_0095530 | 3300049572 | Bacteria | 2512 |
| 156 | Ga0501037_0240277 | 3300049573 | Bacteria | 1270 |
| 157 | Ga0501038_0186160 | 3300049574 | Bacteria | 1673 |
| 158 | Ga0501038_0585222 | 3300049574 | Bacteria | 846 |
| 159 | Ga0501040_0216995 | 3300049576 | Bacteria | 1361 |
| 160 | Ga0501041_0073670 | 3300049577 | Bacteria | 2098 |
| 161 | Ga0501041_0171355 | 3300049577 | Bacteria | 1358 |
| 162 | Ga0501043_0051746 | 3300049579 | Bacteria | 3227 |
| 163 | Ga0501046_0161090 | 3300049580 | Bacteria | 1687 |
| 164 | Ga0501046_0393295 | 3300049580 | Bacteria | 1002 |
| 165 | Ga0501046_0541088 | 3300049580 | Bacteria | 831 |
| 166 | Ga0501047_0003557 | 3300049581 | Bacteria | 14708 |
| 167 | Ga0501048_0031907 | 3300049582 | Bacteria | 3809 |
| 168 | Ga0501048_0391662 | 3300049582 | Bacteria | 993 |
| 169 | Ga0501070_0000273 | 3300049586 | Bacteria | 48925 |
| 170 | Ga0501071_0021239 | 3300049587 | Bacteria | 4519 |
| 171 | Ga0501071_0078487 | 3300049587 | Bacteria | 2413 |
| 172 | Ga0501071_0123791 | 3300049587 | Bacteria | 1918 |
| 173 | Ga0501071_0292002 | 3300049587 | Bacteria | 1235 |
| 174 | Ga0501072_0023909 | 3300049588 | Bacteria | 4749 |
| 175 | Ga0501072_0251245 | 3300049588 | Bacteria | 1408 |
| 176 | Ga0501072_0301334 | 3300049588 | Bacteria | 1274 |
| 177 | Ga0501074_0095853 | 3300049590 | Bacteria | 2125 |
| 178 | Ga0501074_0334087 | 3300049590 | Bacteria | 1076 |
| 179 | Ga0501075_0083189 | 3300049591 | Bacteria | 2424 |
| 180 | Ga0501075_0097787 | 3300049591 | Bacteria | 2228 |
| 181 | Ga0501076_0248503 | 3300049592 | Bacteria | 1455 |
| 182 | Ga0501079_0197470 | 3300049741 | Bacteria | 1571 |
| 183 | Ga0501079_0301004 | 3300049741 | Bacteria | 1255 |
| 184 | Ga0501080_0130167 | 3300049742 | Bacteria | 2330 |
| 185 | Ga0501080_0612441 | 3300049742 | Bacteria | 966 |
| 186 | Ga0501081_0193914 | 3300049743 | Bacteria | 1472 |
| 187 | Ga0501035_0204905 | 3300049822 | Bacteria | 1690 |
| 188 | Ga0501044_0438573 | 3300049823 | Bacteria | 1214 |
| 189 | Ga0501045_0037924 | 3300049824 | Bacteria | 3505 |
| 190 | Ga0501045_0143475 | 3300049824 | Bacteria | 1776 |
| 191 | Ga0501045_0207119 | 3300049824 | Bacteria | 1461 |
| 192 | nmdc:mga00v17_140565_c1 | 3300050491 | Bacteria | 1548 |
| 193 | nmdc:mga06z11_18380_c1 | 3300050494 | Bacteria | 3192 |
| 194 | nmdc:mga07m45_50525_c1 | 3300050496 | Bacteria | 2343 |
| 195 | nmdc:mga05p37_1443_c1 | 3300050507 | Bacteria | 27640 |
| 196 | nmdc:mga05p37_161042_c1 | 3300050507 | Bacteria | 2741 |
| 197 | nmdc:mga05p37_2966_c1 | 3300050507 | Bacteria | 19700 |
| 198 | nmdc:mga05p37_38733_c1 | 3300050507 | Bacteria | 5849 |
| 199 | nmdc:mga05p37_485268_c1 | 3300050507 | Bacteria | 1422 |
| 200 | nmdc:mga09592_24699_c1 | 3300050508 | Bacteria | 4970 |
| 201 | nmdc:mga09592_479989_c1 | 3300050508 | Bacteria | 1071 |
| 202 | nmdc:mga0qj67_98880_c1 | 3300050509 | Bacteria | 2350 |
| 203 | nmdc:mga06r32_152888_c1 | 3300050510 | Bacteria | 2287 |
| 204 | nmdc:mga06r32_32963_c1 | 3300050510 | Bacteria | 4877 |
| 205 | nmdc:mga06r32_90518_c1 | 3300050510 | Bacteria | 2989 |
| 206 | nmdc:mga08y16_176119_c1 | 3300050511 | Unclassified | 2221 |
| 207 | nmdc:mga08y16_17960_c1 | 3300050511 | Bacteria | 7452 |
| 208 | nmdc:mga08y16_302778_c1 | 3300050511 | Bacteria | 1648 |
| 209 | nmdc:mga08y16_9854_c1 | 3300050511 | Bacteria | 10032 |
| 210 | nmdc:mga0a205_23925_c1 | 3300050515 | Bacteria | 5798 |
| 211 | nmdc:mga0a205_82171_c1 | 3300050515 | Bacteria | 3112 |
| 212 | Ga0500555_062889 | 3300053103 | Bacteria | 994 |
| 213 | Ga0501082_0064001 | 3300060353 | Bacteria | 3167 |
| 214 | Ga0501082_0094591 | 3300060353 | Bacteria | 2582 |
| 215 | Ga0501082_0136935 | 3300060353 | Bacteria | 2125 |
| 216 | Ga0530510_0025749 | 3300061734 | Bacteria | 4208 |
| 217 | Ga0530510_0120410 | 3300061734 | Bacteria | 1926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0078487 | Ga0501071_0078487_268_855 | 192 |
| 2 | 3300049588 | Ga0501072_0301334 | Ga0501072_0301334_376_963 | 192 |
| 3 | 3300049591 | Ga0501075_0097787 | Ga0501075_0097787_834_1421 | 192 |
| 4 | 3300049824 | Ga0501045_0207119 | Ga0501045_0207119_348_935 | 192 |
| 5 | 3300009147 | Ga0114129_10000922 | Ga0114129_1000092218 | 195 |
| 6 | 3300005354 | Ga0070675_100300704 | Ga0070675_1003007042 | 209 |
| 7 | 3300005353 | Ga0070669_100178212 | Ga0070669_1001782121 | 212 |
| 8 | 3300005444 | Ga0070694_100485774 | Ga0070694_1004857741 | 212 |
| 9 | 3300031548 | Ga0307408_100006281 | Ga0307408_1000062812 | 220 |
| 10 | 3300031731 | Ga0307405_10005136 | Ga0307405_100051362 | 220 |
| 11 | 3300031824 | Ga0307413_10025687 | Ga0307413_100256872 | 220 |
| 12 | 3300031852 | Ga0307410_10024854 | Ga0307410_100248543 | 220 |
| 13 | 3300031901 | Ga0307406_10032250 | Ga0307406_100322502 | 220 |
| 14 | 3300031903 | Ga0307407_10005302 | Ga0307407_100053022 | 220 |
| 15 | 3300031911 | Ga0307412_10035676 | Ga0307412_100356762 | 220 |
| 16 | 3300031995 | Ga0307409_100019925 | Ga0307409_1000199254 | 220 |
| 17 | 3300032002 | Ga0307416_100045281 | Ga0307416_1000452812 | 220 |
| 18 | 3300032004 | Ga0307414_10033537 | Ga0307414_100335373 | 220 |
| 19 | 3300032005 | Ga0307411_10035821 | Ga0307411_100358213 | 220 |
| 20 | 3300048909 | Ga0496106_0562216 | Ga0496106_0562216_41_703 | 220 |
| 21 | 3300049580 | Ga0501046_0393295 | Ga0501046_0393295_128_790 | 220 |
| 22 | 3300049587 | Ga0501071_0292002 | Ga0501071_0292002_553_1215 | 220 |
| 23 | 3300049590 | Ga0501074_0334087 | Ga0501074_0334087_336_1004 | 220 |
| 24 | 3300005331 | Ga0070670_100654966 | Ga0070670_1006549661 | 221 |
| 25 | 3300005340 | Ga0070689_100203080 | Ga0070689_1002030801 | 221 |
| 26 | 3300005340 | Ga0070689_100315208 | Ga0070689_1003152082 | 221 |
| 27 | 3300005345 | Ga0070692_10184961 | Ga0070692_101849612 | 221 |
| 28 | 3300005347 | Ga0070668_100930607 | Ga0070668_1009306071 | 221 |
| 29 | 3300005365 | Ga0070688_100009468 | Ga0070688_1000094682 | 221 |
| 30 | 3300005440 | Ga0070705_100001697 | Ga0070705_10000169710 | 221 |
| 31 | 3300005444 | Ga0070694_100002103 | Ga0070694_1000021035 | 221 |
| 32 | 3300005468 | Ga0070707_100347865 | Ga0070707_1003478652 | 221 |
| 33 | 3300005564 | Ga0070664_100353704 | Ga0070664_1003537042 | 221 |
| 34 | 3300005577 | Ga0068857_100107491 | Ga0068857_1001074912 | 221 |
| 35 | 3300005617 | Ga0068859_100223901 | Ga0068859_1002239012 | 221 |
| 36 | 3300005618 | Ga0068864_100068502 | Ga0068864_1000685022 | 221 |
| 37 | 3300005618 | Ga0068864_100282641 | Ga0068864_1002826412 | 221 |
| 38 | 3300005937 | Ga0081455_10014083 | Ga0081455_100140833 | 221 |
| 39 | 3300006844 | Ga0075428_100177017 | Ga0075428_1001770172 | 221 |
| 40 | 3300006844 | Ga0075428_100278456 | Ga0075428_1002784562 | 221 |
| 41 | 3300006844 | Ga0075428_100292805 | Ga0075428_1002928052 | 221 |
| 42 | 3300006852 | Ga0075433_10092144 | Ga0075433_100921442 | 221 |
| 43 | 3300006871 | Ga0075434_100188533 | Ga0075434_1001885331 | 221 |
| 44 | 3300006880 | Ga0075429_100788035 | Ga0075429_1007880351 | 221 |
| 45 | 3300006931 | Ga0097620_100223907 | Ga0097620_1002239072 | 221 |
| 46 | 3300009094 | Ga0111539_10375333 | Ga0111539_103753332 | 221 |
| 47 | 3300009147 | Ga0114129_10653360 | Ga0114129_106533602 | 221 |
| 48 | 3300009177 | Ga0105248_10888576 | Ga0105248_108885761 | 221 |
| 49 | 3300013297 | Ga0157378_10029193 | Ga0157378_100291932 | 221 |
| 50 | 3300025885 | Ga0207653_10000166 | Ga0207653_1000016611 | 221 |
| 51 | 3300025910 | Ga0207684_10000184 | Ga0207684_1000018448 | 221 |
| 52 | 3300025922 | Ga0207646_10454898 | Ga0207646_104548981 | 221 |
| 53 | 3300025936 | Ga0207670_10008991 | Ga0207670_100089911 | 221 |
| 54 | 3300025936 | Ga0207670_10450886 | Ga0207670_104508862 | 221 |
| 55 | 3300025945 | Ga0207679_10819061 | Ga0207679_108190612 | 221 |
| 56 | 3300025972 | Ga0207668_10857112 | Ga0207668_108571121 | 221 |
| 57 | 3300026116 | Ga0207674_10640907 | Ga0207674_106409071 | 221 |
| 58 | 3300049571 | Ga0501034_0097182 | Ga0501034_0097182_1611_2276 | 221 |
| 59 | 3300049572 | Ga0501036_0095530 | Ga0501036_0095530_1260_1925 | 221 |
| 60 | 3300049576 | Ga0501040_0216995 | Ga0501040_0216995_63_728 | 221 |
| 61 | 3300049577 | Ga0501041_0073670 | Ga0501041_0073670_971_1636 | 221 |
| 62 | 3300049582 | Ga0501048_0031907 | Ga0501048_0031907_2439_3104 | 221 |
| 63 | 3300049587 | Ga0501071_0021239 | Ga0501071_0021239_2587_3252 | 221 |
| 64 | 3300049587 | Ga0501071_0123791 | Ga0501071_0123791_229_894 | 221 |
| 65 | 3300049588 | Ga0501072_0023909 | Ga0501072_0023909_3489_4154 | 221 |
| 66 | 3300049590 | Ga0501074_0095853 | Ga0501074_0095853_1025_1690 | 221 |
| 67 | 3300049741 | Ga0501079_0301004 | Ga0501079_0301004_501_1166 | 221 |
| 68 | 3300049742 | Ga0501080_0130167 | Ga0501080_0130167_1231_1896 | 221 |
| 69 | 3300049742 | Ga0501080_0612441 | Ga0501080_0612441_273_938 | 221 |
| 70 | 3300049822 | Ga0501035_0204905 | Ga0501035_0204905_360_1025 | 221 |
| 71 | 3300049824 | Ga0501045_0037924 | Ga0501045_0037924_2376_3041 | 221 |
| 72 | 3300050507 | nmdc:mga05p37_161042_c1 | nmdc:mga05p37_161042_c1_1936_2601 | 221 |
| 73 | 3300050507 | nmdc:mga05p37_2966_c1 | nmdc:mga05p37_2966_c1_9282_9947 | 221 |
| 74 | 3300050507 | nmdc:mga05p37_38733_c1 | nmdc:mga05p37_38733_c1_3488_4153 | 221 |
| 75 | 3300050510 | nmdc:mga06r32_32963_c1 | nmdc:mga06r32_32963_c1_197_862 | 221 |
| 76 | 3300050511 | nmdc:mga08y16_176119_c1 | nmdc:mga08y16_176119_c1_1111_1776 | 221 |
| 77 | 3300053103 | Ga0500555_062889 | Ga0500555_062889_279_944 | 221 |
| 78 | 3300060353 | Ga0501082_0064001 | Ga0501082_0064001_2334_2999 | 221 |
| 79 | 3300060353 | Ga0501082_0136935 | Ga0501082_0136935_510_1175 | 221 |
| 80 | 3300061734 | Ga0530510_0120410 | Ga0530510_0120410_903_1568 | 221 |
| 81 | 3300005333 | Ga0070677_10347316 | Ga0070677_103473161 | 222 |
| 82 | 3300005356 | Ga0070674_100038331 | Ga0070674_1000383312 | 222 |
| 83 | 3300005365 | Ga0070688_100227986 | Ga0070688_1002279861 | 222 |
| 84 | 3300005441 | Ga0070700_100716679 | Ga0070700_1007166791 | 222 |
| 85 | 3300005518 | Ga0070699_100503994 | Ga0070699_1005039942 | 222 |
| 86 | 3300005844 | Ga0068862_100029410 | Ga0068862_1000294103 | 222 |
| 87 | 3300006844 | Ga0075428_100732318 | Ga0075428_1007323181 | 222 |
| 88 | 3300009094 | Ga0111539_10069238 | Ga0111539_100692382 | 222 |
| 89 | 3300009094 | Ga0111539_10152729 | Ga0111539_101527292 | 222 |
| 90 | 3300009147 | Ga0114129_10007241 | Ga0114129_100072412 | 222 |
| 91 | 3300025937 | Ga0207669_10025931 | Ga0207669_100259312 | 222 |
| 92 | 3300027907 | Ga0207428_10084103 | Ga0207428_100841032 | 222 |
| 93 | 3300028380 | Ga0268265_10011025 | Ga0268265_100110254 | 222 |
| 94 | 3300032002 | Ga0307416_100175578 | Ga0307416_1001755782 | 222 |
| 95 | 3300032002 | Ga0307416_100321767 | Ga0307416_1003217672 | 222 |
| 96 | 3300032005 | Ga0307411_10017500 | Ga0307411_100175002 | 222 |
| 97 | 3300041997 | Ga0439431_0004548 | Ga0439431_0004548_497_1180 | 222 |
| 98 | 3300041999 | Ga0439433_0039786 | Ga0439433_0039786_175_858 | 222 |
| 99 | 3300042156 | Ga0439446_0012742 | Ga0439446_0012742_1591_2274 | 222 |
| 100 | 3300049577 | Ga0501041_0171355 | Ga0501041_0171355_394_1062 | 222 |
| 101 | 3300049580 | Ga0501046_0541088 | Ga0501046_0541088_19_687 | 222 |
| 102 | 3300049582 | Ga0501048_0391662 | Ga0501048_0391662_251_919 | 222 |
| 103 | 3300049588 | Ga0501072_0251245 | Ga0501072_0251245_321_989 | 222 |
| 104 | 3300049591 | Ga0501075_0083189 | Ga0501075_0083189_1519_2187 | 222 |
| 105 | 3300049592 | Ga0501076_0248503 | Ga0501076_0248503_311_979 | 222 |
| 106 | 3300050507 | nmdc:mga05p37_1443_c1 | nmdc:mga05p37_1443_c1_17091_17768 | 222 |
| 107 | 3300050508 | nmdc:mga09592_479989_c1 | nmdc:mga09592_479989_c1_167_835 | 222 |
| 108 | 3300050511 | nmdc:mga08y16_302778_c1 | nmdc:mga08y16_302778_c1_904_1572 | 222 |
| 109 | 3300060353 | Ga0501082_0094591 | Ga0501082_0094591_104_772 | 222 |
| 110 | 3300061734 | Ga0530510_0025749 | Ga0530510_0025749_2737_3405 | 222 |
| 111 | 3300005436 | Ga0070713_100014795 | Ga0070713_1000147953 | 223 |
| 112 | 3300006028 | Ga0070717_10117305 | Ga0070717_101173052 | 223 |
| 113 | 3300006852 | Ga0075433_10071516 | Ga0075433_100715162 | 223 |
| 114 | 3300009147 | Ga0114129_11037285 | Ga0114129_110372851 | 223 |
| 115 | 3300025928 | Ga0207700_10009956 | Ga0207700_100099563 | 223 |
| 116 | 3300035172 | Ga0373955_0221206 | Ga0373955_0221206_390_1067 | 223 |
| 117 | 3300036401 | Ga0373937_0004595 | Ga0373937_0004595_5965_6642 | 223 |
| 118 | 3300049573 | Ga0501037_0240277 | Ga0501037_0240277_486_1163 | 223 |
| 119 | 3300049574 | Ga0501038_0186160 | Ga0501038_0186160_142_813 | 223 |
| 120 | 3300049574 | Ga0501038_0585222 | Ga0501038_0585222_45_722 | 223 |
| 121 | 3300049741 | Ga0501079_0197470 | Ga0501079_0197470_171_842 | 223 |
| 122 | 3300050515 | nmdc:mga0a205_82171_c1 | nmdc:mga0a205_82171_c1_1799_2479 | 223 |
| 123 | 3300005471 | Ga0070698_100318723 | Ga0070698_1003187232 | 224 |
| 124 | 3300044712 | Ga0453684_0794911 | Ga0453684_0794911_257_931 | 224 |
| 125 | 3300006051 | Ga0075364_10010528 | Ga0075364_100105282 | 225 |
| 126 | 3300006846 | Ga0075430_100097383 | Ga0075430_1000973832 | 225 |
| 127 | 3300006847 | Ga0075431_100097152 | Ga0075431_1000971524 | 225 |
| 128 | 3300006852 | Ga0075433_10152661 | Ga0075433_101526612 | 225 |
| 129 | 3300027907 | Ga0207428_10002703 | Ga0207428_100027039 | 225 |
| 130 | 3300041410 | Ga0439461_0025708 | Ga0439461_0025708_66_752 | 225 |
| 131 | 3300042435 | Ga0439434_0006449 | Ga0439434_0006449_2299_2985 | 225 |
| 132 | 3300049743 | Ga0501081_0193914 | Ga0501081_0193914_760_1452 | 225 |
| 133 | 3300050491 | nmdc:mga00v17_140565_c1 | nmdc:mga00v17_140565_c1_584_1279 | 225 |
| 134 | 3300050494 | nmdc:mga06z11_18380_c1 | nmdc:mga06z11_18380_c1_1915_2610 | 225 |
| 135 | 3300050496 | nmdc:mga07m45_50525_c1 | nmdc:mga07m45_50525_c1_95_790 | 225 |
| 136 | 3300050507 | nmdc:mga05p37_485268_c1 | nmdc:mga05p37_485268_c1_321_1013 | 225 |
| 137 | 3300050510 | nmdc:mga06r32_90518_c1 | nmdc:mga06r32_90518_c1_1396_2088 | 225 |
| 138 | 3300050511 | nmdc:mga08y16_9854_c1 | nmdc:mga08y16_9854_c1_5389_6081 | 225 |
| 139 | 3300050515 | nmdc:mga0a205_23925_c1 | nmdc:mga0a205_23925_c1_1013_1705 | 225 |
| 140 | 3300005444 | Ga0070694_100251844 | Ga0070694_1002518441 | 226 |
| 141 | 3300005844 | Ga0068862_100344464 | Ga0068862_1003444641 | 226 |
| 142 | 3300006844 | Ga0075428_100001335 | Ga0075428_1000013359 | 226 |
| 143 | 3300006846 | Ga0075430_100054884 | Ga0075430_1000548842 | 226 |
| 144 | 3300006847 | Ga0075431_100074387 | Ga0075431_1000743872 | 226 |
| 145 | 3300006852 | Ga0075433_10212169 | Ga0075433_102121692 | 226 |
| 146 | 3300006880 | Ga0075429_100035260 | Ga0075429_1000352603 | 226 |
| 147 | 3300009094 | Ga0111539_10092661 | Ga0111539_100926612 | 226 |
| 148 | 3300009553 | Ga0105249_10153195 | Ga0105249_101531954 | 226 |
| 149 | 3300013308 | Ga0157375_10562013 | Ga0157375_105620132 | 226 |
| 150 | 3300027907 | Ga0207428_10029037 | Ga0207428_100290374 | 226 |
| 151 | 3300028380 | Ga0268265_10221448 | Ga0268265_102214482 | 226 |
| 152 | 3300049579 | Ga0501043_0051746 | Ga0501043_0051746_1792_2472 | 226 |
| 153 | 3300049580 | Ga0501046_0161090 | Ga0501046_0161090_260_940 | 226 |
| 154 | 3300049581 | Ga0501047_0003557 | Ga0501047_0003557_11911_12591 | 226 |
| 155 | 3300049586 | Ga0501070_0000273 | Ga0501070_0000273_19543_20223 | 226 |
| 156 | 3300049823 | Ga0501044_0438573 | Ga0501044_0438573_91_771 | 226 |
| 157 | 3300050508 | nmdc:mga09592_24699_c1 | nmdc:mga09592_24699_c1_1317_1997 | 226 |
| 158 | 3300050511 | nmdc:mga08y16_17960_c1 | nmdc:mga08y16_17960_c1_2337_3017 | 226 |
| 159 | 3300005334 | Ga0068869_100354653 | Ga0068869_1003546531 | 227 |
| 160 | 3300006847 | Ga0075431_100270585 | Ga0075431_1002705852 | 227 |
| 161 | 3300009094 | Ga0111539_10263498 | Ga0111539_102634982 | 227 |
| 162 | 3300009098 | Ga0105245_10042233 | Ga0105245_100422332 | 227 |
| 163 | 3300026116 | Ga0207674_10309351 | Ga0207674_103093512 | 227 |
| 164 | 3300047471 | Ga0495684_0078913 | Ga0495684_0078913_518_1213 | 227 |
| 165 | 3300050509 | nmdc:mga0qj67_98880_c1 | nmdc:mga0qj67_98880_c1_377_1060 | 227 |
| 166 | 3300050510 | nmdc:mga06r32_152888_c1 | nmdc:mga06r32_152888_c1_1290_1973 | 227 |
| 167 | 3300005440 | Ga0070705_100176563 | Ga0070705_1001765631 | 228 |
| 168 | 3300005440 | Ga0070705_100348451 | Ga0070705_1003484512 | 228 |
| 169 | 3300005518 | Ga0070699_100000013 | Ga0070699_10000001318 | 228 |
| 170 | 3300005546 | Ga0070696_100000046 | Ga0070696_10000004611 | 228 |
| 171 | 3300028800 | Ga0265338_10006267 | Ga0265338_100062679 | 228 |
| 172 | 3300031238 | Ga0265332_10061573 | Ga0265332_100615732 | 228 |
| 173 | 3300031241 | Ga0265325_10000351 | Ga0265325_100003512 | 228 |
| 174 | 3300031249 | Ga0265339_10000211 | Ga0265339_1000021118 | 228 |
| 175 | 3300031250 | Ga0265331_10000311 | Ga0265331_1000031140 | 228 |
| 176 | 3300031595 | Ga0265313_10000323 | Ga0265313_100003232 | 228 |
| 177 | 3300031711 | Ga0265314_10000161 | Ga0265314_1000016156 | 228 |
| 178 | 3300031712 | Ga0265342_10009433 | Ga0265342_100094333 | 228 |
| 179 | 3300049824 | Ga0501045_0143475 | Ga0501045_0143475_559_1245 | 228 |
| 180 | 3300005547 | Ga0070693_100004072 | Ga0070693_1000040727 | 229 |
| 181 | 3300005937 | Ga0081455_10009032 | Ga0081455_100090322 | 229 |
| 182 | 3300009148 | Ga0105243_10771034 | Ga0105243_107710342 | 229 |
| 183 | 3300042125 | Ga0450923_008276 | Ga0450923_008276_663_1361 | 229 |
| 184 | iso_pu_bacteria | 2506520007 | 2506578019 | 230 |
| 185 | iso_pu_bacteria | 2506520008 | 2506583157 | 230 |
| 186 | iso_pu_bacteria | 2508501071 | 2508851990 | 230 |
| 187 | iso_pu_bacteria | 2654587920 | 2656275348 | 230 |
| 188 | iso_pu_bacteria | 2687453601 | 2689444550 | 230 |
| 189 | iso_pu_bacteria | 2772190666 | 2772438568 | 230 |
| 190 | iso_pu_bacteria | 2806310673 | 2807176885 | 230 |
| 191 | iso_pu_bacteria | 2869551831 | 2869553919 | 230 |
| 192 | iso_pu_bacteria | 2888366609 | 2888368633 | 230 |
| 193 | iso_pu_bacteria | 2888373701 | 2888373825 | 230 |
| 194 | iso_pu_bacteria | 2932406140 | 2932409679 | 230 |
| 195 | iso_pu_bacteria | 2937967321 | 2937970364 | 230 |
| 196 | iso_pu_bacteria | 2939577877 | 2939578797 | 230 |
| 197 | iso_pu_bacteria | 640753048 | 640937540 | 230 |
| 198 | iso_pu_bacteria | 8004592986 | 8004595530 | 230 |
| 199 | iso_pu_bacteria | 8015394850 | 8015395478 | 230 |
| 200 | 3300005289 | Ga0065704_10116307 | Ga0065704_101163072 | 234 |
| 201 | 3300006946 | Ga0079104_1001968 | Ga0079104_10019682 | 234 |
| 202 | 3300009011 | Ga0105251_10000459 | Ga0105251_1000045921 | 234 |
| 203 | 3300009011 | Ga0105251_10001761 | Ga0105251_100017615 | 234 |
| 204 | 3300009011 | Ga0105251_10002284 | Ga0105251_100022845 | 234 |
| 205 | 3300009036 | Ga0105244_10002389 | Ga0105244_1000238911 | 234 |
| 206 | 3300009101 | Ga0105247_10000087 | Ga0105247_1000008758 | 234 |
| 207 | 3300009174 | Ga0105241_10000002 | Ga0105241_10000002706 | 234 |
| 208 | 3300013100 | Ga0157373_10003930 | Ga0157373_100039308 | 234 |
| 209 | 3300014497 | Ga0182008_10001728 | Ga0182008_100017287 | 234 |
| 210 | 3300017792 | Ga0163161_10000001 | Ga0163161_10000001774 | 234 |
| 211 | 3300025711 | Ga0207696_1000001 | Ga0207696_1000001852 | 234 |
| 212 | 3300025728 | Ga0207655_1000037 | Ga0207655_100003725 | 234 |
| 213 | 3300025735 | Ga0207713_1000090 | Ga0207713_100009036 | 234 |
| 214 | 3300025735 | Ga0207713_1000291 | Ga0207713_100029121 | 234 |
| 215 | 3300025735 | Ga0207713_1004286 | Ga0207713_10042865 | 234 |
| 216 | 3300025900 | Ga0207710_10000052 | Ga0207710_100000524 | 234 |
| 217 | 3300025911 | Ga0207654_10000005 | Ga0207654_10000005704 | 234 |
| 218 | 3300027111 | Ga0209281_1000027 | Ga0209281_100002725 | 234 |
| 219 | 3300041411 | Ga0439466_0012623 | Ga0439466_0012623_1751_2455 | 234 |
| 220 | 3300042006 | Ga0439432_030774 | Ga0439432_030774_670_1374 | 234 |
| 221 | 3300046453 | Ga0495627_000093 | Ga0495627_000093_22685_23389 | 234 |
| 222 | 3300046530 | Ga0495654_0001122 | Ga0495654_0001122_7114_7818 | 234 |
| 223 | 3300046530 | Ga0495654_0202578 | Ga0495654_0202578_82_786 | 234 |
| 224 | 3300046794 | Ga0495589_0000004 | Ga0495589_0000004_220372_221076 | 234 |
| 225 | 3300048919 | Ga0496116_0000001 | Ga0496116_0000001_262654_263358 | 234 |
| 226 | 3300048920 | Ga0496117_0016347 | Ga0496117_0016347_2222_2926 | 234 |
| 227 | 3300048920 | Ga0496117_0066837 | Ga0496117_0066837_407_1111 | 234 |
| 228 | 3300048921 | Ga0496118_0018223 | Ga0496118_0018223_5123_5827 | 234 |
| 229 | 3300048922 | Ga0496119_0006779 | Ga0496119_0006779_9633_10337 | 234 |
| 230 | 3300048922 | Ga0496119_0015718 | Ga0496119_0015718_5067_5771 | 234 |
| 231 | 3300048923 | Ga0496120_0001534 | Ga0496120_0001534_9188_9892 | 234 |
| 232 | 3300048923 | Ga0496120_0001978 | Ga0496120_0001978_10613_11317 | 234 |
| 233 | 3300048927 | Ga0496124_0000021 | Ga0496124_0000021_307689_308393 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9692 | 5 | 226 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9673 | 5 | 226 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9664 | 5 | 231 |
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9642 | 6 | 230 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9635 | 5 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9819 | 3 | 230 | 3.40.50.300 |
| af_P0A9T8_2_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9764 | 4 | 227 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9756 | 5 | 225 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9735 | 3 | 230 | 3.40.50.300 |
| af_P14175_33_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9719 | 25 | 226 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661KN18-F1-model_v4 | Lipoprotein-releasing system ATP-binding protein LolD | 0.9911 | 86 | 227 |
GO:0005524
GO:0016887 |
| AF-A0A089I4Y8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9892 | 7 | 226 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A3D2CRM9-F1-model_v4 | Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) | 0.9884 | 4 | 229 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0044874 GO:0089705 |
| AF-A0A6L4YFH5-F1-model_v4 | Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) | 0.9871 | 1 | 225 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0044874 GO:0089705 |
| AF-A0A223S3N0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9854 | 1 | 225 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar