F345981

General Info

Members Datasets Scaffolds Average Seq Length
233 159 217 226

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100054884|Ga0075430_1000548842
Length 272
Sequence VGPTFLSASWDGLLANRQGTTAPHCLARNRRGSASEVRLDRFRAPLQEISDLLVVTDLTKEYPTPRGFLPVLSSIHFSLQRGEAASIMGPSGSGKSTLLYVLGTLEPPTSGTVTLDGQDPFRLDERALAAFRNEKVGFVFQDHCLLPQLSVLENVLAPTLVGKRDNGVVDRARDLLSQVGLDQRLDHRPAELSGGEKQRVALARGLIRQPALLLCDEPTGNLDRRSADAVAALLLDLHRTRQTILVVVTHSPELAARFPLRFEIQEQQLKRM

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
5 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
6 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
7 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
8 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
9 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
10 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
11 2932406140 Serratia sp. 2723 Isolate Rhizosphere
12 2937967321 Serratia sp. YC16 Isolate Unclassified
13 2939577877 Serratia sp. 509 Isolate Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 640753048 Serratia proteamaculans 568 Isolate Endosphere
158 8004592986 Serratia sp. S119 Isolate Unclassified
159 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.13
Metatranscriptomes 0
Isolates 6.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0.86
Rhizoplane 0.43
Rhizosphere 90.13
Stem 0
Stem Tuber 0
Unclassified 6.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10116307 3300005289 Bacteria 1856
2 Ga0070670_100654966 3300005331 Bacteria 942
3 Ga0070677_10347316 3300005333 Bacteria 768
4 Ga0068869_100354653 3300005334 Bacteria 1196
5 Ga0070689_100203080 3300005340 Bacteria 1619
6 Ga0070689_100315208 3300005340 Bacteria 1305
7 Ga0070692_10184961 3300005345 Bacteria 1210
8 Ga0070668_100930607 3300005347 Bacteria 778
9 Ga0070669_100178212 3300005353 Bacteria 1661
10 Ga0070675_100300704 3300005354 Bacteria 1413
11 Ga0070674_100038331 3300005356 Bacteria 3229
12 Ga0070688_100009468 3300005365 Bacteria 5329
13 Ga0070688_100227986 3300005365 Bacteria 1316
14 Ga0070713_100014795 3300005436 Bacteria 5807
15 Ga0070705_100001697 3300005440 Bacteria 11497
16 Ga0070705_100176563 3300005440 Bacteria 1443
17 Ga0070705_100348451 3300005440 Bacteria 1079
18 Ga0070700_100716679 3300005441 Bacteria 797
19 Ga0070694_100002103 3300005444 Bacteria 11807
20 Ga0070694_100251844 3300005444 Bacteria 1336
21 Ga0070694_100485774 3300005444 Bacteria 981
22 Ga0070707_100347865 3300005468 Bacteria 1440
23 Ga0070698_100318723 3300005471 Bacteria 1485
24 Ga0070699_100000013 3300005518 Bacteria 241303
25 Ga0070699_100503994 3300005518 Bacteria 1100
26 Ga0070696_100000046 3300005546 Bacteria 56631
27 Ga0070693_100004072 3300005547 Bacteria 6881
28 Ga0070664_100353704 3300005564 Bacteria 1337
29 Ga0068857_100107491 3300005577 Bacteria 2506
30 Ga0068859_100223901 3300005617 Bacteria 1969
31 Ga0068864_100068502 3300005618 Unclassified 3083
32 Ga0068864_100282641 3300005618 Bacteria 1549
33 Ga0068862_100029410 3300005844 Bacteria 4630
34 Ga0068862_100344464 3300005844 Bacteria 1381
35 Ga0081455_10009032 3300005937 Bacteria 10289
36 Ga0081455_10014083 3300005937 Bacteria 7860
37 Ga0070717_10117305 3300006028 Bacteria 2277
38 Ga0075364_10010528 3300006051 Bacteria 5590
39 Ga0075428_100001335 3300006844 Bacteria 26174
40 Ga0075428_100177017 3300006844 Bacteria 2310
41 Ga0075428_100278456 3300006844 Bacteria 1800
42 Ga0075428_100292805 3300006844 Bacteria 1751
43 Ga0075428_100732318 3300006844 Bacteria 1052
44 Ga0075430_100054884 3300006846 Unclassified 3352
45 Ga0075430_100097383 3300006846 Bacteria 2458
46 Ga0075431_100074387 3300006847 Unclassified 3505
47 Ga0075431_100097152 3300006847 Bacteria 3041
48 Ga0075431_100270585 3300006847 Bacteria 1722
49 Ga0075433_10071516 3300006852 Bacteria 3049
50 Ga0075433_10092144 3300006852 Bacteria 2680
51 Ga0075433_10152661 3300006852 Bacteria 2054
52 Ga0075433_10212169 3300006852 Bacteria 1720
53 Ga0075434_100188533 3300006871 Bacteria 2082
54 Ga0075429_100035260 3300006880 Bacteria 4351
55 Ga0075429_100788035 3300006880 Bacteria 832
56 Ga0097620_100223907 3300006931 Bacteria 1969
57 Ga0079104_1001968 3300006946 Bacteria 12102
58 Ga0105251_10000459 3300009011 Bacteria 38899
59 Ga0105251_10001761 3300009011 Bacteria 18051
60 Ga0105251_10002284 3300009011 Bacteria 15190
61 Ga0105244_10002389 3300009036 Bacteria 14223
62 Ga0111539_10069238 3300009094 Bacteria 4167
63 Ga0111539_10092661 3300009094 Unclassified 3550
64 Ga0111539_10152729 3300009094 Bacteria 2702
65 Ga0111539_10263498 3300009094 Bacteria 2006
66 Ga0111539_10375333 3300009094 Bacteria 1655
67 Ga0105245_10042233 3300009098 Bacteria 4068
68 Ga0105247_10000087 3300009101 Bacteria 99467
69 Ga0114129_10000922 3300009147 Bacteria 38366
70 Ga0114129_10007241 3300009147 Bacteria 15797
71 Ga0114129_10653360 3300009147 Bacteria 1357
72 Ga0114129_11037285 3300009147 Bacteria 1030
73 Ga0105243_10771034 3300009148 Bacteria 945
74 Ga0105241_10000002 3300009174 Bacteria 869480
75 Ga0105248_10888576 3300009177 Unclassified 1006
76 Ga0105249_10153195 3300009553 Bacteria 2221
77 Ga0157373_10003930 3300013100 Bacteria 11225
78 Ga0157378_10029193 3300013297 Bacteria 4868
79 Ga0157375_10562013 3300013308 Bacteria 1302
80 Ga0182008_10001728 3300014497 Bacteria 14336
81 Ga0163161_10000001 3300017792 Bacteria 2041488
82 Ga0207696_1000001 3300025711 Bacteria 2579611
83 Ga0207655_1000037 3300025728 Bacteria 354473
84 Ga0207713_1000090 3300025735 Bacteria 151060
85 Ga0207713_1000291 3300025735 Bacteria 57789
86 Ga0207713_1004286 3300025735 Bacteria 9301
87 Ga0207653_10000166 3300025885 Bacteria 46688
88 Ga0207710_10000052 3300025900 Bacteria 181113
89 Ga0207684_10000184 3300025910 Bacteria 100205
90 Ga0207654_10000005 3300025911 Bacteria 869492
91 Ga0207646_10454898 3300025922 Bacteria 1155
92 Ga0207700_10009956 3300025928 Bacteria 5970
93 Ga0207670_10008991 3300025936 Bacteria 5668
94 Ga0207670_10450886 3300025936 Bacteria 1037
95 Ga0207669_10025931 3300025937 Bacteria 3179
96 Ga0207679_10819061 3300025945 Bacteria 849
97 Ga0207668_10857112 3300025972 Bacteria 807
98 Ga0207674_10309351 3300026116 Bacteria 1529
99 Ga0207674_10640907 3300026116 Bacteria 1026
100 Ga0209281_1000027 3300027111 Bacteria 463409
101 Ga0207428_10002703 3300027907 Bacteria 17677
102 Ga0207428_10029037 3300027907 Bacteria 4589
103 Ga0207428_10084103 3300027907 Bacteria 2480
104 Ga0268265_10011025 3300028380 Bacteria 6105
105 Ga0268265_10221448 3300028380 Bacteria 1656
106 Ga0265338_10006267 3300028800 Bacteria 15221
107 Ga0265332_10061573 3300031238 Bacteria 1604
108 Ga0265325_10000351 3300031241 Bacteria 32491
109 Ga0265339_10000211 3300031249 Bacteria 47974
110 Ga0265331_10000311 3300031250 Bacteria 53260
111 Ga0307408_100006281 3300031548 Bacteria 7888
112 Ga0265313_10000323 3300031595 Bacteria 52193
113 Ga0265314_10000161 3300031711 Bacteria 101910
114 Ga0265342_10009433 3300031712 Bacteria 6882
115 Ga0307405_10005136 3300031731 Bacteria 6272
116 Ga0307413_10025687 3300031824 Bacteria 3233
117 Ga0307410_10024854 3300031852 Bacteria 3748
118 Ga0307406_10032250 3300031901 Bacteria 3197
119 Ga0307407_10005302 3300031903 Bacteria 5577
120 Ga0307412_10035676 3300031911 Bacteria 3179
121 Ga0307409_100019925 3300031995 Bacteria 4556
122 Ga0307416_100045281 3300032002 Bacteria 3463
123 Ga0307416_100175578 3300032002 Bacteria 2001
124 Ga0307416_100321767 3300032002 Bacteria 1549
125 Ga0307414_10033537 3300032004 Bacteria 3395
126 Ga0307411_10017500 3300032005 Bacteria 4086
127 Ga0307411_10035821 3300032005 Bacteria 3103
128 Ga0373955_0221206 3300035172 Bacteria 1131
129 Ga0373937_0004595 3300036401 Bacteria 11716
130 Ga0439461_0025708 3300041410 Bacteria 1197
131 Ga0439466_0012623 3300041411 Bacteria 3107
132 Ga0439431_0004548 3300041997 Bacteria 3049
133 Ga0439433_0039786 3300041999 Bacteria 1092
134 Ga0439432_030774 3300042006 Bacteria 1739
135 Ga0450923_008276 3300042125 Bacteria 1785
136 Ga0439446_0012742 3300042156 Bacteria 2299
137 Ga0439434_0006449 3300042435 Bacteria 3427
138 Ga0453684_0794911 3300044712 Bacteria 1021
139 Ga0495627_000093 3300046453 Bacteria 108767
140 Ga0495654_0001122 3300046530 Bacteria 19324
141 Ga0495654_0202578 3300046530 Bacteria 848
142 Ga0495589_0000004 3300046794 Bacteria 439891
143 Ga0495684_0078913 3300047471 Bacteria 2499
144 Ga0496106_0562216 3300048909 Bacteria 915
145 Ga0496116_0000001 3300048919 Bacteria 1501681
146 Ga0496117_0016347 3300048920 Bacteria 6264
147 Ga0496117_0066837 3300048920 Bacteria 2436
148 Ga0496118_0018223 3300048921 Bacteria 6343
149 Ga0496119_0006779 3300048922 Bacteria 10503
150 Ga0496119_0015718 3300048922 Bacteria 5804
151 Ga0496120_0001534 3300048923 Bacteria 27135
152 Ga0496120_0001978 3300048923 Bacteria 22352
153 Ga0496124_0000021 3300048927 Bacteria 432123
154 Ga0501034_0097182 3300049571 Bacteria 2941
155 Ga0501036_0095530 3300049572 Bacteria 2512
156 Ga0501037_0240277 3300049573 Bacteria 1270
157 Ga0501038_0186160 3300049574 Bacteria 1673
158 Ga0501038_0585222 3300049574 Bacteria 846
159 Ga0501040_0216995 3300049576 Bacteria 1361
160 Ga0501041_0073670 3300049577 Bacteria 2098
161 Ga0501041_0171355 3300049577 Bacteria 1358
162 Ga0501043_0051746 3300049579 Bacteria 3227
163 Ga0501046_0161090 3300049580 Bacteria 1687
164 Ga0501046_0393295 3300049580 Bacteria 1002
165 Ga0501046_0541088 3300049580 Bacteria 831
166 Ga0501047_0003557 3300049581 Bacteria 14708
167 Ga0501048_0031907 3300049582 Bacteria 3809
168 Ga0501048_0391662 3300049582 Bacteria 993
169 Ga0501070_0000273 3300049586 Bacteria 48925
170 Ga0501071_0021239 3300049587 Bacteria 4519
171 Ga0501071_0078487 3300049587 Bacteria 2413
172 Ga0501071_0123791 3300049587 Bacteria 1918
173 Ga0501071_0292002 3300049587 Bacteria 1235
174 Ga0501072_0023909 3300049588 Bacteria 4749
175 Ga0501072_0251245 3300049588 Bacteria 1408
176 Ga0501072_0301334 3300049588 Bacteria 1274
177 Ga0501074_0095853 3300049590 Bacteria 2125
178 Ga0501074_0334087 3300049590 Bacteria 1076
179 Ga0501075_0083189 3300049591 Bacteria 2424
180 Ga0501075_0097787 3300049591 Bacteria 2228
181 Ga0501076_0248503 3300049592 Bacteria 1455
182 Ga0501079_0197470 3300049741 Bacteria 1571
183 Ga0501079_0301004 3300049741 Bacteria 1255
184 Ga0501080_0130167 3300049742 Bacteria 2330
185 Ga0501080_0612441 3300049742 Bacteria 966
186 Ga0501081_0193914 3300049743 Bacteria 1472
187 Ga0501035_0204905 3300049822 Bacteria 1690
188 Ga0501044_0438573 3300049823 Bacteria 1214
189 Ga0501045_0037924 3300049824 Bacteria 3505
190 Ga0501045_0143475 3300049824 Bacteria 1776
191 Ga0501045_0207119 3300049824 Bacteria 1461
192 nmdc:mga00v17_140565_c1 3300050491 Bacteria 1548
193 nmdc:mga06z11_18380_c1 3300050494 Bacteria 3192
194 nmdc:mga07m45_50525_c1 3300050496 Bacteria 2343
195 nmdc:mga05p37_1443_c1 3300050507 Bacteria 27640
196 nmdc:mga05p37_161042_c1 3300050507 Bacteria 2741
197 nmdc:mga05p37_2966_c1 3300050507 Bacteria 19700
198 nmdc:mga05p37_38733_c1 3300050507 Bacteria 5849
199 nmdc:mga05p37_485268_c1 3300050507 Bacteria 1422
200 nmdc:mga09592_24699_c1 3300050508 Bacteria 4970
201 nmdc:mga09592_479989_c1 3300050508 Bacteria 1071
202 nmdc:mga0qj67_98880_c1 3300050509 Bacteria 2350
203 nmdc:mga06r32_152888_c1 3300050510 Bacteria 2287
204 nmdc:mga06r32_32963_c1 3300050510 Bacteria 4877
205 nmdc:mga06r32_90518_c1 3300050510 Bacteria 2989
206 nmdc:mga08y16_176119_c1 3300050511 Unclassified 2221
207 nmdc:mga08y16_17960_c1 3300050511 Bacteria 7452
208 nmdc:mga08y16_302778_c1 3300050511 Bacteria 1648
209 nmdc:mga08y16_9854_c1 3300050511 Bacteria 10032
210 nmdc:mga0a205_23925_c1 3300050515 Bacteria 5798
211 nmdc:mga0a205_82171_c1 3300050515 Bacteria 3112
212 Ga0500555_062889 3300053103 Bacteria 994
213 Ga0501082_0064001 3300060353 Bacteria 3167
214 Ga0501082_0094591 3300060353 Bacteria 2582
215 Ga0501082_0136935 3300060353 Bacteria 2125
216 Ga0530510_0025749 3300061734 Bacteria 4208
217 Ga0530510_0120410 3300061734 Bacteria 1926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0078487 Ga0501071_0078487_268_855 192
2 3300049588 Ga0501072_0301334 Ga0501072_0301334_376_963 192
3 3300049591 Ga0501075_0097787 Ga0501075_0097787_834_1421 192
4 3300049824 Ga0501045_0207119 Ga0501045_0207119_348_935 192
5 3300009147 Ga0114129_10000922 Ga0114129_1000092218 195
6 3300005354 Ga0070675_100300704 Ga0070675_1003007042 209
7 3300005353 Ga0070669_100178212 Ga0070669_1001782121 212
8 3300005444 Ga0070694_100485774 Ga0070694_1004857741 212
9 3300031548 Ga0307408_100006281 Ga0307408_1000062812 220
10 3300031731 Ga0307405_10005136 Ga0307405_100051362 220
11 3300031824 Ga0307413_10025687 Ga0307413_100256872 220
12 3300031852 Ga0307410_10024854 Ga0307410_100248543 220
13 3300031901 Ga0307406_10032250 Ga0307406_100322502 220
14 3300031903 Ga0307407_10005302 Ga0307407_100053022 220
15 3300031911 Ga0307412_10035676 Ga0307412_100356762 220
16 3300031995 Ga0307409_100019925 Ga0307409_1000199254 220
17 3300032002 Ga0307416_100045281 Ga0307416_1000452812 220
18 3300032004 Ga0307414_10033537 Ga0307414_100335373 220
19 3300032005 Ga0307411_10035821 Ga0307411_100358213 220
20 3300048909 Ga0496106_0562216 Ga0496106_0562216_41_703 220
21 3300049580 Ga0501046_0393295 Ga0501046_0393295_128_790 220
22 3300049587 Ga0501071_0292002 Ga0501071_0292002_553_1215 220
23 3300049590 Ga0501074_0334087 Ga0501074_0334087_336_1004 220
24 3300005331 Ga0070670_100654966 Ga0070670_1006549661 221
25 3300005340 Ga0070689_100203080 Ga0070689_1002030801 221
26 3300005340 Ga0070689_100315208 Ga0070689_1003152082 221
27 3300005345 Ga0070692_10184961 Ga0070692_101849612 221
28 3300005347 Ga0070668_100930607 Ga0070668_1009306071 221
29 3300005365 Ga0070688_100009468 Ga0070688_1000094682 221
30 3300005440 Ga0070705_100001697 Ga0070705_10000169710 221
31 3300005444 Ga0070694_100002103 Ga0070694_1000021035 221
32 3300005468 Ga0070707_100347865 Ga0070707_1003478652 221
33 3300005564 Ga0070664_100353704 Ga0070664_1003537042 221
34 3300005577 Ga0068857_100107491 Ga0068857_1001074912 221
35 3300005617 Ga0068859_100223901 Ga0068859_1002239012 221
36 3300005618 Ga0068864_100068502 Ga0068864_1000685022 221
37 3300005618 Ga0068864_100282641 Ga0068864_1002826412 221
38 3300005937 Ga0081455_10014083 Ga0081455_100140833 221
39 3300006844 Ga0075428_100177017 Ga0075428_1001770172 221
40 3300006844 Ga0075428_100278456 Ga0075428_1002784562 221
41 3300006844 Ga0075428_100292805 Ga0075428_1002928052 221
42 3300006852 Ga0075433_10092144 Ga0075433_100921442 221
43 3300006871 Ga0075434_100188533 Ga0075434_1001885331 221
44 3300006880 Ga0075429_100788035 Ga0075429_1007880351 221
45 3300006931 Ga0097620_100223907 Ga0097620_1002239072 221
46 3300009094 Ga0111539_10375333 Ga0111539_103753332 221
47 3300009147 Ga0114129_10653360 Ga0114129_106533602 221
48 3300009177 Ga0105248_10888576 Ga0105248_108885761 221
49 3300013297 Ga0157378_10029193 Ga0157378_100291932 221
50 3300025885 Ga0207653_10000166 Ga0207653_1000016611 221
51 3300025910 Ga0207684_10000184 Ga0207684_1000018448 221
52 3300025922 Ga0207646_10454898 Ga0207646_104548981 221
53 3300025936 Ga0207670_10008991 Ga0207670_100089911 221
54 3300025936 Ga0207670_10450886 Ga0207670_104508862 221
55 3300025945 Ga0207679_10819061 Ga0207679_108190612 221
56 3300025972 Ga0207668_10857112 Ga0207668_108571121 221
57 3300026116 Ga0207674_10640907 Ga0207674_106409071 221
58 3300049571 Ga0501034_0097182 Ga0501034_0097182_1611_2276 221
59 3300049572 Ga0501036_0095530 Ga0501036_0095530_1260_1925 221
60 3300049576 Ga0501040_0216995 Ga0501040_0216995_63_728 221
61 3300049577 Ga0501041_0073670 Ga0501041_0073670_971_1636 221
62 3300049582 Ga0501048_0031907 Ga0501048_0031907_2439_3104 221
63 3300049587 Ga0501071_0021239 Ga0501071_0021239_2587_3252 221
64 3300049587 Ga0501071_0123791 Ga0501071_0123791_229_894 221
65 3300049588 Ga0501072_0023909 Ga0501072_0023909_3489_4154 221
66 3300049590 Ga0501074_0095853 Ga0501074_0095853_1025_1690 221
67 3300049741 Ga0501079_0301004 Ga0501079_0301004_501_1166 221
68 3300049742 Ga0501080_0130167 Ga0501080_0130167_1231_1896 221
69 3300049742 Ga0501080_0612441 Ga0501080_0612441_273_938 221
70 3300049822 Ga0501035_0204905 Ga0501035_0204905_360_1025 221
71 3300049824 Ga0501045_0037924 Ga0501045_0037924_2376_3041 221
72 3300050507 nmdc:mga05p37_161042_c1 nmdc:mga05p37_161042_c1_1936_2601 221
73 3300050507 nmdc:mga05p37_2966_c1 nmdc:mga05p37_2966_c1_9282_9947 221
74 3300050507 nmdc:mga05p37_38733_c1 nmdc:mga05p37_38733_c1_3488_4153 221
75 3300050510 nmdc:mga06r32_32963_c1 nmdc:mga06r32_32963_c1_197_862 221
76 3300050511 nmdc:mga08y16_176119_c1 nmdc:mga08y16_176119_c1_1111_1776 221
77 3300053103 Ga0500555_062889 Ga0500555_062889_279_944 221
78 3300060353 Ga0501082_0064001 Ga0501082_0064001_2334_2999 221
79 3300060353 Ga0501082_0136935 Ga0501082_0136935_510_1175 221
80 3300061734 Ga0530510_0120410 Ga0530510_0120410_903_1568 221
81 3300005333 Ga0070677_10347316 Ga0070677_103473161 222
82 3300005356 Ga0070674_100038331 Ga0070674_1000383312 222
83 3300005365 Ga0070688_100227986 Ga0070688_1002279861 222
84 3300005441 Ga0070700_100716679 Ga0070700_1007166791 222
85 3300005518 Ga0070699_100503994 Ga0070699_1005039942 222
86 3300005844 Ga0068862_100029410 Ga0068862_1000294103 222
87 3300006844 Ga0075428_100732318 Ga0075428_1007323181 222
88 3300009094 Ga0111539_10069238 Ga0111539_100692382 222
89 3300009094 Ga0111539_10152729 Ga0111539_101527292 222
90 3300009147 Ga0114129_10007241 Ga0114129_100072412 222
91 3300025937 Ga0207669_10025931 Ga0207669_100259312 222
92 3300027907 Ga0207428_10084103 Ga0207428_100841032 222
93 3300028380 Ga0268265_10011025 Ga0268265_100110254 222
94 3300032002 Ga0307416_100175578 Ga0307416_1001755782 222
95 3300032002 Ga0307416_100321767 Ga0307416_1003217672 222
96 3300032005 Ga0307411_10017500 Ga0307411_100175002 222
97 3300041997 Ga0439431_0004548 Ga0439431_0004548_497_1180 222
98 3300041999 Ga0439433_0039786 Ga0439433_0039786_175_858 222
99 3300042156 Ga0439446_0012742 Ga0439446_0012742_1591_2274 222
100 3300049577 Ga0501041_0171355 Ga0501041_0171355_394_1062 222
101 3300049580 Ga0501046_0541088 Ga0501046_0541088_19_687 222
102 3300049582 Ga0501048_0391662 Ga0501048_0391662_251_919 222
103 3300049588 Ga0501072_0251245 Ga0501072_0251245_321_989 222
104 3300049591 Ga0501075_0083189 Ga0501075_0083189_1519_2187 222
105 3300049592 Ga0501076_0248503 Ga0501076_0248503_311_979 222
106 3300050507 nmdc:mga05p37_1443_c1 nmdc:mga05p37_1443_c1_17091_17768 222
107 3300050508 nmdc:mga09592_479989_c1 nmdc:mga09592_479989_c1_167_835 222
108 3300050511 nmdc:mga08y16_302778_c1 nmdc:mga08y16_302778_c1_904_1572 222
109 3300060353 Ga0501082_0094591 Ga0501082_0094591_104_772 222
110 3300061734 Ga0530510_0025749 Ga0530510_0025749_2737_3405 222
111 3300005436 Ga0070713_100014795 Ga0070713_1000147953 223
112 3300006028 Ga0070717_10117305 Ga0070717_101173052 223
113 3300006852 Ga0075433_10071516 Ga0075433_100715162 223
114 3300009147 Ga0114129_11037285 Ga0114129_110372851 223
115 3300025928 Ga0207700_10009956 Ga0207700_100099563 223
116 3300035172 Ga0373955_0221206 Ga0373955_0221206_390_1067 223
117 3300036401 Ga0373937_0004595 Ga0373937_0004595_5965_6642 223
118 3300049573 Ga0501037_0240277 Ga0501037_0240277_486_1163 223
119 3300049574 Ga0501038_0186160 Ga0501038_0186160_142_813 223
120 3300049574 Ga0501038_0585222 Ga0501038_0585222_45_722 223
121 3300049741 Ga0501079_0197470 Ga0501079_0197470_171_842 223
122 3300050515 nmdc:mga0a205_82171_c1 nmdc:mga0a205_82171_c1_1799_2479 223
123 3300005471 Ga0070698_100318723 Ga0070698_1003187232 224
124 3300044712 Ga0453684_0794911 Ga0453684_0794911_257_931 224
125 3300006051 Ga0075364_10010528 Ga0075364_100105282 225
126 3300006846 Ga0075430_100097383 Ga0075430_1000973832 225
127 3300006847 Ga0075431_100097152 Ga0075431_1000971524 225
128 3300006852 Ga0075433_10152661 Ga0075433_101526612 225
129 3300027907 Ga0207428_10002703 Ga0207428_100027039 225
130 3300041410 Ga0439461_0025708 Ga0439461_0025708_66_752 225
131 3300042435 Ga0439434_0006449 Ga0439434_0006449_2299_2985 225
132 3300049743 Ga0501081_0193914 Ga0501081_0193914_760_1452 225
133 3300050491 nmdc:mga00v17_140565_c1 nmdc:mga00v17_140565_c1_584_1279 225
134 3300050494 nmdc:mga06z11_18380_c1 nmdc:mga06z11_18380_c1_1915_2610 225
135 3300050496 nmdc:mga07m45_50525_c1 nmdc:mga07m45_50525_c1_95_790 225
136 3300050507 nmdc:mga05p37_485268_c1 nmdc:mga05p37_485268_c1_321_1013 225
137 3300050510 nmdc:mga06r32_90518_c1 nmdc:mga06r32_90518_c1_1396_2088 225
138 3300050511 nmdc:mga08y16_9854_c1 nmdc:mga08y16_9854_c1_5389_6081 225
139 3300050515 nmdc:mga0a205_23925_c1 nmdc:mga0a205_23925_c1_1013_1705 225
140 3300005444 Ga0070694_100251844 Ga0070694_1002518441 226
141 3300005844 Ga0068862_100344464 Ga0068862_1003444641 226
142 3300006844 Ga0075428_100001335 Ga0075428_1000013359 226
143 3300006846 Ga0075430_100054884 Ga0075430_1000548842 226
144 3300006847 Ga0075431_100074387 Ga0075431_1000743872 226
145 3300006852 Ga0075433_10212169 Ga0075433_102121692 226
146 3300006880 Ga0075429_100035260 Ga0075429_1000352603 226
147 3300009094 Ga0111539_10092661 Ga0111539_100926612 226
148 3300009553 Ga0105249_10153195 Ga0105249_101531954 226
149 3300013308 Ga0157375_10562013 Ga0157375_105620132 226
150 3300027907 Ga0207428_10029037 Ga0207428_100290374 226
151 3300028380 Ga0268265_10221448 Ga0268265_102214482 226
152 3300049579 Ga0501043_0051746 Ga0501043_0051746_1792_2472 226
153 3300049580 Ga0501046_0161090 Ga0501046_0161090_260_940 226
154 3300049581 Ga0501047_0003557 Ga0501047_0003557_11911_12591 226
155 3300049586 Ga0501070_0000273 Ga0501070_0000273_19543_20223 226
156 3300049823 Ga0501044_0438573 Ga0501044_0438573_91_771 226
157 3300050508 nmdc:mga09592_24699_c1 nmdc:mga09592_24699_c1_1317_1997 226
158 3300050511 nmdc:mga08y16_17960_c1 nmdc:mga08y16_17960_c1_2337_3017 226
159 3300005334 Ga0068869_100354653 Ga0068869_1003546531 227
160 3300006847 Ga0075431_100270585 Ga0075431_1002705852 227
161 3300009094 Ga0111539_10263498 Ga0111539_102634982 227
162 3300009098 Ga0105245_10042233 Ga0105245_100422332 227
163 3300026116 Ga0207674_10309351 Ga0207674_103093512 227
164 3300047471 Ga0495684_0078913 Ga0495684_0078913_518_1213 227
165 3300050509 nmdc:mga0qj67_98880_c1 nmdc:mga0qj67_98880_c1_377_1060 227
166 3300050510 nmdc:mga06r32_152888_c1 nmdc:mga06r32_152888_c1_1290_1973 227
167 3300005440 Ga0070705_100176563 Ga0070705_1001765631 228
168 3300005440 Ga0070705_100348451 Ga0070705_1003484512 228
169 3300005518 Ga0070699_100000013 Ga0070699_10000001318 228
170 3300005546 Ga0070696_100000046 Ga0070696_10000004611 228
171 3300028800 Ga0265338_10006267 Ga0265338_100062679 228
172 3300031238 Ga0265332_10061573 Ga0265332_100615732 228
173 3300031241 Ga0265325_10000351 Ga0265325_100003512 228
174 3300031249 Ga0265339_10000211 Ga0265339_1000021118 228
175 3300031250 Ga0265331_10000311 Ga0265331_1000031140 228
176 3300031595 Ga0265313_10000323 Ga0265313_100003232 228
177 3300031711 Ga0265314_10000161 Ga0265314_1000016156 228
178 3300031712 Ga0265342_10009433 Ga0265342_100094333 228
179 3300049824 Ga0501045_0143475 Ga0501045_0143475_559_1245 228
180 3300005547 Ga0070693_100004072 Ga0070693_1000040727 229
181 3300005937 Ga0081455_10009032 Ga0081455_100090322 229
182 3300009148 Ga0105243_10771034 Ga0105243_107710342 229
183 3300042125 Ga0450923_008276 Ga0450923_008276_663_1361 229
184 iso_pu_bacteria 2506520007 2506578019 230
185 iso_pu_bacteria 2506520008 2506583157 230
186 iso_pu_bacteria 2508501071 2508851990 230
187 iso_pu_bacteria 2654587920 2656275348 230
188 iso_pu_bacteria 2687453601 2689444550 230
189 iso_pu_bacteria 2772190666 2772438568 230
190 iso_pu_bacteria 2806310673 2807176885 230
191 iso_pu_bacteria 2869551831 2869553919 230
192 iso_pu_bacteria 2888366609 2888368633 230
193 iso_pu_bacteria 2888373701 2888373825 230
194 iso_pu_bacteria 2932406140 2932409679 230
195 iso_pu_bacteria 2937967321 2937970364 230
196 iso_pu_bacteria 2939577877 2939578797 230
197 iso_pu_bacteria 640753048 640937540 230
198 iso_pu_bacteria 8004592986 8004595530 230
199 iso_pu_bacteria 8015394850 8015395478 230
200 3300005289 Ga0065704_10116307 Ga0065704_101163072 234
201 3300006946 Ga0079104_1001968 Ga0079104_10019682 234
202 3300009011 Ga0105251_10000459 Ga0105251_1000045921 234
203 3300009011 Ga0105251_10001761 Ga0105251_100017615 234
204 3300009011 Ga0105251_10002284 Ga0105251_100022845 234
205 3300009036 Ga0105244_10002389 Ga0105244_1000238911 234
206 3300009101 Ga0105247_10000087 Ga0105247_1000008758 234
207 3300009174 Ga0105241_10000002 Ga0105241_10000002706 234
208 3300013100 Ga0157373_10003930 Ga0157373_100039308 234
209 3300014497 Ga0182008_10001728 Ga0182008_100017287 234
210 3300017792 Ga0163161_10000001 Ga0163161_10000001774 234
211 3300025711 Ga0207696_1000001 Ga0207696_1000001852 234
212 3300025728 Ga0207655_1000037 Ga0207655_100003725 234
213 3300025735 Ga0207713_1000090 Ga0207713_100009036 234
214 3300025735 Ga0207713_1000291 Ga0207713_100029121 234
215 3300025735 Ga0207713_1004286 Ga0207713_10042865 234
216 3300025900 Ga0207710_10000052 Ga0207710_100000524 234
217 3300025911 Ga0207654_10000005 Ga0207654_10000005704 234
218 3300027111 Ga0209281_1000027 Ga0209281_100002725 234
219 3300041411 Ga0439466_0012623 Ga0439466_0012623_1751_2455 234
220 3300042006 Ga0439432_030774 Ga0439432_030774_670_1374 234
221 3300046453 Ga0495627_000093 Ga0495627_000093_22685_23389 234
222 3300046530 Ga0495654_0001122 Ga0495654_0001122_7114_7818 234
223 3300046530 Ga0495654_0202578 Ga0495654_0202578_82_786 234
224 3300046794 Ga0495589_0000004 Ga0495589_0000004_220372_221076 234
225 3300048919 Ga0496116_0000001 Ga0496116_0000001_262654_263358 234
226 3300048920 Ga0496117_0016347 Ga0496117_0016347_2222_2926 234
227 3300048920 Ga0496117_0066837 Ga0496117_0066837_407_1111 234
228 3300048921 Ga0496118_0018223 Ga0496118_0018223_5123_5827 234
229 3300048922 Ga0496119_0006779 Ga0496119_0006779_9633_10337 234
230 3300048922 Ga0496119_0015718 Ga0496119_0015718_5067_5771 234
231 3300048923 Ga0496120_0001534 Ga0496120_0001534_9188_9892 234
232 3300048923 Ga0496120_0001978 Ga0496120_0001978_10613_11317 234
233 3300048927 Ga0496124_0000021 Ga0496124_0000021_307689_308393 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

72

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9692 5 226
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9673 5 226
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9664 5 231
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9642 6 230
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9635 5 229
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9819 3 230 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9764 4 227 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9756 5 225 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9735 3 230 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9719 25 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A661KN18-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9911 86 227 GO:0005524
GO:0016887
AF-A0A089I4Y8-F1-model_v4 ABC transporter ATP-binding protein 0.9892 7 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3D2CRM9-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9884 4 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A6L4YFH5-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9871 1 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A223S3N0-F1-model_v4 ABC transporter ATP-binding protein 0.9854 1 225 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map