F345959
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 233 | 151 | 233 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100190681|Ga0070712_1001906812 |
| Length | 101 |
| Sequence | MPKFVIERDLPGAGALSADELRAISQKSNKVIADLGPEIRWLESYVTEDKLYCVYVAPDADIIFEHARCGGFPANKVTRVANIIDPSTGDAAERVTAKSAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 37 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 41 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 92 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 93 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 103 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 106 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 107 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 112 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 113 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 117 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 118 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 119 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 120 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 121 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 122 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 135 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 136 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 140 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 143 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 151 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 1.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 0.86 |
| Rhizosphere | 94.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11734451 | 3300004798 | Unclassified | 514 |
| 2 | Ga0058860_10047862 | 3300004801 | Archaea | 609 |
| 3 | Ga0065715_10096520 | 3300005293 | Bacteria | 3865 |
| 4 | Ga0065715_10177489 | 3300005293 | Bacteria | 1500 |
| 5 | Ga0070676_10664087 | 3300005328 | Unclassified | 758 |
| 6 | Ga0070683_100109589 | 3300005329 | Bacteria | 2604 |
| 7 | Ga0070680_100001942 | 3300005336 | Bacteria | 15203 |
| 8 | Ga0070680_100152375 | 3300005336 | Bacteria | 1941 |
| 9 | Ga0070680_100226369 | 3300005336 | Bacteria | 1579 |
| 10 | Ga0070680_100366659 | 3300005336 | Bacteria | 1225 |
| 11 | Ga0070682_100014043 | 3300005337 | Bacteria | 4622 |
| 12 | Ga0070682_100184665 | 3300005337 | Unclassified | 1459 |
| 13 | Ga0070682_100339387 | 3300005337 | Bacteria | 1116 |
| 14 | Ga0070689_100191570 | 3300005340 | Bacteria | 1665 |
| 15 | Ga0070692_10211818 | 3300005345 | Unclassified | 1140 |
| 16 | Ga0070675_100500553 | 3300005354 | Bacteria | 1095 |
| 17 | Ga0070673_100461409 | 3300005364 | Bacteria | 1144 |
| 18 | Ga0070659_100350277 | 3300005366 | Bacteria | 1239 |
| 19 | Ga0070709_10001406 | 3300005434 | Bacteria | 13046 |
| 20 | Ga0070714_100095033 | 3300005435 | Bacteria | 2617 |
| 21 | Ga0070713_100017375 | 3300005436 | Bacteria | 5439 |
| 22 | Ga0070701_11362929 | 3300005438 | Bacteria | 509 |
| 23 | Ga0070681_10011978 | 3300005458 | Bacteria | 8598 |
| 24 | Ga0070681_10060364 | 3300005458 | Bacteria | 3769 |
| 25 | Ga0070681_10494681 | 3300005458 | Bacteria | 1136 |
| 26 | Ga0070706_100073668 | 3300005467 | Bacteria | 3161 |
| 27 | Ga0070706_100125973 | 3300005467 | Bacteria | 2388 |
| 28 | Ga0070707_100415610 | 3300005468 | Bacteria | 1305 |
| 29 | Ga0070707_100855736 | 3300005468 | Bacteria | 873 |
| 30 | Ga0070707_101210848 | 3300005468 | Bacteria | 721 |
| 31 | Ga0070698_101338525 | 3300005471 | Bacteria | 666 |
| 32 | Ga0070699_100001771 | 3300005518 | Bacteria | 19664 |
| 33 | Ga0070699_100125844 | 3300005518 | Bacteria | 2256 |
| 34 | Ga0070679_100245442 | 3300005530 | Unclassified | 1747 |
| 35 | Ga0070679_100641042 | 3300005530 | Bacteria | 1005 |
| 36 | Ga0070697_100048730 | 3300005536 | Bacteria | 3435 |
| 37 | Ga0068853_100642747 | 3300005539 | Unclassified | 1009 |
| 38 | Ga0070686_100130901 | 3300005544 | Bacteria | 1735 |
| 39 | Ga0070695_100039792 | 3300005545 | Bacteria | 2973 |
| 40 | Ga0070695_100984108 | 3300005545 | Bacteria | 685 |
| 41 | Ga0070693_101669356 | 3300005547 | Bacteria | 502 |
| 42 | Ga0070704_100194674 | 3300005549 | Bacteria | 1632 |
| 43 | Ga0068855_101604549 | 3300005563 | Bacteria | 665 |
| 44 | Ga0068855_102497099 | 3300005563 | Bacteria | 514 |
| 45 | Ga0068854_100176669 | 3300005578 | Bacteria | 1665 |
| 46 | Ga0068856_100206275 | 3300005614 | Unclassified | 1980 |
| 47 | Ga0070716_100090027 | 3300006173 | Bacteria | 1855 |
| 48 | Ga0070712_100190681 | 3300006175 | Bacteria | 1604 |
| 49 | Ga0070712_101819181 | 3300006175 | Unclassified | 533 |
| 50 | Ga0075431_100159644 | 3300006847 | Bacteria | 2318 |
| 51 | Ga0075431_100325698 | 3300006847 | Bacteria | 1548 |
| 52 | Ga0075433_10061141 | 3300006852 | Bacteria | 3299 |
| 53 | Ga0075433_10455172 | 3300006852 | Bacteria | 1128 |
| 54 | Ga0075434_100276003 | 3300006871 | Bacteria | 1700 |
| 55 | Ga0075429_101441277 | 3300006880 | Bacteria | 599 |
| 56 | Ga0068865_101554110 | 3300006881 | Bacteria | 594 |
| 57 | Ga0075436_100122871 | 3300006914 | Bacteria | 1818 |
| 58 | Ga0099794_10006732 | 3300007265 | Bacteria | 4671 |
| 59 | Ga0099794_10011099 | 3300007265 | Bacteria | 3850 |
| 60 | Ga0099795_10442266 | 3300007788 | Bacteria | 597 |
| 61 | Ga0105240_10314528 | 3300009093 | Bacteria | 1787 |
| 62 | Ga0111539_10680077 | 3300009094 | Bacteria | 1198 |
| 63 | Ga0105245_10012255 | 3300009098 | Bacteria | 7460 |
| 64 | Ga0105245_10157653 | 3300009098 | Bacteria | 2151 |
| 65 | Ga0105245_10234801 | 3300009098 | Unclassified | 1775 |
| 66 | Ga0105245_10663757 | 3300009098 | Bacteria | 1073 |
| 67 | Ga0105245_13173862 | 3300009098 | Unclassified | 509 |
| 68 | Ga0105247_11759763 | 3300009101 | Bacteria | 514 |
| 69 | Ga0114129_10891959 | 3300009147 | Bacteria | 1127 |
| 70 | Ga0105241_10177201 | 3300009174 | Bacteria | 1765 |
| 71 | Ga0105242_10103227 | 3300009176 | Bacteria | 2418 |
| 72 | Ga0105242_10626292 | 3300009176 | Bacteria | 1043 |
| 73 | Ga0105237_10306788 | 3300009545 | Bacteria | 1590 |
| 74 | Ga0105239_10735927 | 3300010375 | Bacteria | 1128 |
| 75 | Ga0105239_12506764 | 3300010375 | Bacteria | 601 |
| 76 | Ga0105239_13016546 | 3300010375 | Bacteria | 549 |
| 77 | Ga0157371_10615786 | 3300013102 | Bacteria | 808 |
| 78 | Ga0157370_12095498 | 3300013104 | Unclassified | 507 |
| 79 | Ga0157374_10148711 | 3300013296 | Unclassified | 2277 |
| 80 | Ga0157378_10079078 | 3300013297 | Bacteria | 2968 |
| 81 | Ga0157378_10372432 | 3300013297 | Bacteria | 1400 |
| 82 | Ga0163162_10627626 | 3300013306 | Bacteria | 1199 |
| 83 | Ga0157372_10293396 | 3300013307 | Unclassified | 1891 |
| 84 | Ga0157372_10444145 | 3300013307 | Bacteria | 1512 |
| 85 | Ga0157375_10713865 | 3300013308 | Bacteria | 1156 |
| 86 | Ga0157375_11683020 | 3300013308 | Bacteria | 751 |
| 87 | Ga0163163_11404405 | 3300014325 | Bacteria | 760 |
| 88 | Ga0157376_11138963 | 3300014969 | Bacteria | 807 |
| 89 | Ga0206356_11718267 | 3300020070 | Bacteria | 500 |
| 90 | Ga0206352_10970138 | 3300020078 | Bacteria | 586 |
| 91 | Ga0213876_10066540 | 3300021384 | Bacteria | 1902 |
| 92 | Ga0213876_10273300 | 3300021384 | Bacteria | 898 |
| 93 | Ga0213876_10602290 | 3300021384 | Bacteria | 585 |
| 94 | Ga0207699_10000108 | 3300025906 | Bacteria | 58752 |
| 95 | Ga0207699_11215942 | 3300025906 | Unclassified | 558 |
| 96 | Ga0207645_10499210 | 3300025907 | Bacteria | 824 |
| 97 | Ga0207684_10000002 | 3300025910 | Bacteria | 1042751 |
| 98 | Ga0207684_10103890 | 3300025910 | Bacteria | 2429 |
| 99 | Ga0207654_10289692 | 3300025911 | Bacteria | 1110 |
| 100 | Ga0207707_10003730 | 3300025912 | Bacteria | 13492 |
| 101 | Ga0207707_10637340 | 3300025912 | Bacteria | 899 |
| 102 | Ga0207707_11098701 | 3300025912 | Bacteria | 648 |
| 103 | Ga0207671_10475024 | 3300025914 | Bacteria | 996 |
| 104 | Ga0207693_10206000 | 3300025915 | Bacteria | 1546 |
| 105 | Ga0207660_10046242 | 3300025917 | Unclassified | 3070 |
| 106 | Ga0207660_10124029 | 3300025917 | Bacteria | 1960 |
| 107 | Ga0207660_11123961 | 3300025917 | Bacteria | 640 |
| 108 | Ga0207652_10084586 | 3300025921 | Unclassified | 2779 |
| 109 | Ga0207652_11472791 | 3300025921 | Bacteria | 585 |
| 110 | Ga0207652_11515097 | 3300025921 | Unclassified | 575 |
| 111 | Ga0207646_10000402 | 3300025922 | Bacteria | 58018 |
| 112 | Ga0207646_10029400 | 3300025922 | Bacteria | 4995 |
| 113 | Ga0207687_10013476 | 3300025927 | Bacteria | 5338 |
| 114 | Ga0207687_10264434 | 3300025927 | Bacteria | 1373 |
| 115 | Ga0207687_10384681 | 3300025927 | Unclassified | 1150 |
| 116 | Ga0207687_10916417 | 3300025927 | Bacteria | 750 |
| 117 | Ga0207700_10004274 | 3300025928 | Bacteria | 8397 |
| 118 | Ga0207664_10118235 | 3300025929 | Bacteria | 2214 |
| 119 | Ga0207690_10352890 | 3300025932 | Bacteria | 1163 |
| 120 | Ga0207686_10044859 | 3300025934 | Bacteria | 2717 |
| 121 | Ga0207704_11419181 | 3300025938 | Bacteria | 595 |
| 122 | Ga0207665_10164507 | 3300025939 | Bacteria | 1598 |
| 123 | Ga0207667_10022659 | 3300025949 | Bacteria | 6929 |
| 124 | Ga0207667_10614612 | 3300025949 | Unclassified | 1095 |
| 125 | Ga0207640_10157558 | 3300025981 | Bacteria | 1676 |
| 126 | Ga0207658_12186541 | 3300025986 | Bacteria | 502 |
| 127 | Ga0207703_10671546 | 3300026035 | Unclassified | 984 |
| 128 | Ga0207639_11348316 | 3300026041 | Unclassified | 669 |
| 129 | Ga0207648_11065272 | 3300026089 | Bacteria | 758 |
| 130 | Ga0207683_10723554 | 3300026121 | Bacteria | 923 |
| 131 | Ga0209588_1000075 | 3300027671 | Bacteria | 33877 |
| 132 | Ga0209588_1097689 | 3300027671 | Bacteria | 946 |
| 133 | Ga0265334_10162725 | 3300028573 | Bacteria | 784 |
| 134 | Ga0265338_10230561 | 3300028800 | Bacteria | 1377 |
| 135 | Ga0265338_10787523 | 3300028800 | Bacteria | 652 |
| 136 | Ga0265320_10063768 | 3300031240 | Bacteria | 1752 |
| 137 | Ga0265325_10023354 | 3300031241 | Bacteria | 3377 |
| 138 | Ga0265325_10071670 | 3300031241 | Bacteria | 1738 |
| 139 | Ga0265340_10006720 | 3300031247 | Bacteria | 6299 |
| 140 | Ga0265339_10192488 | 3300031249 | Bacteria | 1010 |
| 141 | Ga0265316_10040573 | 3300031344 | Bacteria | 3731 |
| 142 | Ga0265316_10072699 | 3300031344 | Bacteria | 2649 |
| 143 | Ga0307408_100777653 | 3300031548 | Bacteria | 867 |
| 144 | Ga0307408_101396264 | 3300031548 | Bacteria | 659 |
| 145 | Ga0307408_101401710 | 3300031548 | Bacteria | 658 |
| 146 | Ga0307408_101717048 | 3300031548 | Bacteria | 598 |
| 147 | Ga0307408_101979053 | 3300031548 | Bacteria | 560 |
| 148 | Ga0265313_10204456 | 3300031595 | Bacteria | 820 |
| 149 | Ga0265314_10236489 | 3300031711 | Bacteria | 1057 |
| 150 | Ga0265342_10006924 | 3300031712 | Bacteria | 8380 |
| 151 | Ga0307405_10079090 | 3300031731 | Bacteria | 2142 |
| 152 | Ga0307405_10192823 | 3300031731 | Bacteria | 1473 |
| 153 | Ga0307405_10274636 | 3300031731 | Bacteria | 1265 |
| 154 | Ga0307405_10603386 | 3300031731 | Bacteria | 896 |
| 155 | Ga0307413_10040481 | 3300031824 | Bacteria | 2719 |
| 156 | Ga0307413_10273263 | 3300031824 | Bacteria | 1266 |
| 157 | Ga0307410_10020858 | 3300031852 | Bacteria | 4018 |
| 158 | Ga0307410_11803155 | 3300031852 | Unclassified | 543 |
| 159 | Ga0307406_10121266 | 3300031901 | Bacteria | 1818 |
| 160 | Ga0307406_12052514 | 3300031901 | Bacteria | 512 |
| 161 | Ga0307407_10021149 | 3300031903 | Bacteria | 3349 |
| 162 | Ga0307407_10039911 | 3300031903 | Bacteria | 2613 |
| 163 | Ga0307412_10021731 | 3300031911 | Bacteria | 3924 |
| 164 | Ga0307412_10063844 | 3300031911 | Bacteria | 2486 |
| 165 | Ga0307412_11023170 | 3300031911 | Bacteria | 731 |
| 166 | Ga0307409_100030345 | 3300031995 | Bacteria | 3882 |
| 167 | Ga0307416_100035410 | 3300032002 | Bacteria | 3812 |
| 168 | Ga0307416_100107725 | 3300032002 | Bacteria | 2446 |
| 169 | Ga0307416_100526507 | 3300032002 | Bacteria | 1251 |
| 170 | Ga0307416_102136656 | 3300032002 | Unclassified | 662 |
| 171 | Ga0307416_102905323 | 3300032002 | Bacteria | 573 |
| 172 | Ga0307414_10002305 | 3300032004 | Bacteria | 9973 |
| 173 | Ga0307414_10098419 | 3300032004 | Bacteria | 2194 |
| 174 | Ga0307411_10029315 | 3300032005 | Bacteria | 3358 |
| 175 | Ga0307411_10243447 | 3300032005 | Bacteria | 1409 |
| 176 | Ga0307411_12104509 | 3300032005 | Bacteria | 528 |
| 177 | Ga0307415_100426662 | 3300032126 | Bacteria | 1139 |
| 178 | Ga0307415_102152804 | 3300032126 | Bacteria | 545 |
| 179 | Ga0373959_0047005 | 3300034820 | Bacteria | 922 |
| 180 | Ga0373949_0044550 | 3300035090 | Bacteria | 1101 |
| 181 | Ga0373941_0011043 | 3300035115 | Unclassified | 2325 |
| 182 | Ga0373960_0059031 | 3300035121 | Bacteria | 1159 |
| 183 | Ga0373961_0127900 | 3300035241 | Bacteria | 848 |
| 184 | Ga0436365_0404153 | 3300039437 | Bacteria | 1590 |
| 185 | Ga0436365_0468139 | 3300039437 | Bacteria | 4884 |
| 186 | Ga0436365_1371830 | 3300039437 | Bacteria | 6255 |
| 187 | Ga0436365_1677033 | 3300039437 | Bacteria | 930 |
| 188 | Ga0436360_0609108 | 3300039438 | Bacteria | 1888 |
| 189 | Ga0436363_0198945 | 3300039450 | Bacteria | 647 |
| 190 | Ga0436362_0732142 | 3300039453 | Bacteria | 603 |
| 191 | Ga0450919_017048 | 3300042121 | Bacteria | 819 |
| 192 | Ga0439434_0098730 | 3300042435 | Bacteria | 939 |
| 193 | Ga0466966_0167044 | 3300044684 | Bacteria | 1338 |
| 194 | Ga0466961_0125961 | 3300044693 | Bacteria | 1607 |
| 195 | Ga0466963_0050051 | 3300044694 | Bacteria | 2765 |
| 196 | Ga0466963_0072183 | 3300044694 | Bacteria | 2325 |
| 197 | Ga0466964_0095841 | 3300044706 | Bacteria | 1299 |
| 198 | Ga0466971_0035187 | 3300044719 | Bacteria | 2245 |
| 199 | Ga0466968_0111307 | 3300044735 | Bacteria | 1231 |
| 200 | Ga0466970_0360348 | 3300044765 | Bacteria | 826 |
| 201 | Ga0466957_0035664 | 3300044842 | Bacteria | 2985 |
| 202 | Ga0466957_0176148 | 3300044842 | Bacteria | 1395 |
| 203 | Ga0466957_0575222 | 3300044842 | Bacteria | 787 |
| 204 | Ga0466959_0423457 | 3300045049 | Bacteria | 904 |
| 205 | Ga0466958_0010853 | 3300045836 | Bacteria | 5115 |
| 206 | Ga0466958_0089369 | 3300045836 | Bacteria | 1905 |
| 207 | Ga0466967_0072084 | 3300045976 | Bacteria | 3095 |
| 208 | Ga0466967_0359886 | 3300045976 | Bacteria | 1410 |
| 209 | Ga0466967_0780884 | 3300045976 | Unclassified | 948 |
| 210 | Ga0466967_1005303 | 3300045976 | Bacteria | 830 |
| 211 | Ga0466967_1663894 | 3300045976 | Bacteria | 636 |
| 212 | Ga0495594_0234034 | 3300046499 | Unclassified | 1047 |
| 213 | Ga0495588_0272951 | 3300046674 | Bacteria | 891 |
| 214 | Ga0496111_0934097 | 3300048914 | Archaea | 624 |
| 215 | Ga0496112_0634585 | 3300048915 | Bacteria | 999 |
| 216 | Ga0501069_0000856 | 3300049585 | Bacteria | 14425 |
| 217 | Ga0501070_0043543 | 3300049586 | Bacteria | 3735 |
| 218 | Ga0501073_0253965 | 3300049589 | Bacteria | 1213 |
| 219 | Ga0501202_217741 | 3300049652 | Bacteria | 528 |
| 220 | Ga0501209_251716 | 3300049656 | Bacteria | 552 |
| 221 | Ga0501080_0000096 | 3300049742 | Bacteria | 59454 |
| 222 | Ga0501268_126596 | 3300049765 | Bacteria | 571 |
| 223 | Ga0501045_1025408 | 3300049824 | Bacteria | 605 |
| 224 | nmdc:mga05p37_1106987_c1 | 3300050507 | Bacteria | 829 |
| 225 | nmdc:mga06r32_183496_c1 | 3300050510 | Bacteria | 2079 |
| 226 | nmdc:mga06r32_947006_c1 | 3300050510 | Bacteria | 816 |
| 227 | nmdc:mga0n895_356419_c1 | 3300050512 | Bacteria | 1481 |
| 228 | nmdc:mga0rr50_73359_c1 | 3300050513 | Bacteria | 2616 |
| 229 | nmdc:mga08x19_304512_c1 | 3300050514 | Unclassified | 1107 |
| 230 | nmdc:mga0a205_1229675_c1 | 3300050515 | Bacteria | 597 |
| 231 | nmdc:mga0a205_283833_c1 | 3300050515 | Unclassified | 1531 |
| 232 | Ga0500652_142965 | 3300053131 | Bacteria | 995 |
| 233 | Ga0590077_049384 | 3300059426 | Bacteria | 943 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059426 | Ga0590077_049384 | Ga0590077_049384_622_924 | 75 |
| 2 | 3300042435 | Ga0439434_0098730 | Ga0439434_0098730_328_594 | 88 |
| 3 | 3300004798 | Ga0058859_11734451 | Ga0058859_117344512 | 90 |
| 4 | 3300004801 | Ga0058860_10047862 | Ga0058860_100478621 | 90 |
| 5 | 3300005293 | Ga0065715_10096520 | Ga0065715_100965205 | 90 |
| 6 | 3300005293 | Ga0065715_10177489 | Ga0065715_101774891 | 90 |
| 7 | 3300005328 | Ga0070676_10664087 | Ga0070676_106640872 | 90 |
| 8 | 3300005329 | Ga0070683_100109589 | Ga0070683_1001095893 | 90 |
| 9 | 3300005336 | Ga0070680_100001942 | Ga0070680_1000019428 | 90 |
| 10 | 3300005336 | Ga0070680_100152375 | Ga0070680_1001523753 | 90 |
| 11 | 3300005336 | Ga0070680_100226369 | Ga0070680_1002263693 | 90 |
| 12 | 3300005336 | Ga0070680_100366659 | Ga0070680_1003666592 | 90 |
| 13 | 3300005337 | Ga0070682_100014043 | Ga0070682_1000140433 | 90 |
| 14 | 3300005337 | Ga0070682_100184665 | Ga0070682_1001846652 | 90 |
| 15 | 3300005337 | Ga0070682_100339387 | Ga0070682_1003393872 | 90 |
| 16 | 3300005340 | Ga0070689_100191570 | Ga0070689_1001915703 | 90 |
| 17 | 3300005345 | Ga0070692_10211818 | Ga0070692_102118183 | 90 |
| 18 | 3300005354 | Ga0070675_100500553 | Ga0070675_1005005532 | 90 |
| 19 | 3300005364 | Ga0070673_100461409 | Ga0070673_1004614092 | 90 |
| 20 | 3300005366 | Ga0070659_100350277 | Ga0070659_1003502772 | 90 |
| 21 | 3300005434 | Ga0070709_10001406 | Ga0070709_100014068 | 90 |
| 22 | 3300005435 | Ga0070714_100095033 | Ga0070714_1000950332 | 90 |
| 23 | 3300005436 | Ga0070713_100017375 | Ga0070713_1000173753 | 90 |
| 24 | 3300005438 | Ga0070701_11362929 | Ga0070701_113629292 | 90 |
| 25 | 3300005458 | Ga0070681_10011978 | Ga0070681_100119782 | 90 |
| 26 | 3300005458 | Ga0070681_10060364 | Ga0070681_100603646 | 90 |
| 27 | 3300005458 | Ga0070681_10494681 | Ga0070681_104946811 | 90 |
| 28 | 3300005467 | Ga0070706_100073668 | Ga0070706_1000736683 | 90 |
| 29 | 3300005467 | Ga0070706_100125973 | Ga0070706_1001259734 | 90 |
| 30 | 3300005468 | Ga0070707_100415610 | Ga0070707_1004156102 | 90 |
| 31 | 3300005468 | Ga0070707_100855736 | Ga0070707_1008557362 | 90 |
| 32 | 3300005468 | Ga0070707_101210848 | Ga0070707_1012108482 | 90 |
| 33 | 3300005471 | Ga0070698_101338525 | Ga0070698_1013385252 | 90 |
| 34 | 3300005518 | Ga0070699_100001771 | Ga0070699_1000017712 | 90 |
| 35 | 3300005518 | Ga0070699_100125844 | Ga0070699_1001258442 | 90 |
| 36 | 3300005530 | Ga0070679_100245442 | Ga0070679_1002454422 | 90 |
| 37 | 3300005530 | Ga0070679_100641042 | Ga0070679_1006410422 | 90 |
| 38 | 3300005536 | Ga0070697_100048730 | Ga0070697_1000487302 | 90 |
| 39 | 3300005539 | Ga0068853_100642747 | Ga0068853_1006427472 | 90 |
| 40 | 3300005544 | Ga0070686_100130901 | Ga0070686_1001309012 | 90 |
| 41 | 3300005545 | Ga0070695_100039792 | Ga0070695_1000397924 | 90 |
| 42 | 3300005545 | Ga0070695_100984108 | Ga0070695_1009841081 | 90 |
| 43 | 3300005547 | Ga0070693_101669356 | Ga0070693_1016693562 | 90 |
| 44 | 3300005549 | Ga0070704_100194674 | Ga0070704_1001946741 | 90 |
| 45 | 3300005563 | Ga0068855_101604549 | Ga0068855_1016045492 | 90 |
| 46 | 3300005563 | Ga0068855_102497099 | Ga0068855_1024970992 | 90 |
| 47 | 3300005578 | Ga0068854_100176669 | Ga0068854_1001766692 | 90 |
| 48 | 3300005614 | Ga0068856_100206275 | Ga0068856_1002062752 | 90 |
| 49 | 3300006173 | Ga0070716_100090027 | Ga0070716_1000900272 | 90 |
| 50 | 3300006175 | Ga0070712_100190681 | Ga0070712_1001906812 | 90 |
| 51 | 3300006175 | Ga0070712_101819181 | Ga0070712_1018191812 | 90 |
| 52 | 3300006847 | Ga0075431_100159644 | Ga0075431_1001596442 | 90 |
| 53 | 3300006847 | Ga0075431_100325698 | Ga0075431_1003256984 | 90 |
| 54 | 3300006852 | Ga0075433_10061141 | Ga0075433_100611411 | 90 |
| 55 | 3300006852 | Ga0075433_10455172 | Ga0075433_104551722 | 90 |
| 56 | 3300006871 | Ga0075434_100276003 | Ga0075434_1002760032 | 90 |
| 57 | 3300006880 | Ga0075429_101441277 | Ga0075429_1014412771 | 90 |
| 58 | 3300006881 | Ga0068865_101554110 | Ga0068865_1015541102 | 90 |
| 59 | 3300006914 | Ga0075436_100122871 | Ga0075436_1001228711 | 90 |
| 60 | 3300007265 | Ga0099794_10006732 | Ga0099794_100067324 | 90 |
| 61 | 3300007265 | Ga0099794_10011099 | Ga0099794_100110993 | 90 |
| 62 | 3300007788 | Ga0099795_10442266 | Ga0099795_104422662 | 90 |
| 63 | 3300009093 | Ga0105240_10314528 | Ga0105240_103145283 | 90 |
| 64 | 3300009094 | Ga0111539_10680077 | Ga0111539_106800772 | 90 |
| 65 | 3300009098 | Ga0105245_10012255 | Ga0105245_100122552 | 90 |
| 66 | 3300009098 | Ga0105245_10157653 | Ga0105245_101576533 | 90 |
| 67 | 3300009098 | Ga0105245_10234801 | Ga0105245_102348012 | 90 |
| 68 | 3300009098 | Ga0105245_10663757 | Ga0105245_106637571 | 90 |
| 69 | 3300009098 | Ga0105245_13173862 | Ga0105245_131738622 | 90 |
| 70 | 3300009101 | Ga0105247_11759763 | Ga0105247_117597631 | 90 |
| 71 | 3300009147 | Ga0114129_10891959 | Ga0114129_108919592 | 90 |
| 72 | 3300009174 | Ga0105241_10177201 | Ga0105241_101772012 | 90 |
| 73 | 3300009176 | Ga0105242_10103227 | Ga0105242_101032272 | 90 |
| 74 | 3300009176 | Ga0105242_10626292 | Ga0105242_106262922 | 90 |
| 75 | 3300009545 | Ga0105237_10306788 | Ga0105237_103067882 | 90 |
| 76 | 3300010375 | Ga0105239_10735927 | Ga0105239_107359272 | 90 |
| 77 | 3300010375 | Ga0105239_12506764 | Ga0105239_125067642 | 90 |
| 78 | 3300010375 | Ga0105239_13016546 | Ga0105239_130165462 | 90 |
| 79 | 3300013102 | Ga0157371_10615786 | Ga0157371_106157862 | 90 |
| 80 | 3300013104 | Ga0157370_12095498 | Ga0157370_120954981 | 90 |
| 81 | 3300013296 | Ga0157374_10148711 | Ga0157374_101487113 | 90 |
| 82 | 3300013297 | Ga0157378_10079078 | Ga0157378_100790783 | 90 |
| 83 | 3300013297 | Ga0157378_10372432 | Ga0157378_103724322 | 90 |
| 84 | 3300013306 | Ga0163162_10627626 | Ga0163162_106276262 | 90 |
| 85 | 3300013307 | Ga0157372_10293396 | Ga0157372_102933961 | 90 |
| 86 | 3300013307 | Ga0157372_10444145 | Ga0157372_104441452 | 90 |
| 87 | 3300013308 | Ga0157375_10713865 | Ga0157375_107138652 | 90 |
| 88 | 3300013308 | Ga0157375_11683020 | Ga0157375_116830201 | 90 |
| 89 | 3300014325 | Ga0163163_11404405 | Ga0163163_114044052 | 90 |
| 90 | 3300014969 | Ga0157376_11138963 | Ga0157376_111389632 | 90 |
| 91 | 3300020070 | Ga0206356_11718267 | Ga0206356_117182671 | 90 |
| 92 | 3300020078 | Ga0206352_10970138 | Ga0206352_109701382 | 90 |
| 93 | 3300021384 | Ga0213876_10066540 | Ga0213876_100665402 | 90 |
| 94 | 3300021384 | Ga0213876_10273300 | Ga0213876_102733001 | 90 |
| 95 | 3300021384 | Ga0213876_10602290 | Ga0213876_106022902 | 90 |
| 96 | 3300025906 | Ga0207699_10000108 | Ga0207699_1000010854 | 90 |
| 97 | 3300025906 | Ga0207699_11215942 | Ga0207699_112159422 | 90 |
| 98 | 3300025907 | Ga0207645_10499210 | Ga0207645_104992101 | 90 |
| 99 | 3300025910 | Ga0207684_10000002 | Ga0207684_10000002800 | 90 |
| 100 | 3300025910 | Ga0207684_10103890 | Ga0207684_101038902 | 90 |
| 101 | 3300025911 | Ga0207654_10289692 | Ga0207654_102896922 | 90 |
| 102 | 3300025912 | Ga0207707_10003730 | Ga0207707_1000373010 | 90 |
| 103 | 3300025912 | Ga0207707_10637340 | Ga0207707_106373401 | 90 |
| 104 | 3300025912 | Ga0207707_11098701 | Ga0207707_110987012 | 90 |
| 105 | 3300025914 | Ga0207671_10475024 | Ga0207671_104750242 | 90 |
| 106 | 3300025915 | Ga0207693_10206000 | Ga0207693_102060002 | 90 |
| 107 | 3300025917 | Ga0207660_10046242 | Ga0207660_100462422 | 90 |
| 108 | 3300025917 | Ga0207660_10124029 | Ga0207660_101240293 | 90 |
| 109 | 3300025917 | Ga0207660_11123961 | Ga0207660_111239612 | 90 |
| 110 | 3300025921 | Ga0207652_10084586 | Ga0207652_100845862 | 90 |
| 111 | 3300025921 | Ga0207652_11472791 | Ga0207652_114727912 | 90 |
| 112 | 3300025921 | Ga0207652_11515097 | Ga0207652_115150972 | 90 |
| 113 | 3300025922 | Ga0207646_10000402 | Ga0207646_1000040211 | 90 |
| 114 | 3300025922 | Ga0207646_10029400 | Ga0207646_100294007 | 90 |
| 115 | 3300025927 | Ga0207687_10013476 | Ga0207687_100134766 | 90 |
| 116 | 3300025927 | Ga0207687_10264434 | Ga0207687_102644342 | 90 |
| 117 | 3300025927 | Ga0207687_10384681 | Ga0207687_103846812 | 90 |
| 118 | 3300025927 | Ga0207687_10916417 | Ga0207687_109164171 | 90 |
| 119 | 3300025928 | Ga0207700_10004274 | Ga0207700_100042745 | 90 |
| 120 | 3300025929 | Ga0207664_10118235 | Ga0207664_101182352 | 90 |
| 121 | 3300025932 | Ga0207690_10352890 | Ga0207690_103528902 | 90 |
| 122 | 3300025934 | Ga0207686_10044859 | Ga0207686_100448593 | 90 |
| 123 | 3300025938 | Ga0207704_11419181 | Ga0207704_114191812 | 90 |
| 124 | 3300025939 | Ga0207665_10164507 | Ga0207665_101645073 | 90 |
| 125 | 3300025949 | Ga0207667_10022659 | Ga0207667_100226596 | 90 |
| 126 | 3300025949 | Ga0207667_10614612 | Ga0207667_106146121 | 90 |
| 127 | 3300025981 | Ga0207640_10157558 | Ga0207640_101575582 | 90 |
| 128 | 3300025986 | Ga0207658_12186541 | Ga0207658_121865411 | 90 |
| 129 | 3300026035 | Ga0207703_10671546 | Ga0207703_106715462 | 90 |
| 130 | 3300026041 | Ga0207639_11348316 | Ga0207639_113483162 | 90 |
| 131 | 3300026089 | Ga0207648_11065272 | Ga0207648_110652722 | 90 |
| 132 | 3300026121 | Ga0207683_10723554 | Ga0207683_107235541 | 90 |
| 133 | 3300027671 | Ga0209588_1000075 | Ga0209588_100007535 | 90 |
| 134 | 3300027671 | Ga0209588_1097689 | Ga0209588_10976891 | 90 |
| 135 | 3300028573 | Ga0265334_10162725 | Ga0265334_101627252 | 90 |
| 136 | 3300028800 | Ga0265338_10230561 | Ga0265338_102305612 | 90 |
| 137 | 3300028800 | Ga0265338_10787523 | Ga0265338_107875232 | 90 |
| 138 | 3300031240 | Ga0265320_10063768 | Ga0265320_100637682 | 90 |
| 139 | 3300031241 | Ga0265325_10023354 | Ga0265325_100233545 | 90 |
| 140 | 3300031241 | Ga0265325_10071670 | Ga0265325_100716702 | 90 |
| 141 | 3300031247 | Ga0265340_10006720 | Ga0265340_100067203 | 90 |
| 142 | 3300031249 | Ga0265339_10192488 | Ga0265339_101924882 | 90 |
| 143 | 3300031344 | Ga0265316_10040573 | Ga0265316_100405733 | 90 |
| 144 | 3300031344 | Ga0265316_10072699 | Ga0265316_100726993 | 90 |
| 145 | 3300031548 | Ga0307408_100777653 | Ga0307408_1007776532 | 90 |
| 146 | 3300031548 | Ga0307408_101396264 | Ga0307408_1013962641 | 90 |
| 147 | 3300031548 | Ga0307408_101401710 | Ga0307408_1014017102 | 90 |
| 148 | 3300031548 | Ga0307408_101717048 | Ga0307408_1017170482 | 90 |
| 149 | 3300031548 | Ga0307408_101979053 | Ga0307408_1019790532 | 90 |
| 150 | 3300031595 | Ga0265313_10204456 | Ga0265313_102044561 | 90 |
| 151 | 3300031711 | Ga0265314_10236489 | Ga0265314_102364892 | 90 |
| 152 | 3300031712 | Ga0265342_10006924 | Ga0265342_100069249 | 90 |
| 153 | 3300031731 | Ga0307405_10079090 | Ga0307405_100790904 | 90 |
| 154 | 3300031731 | Ga0307405_10192823 | Ga0307405_101928233 | 90 |
| 155 | 3300031731 | Ga0307405_10274636 | Ga0307405_102746362 | 90 |
| 156 | 3300031731 | Ga0307405_10603386 | Ga0307405_106033862 | 90 |
| 157 | 3300031824 | Ga0307413_10040481 | Ga0307413_100404812 | 90 |
| 158 | 3300031824 | Ga0307413_10273263 | Ga0307413_102732631 | 90 |
| 159 | 3300031852 | Ga0307410_10020858 | Ga0307410_100208584 | 90 |
| 160 | 3300031852 | Ga0307410_11803155 | Ga0307410_118031552 | 90 |
| 161 | 3300031901 | Ga0307406_10121266 | Ga0307406_101212664 | 90 |
| 162 | 3300031901 | Ga0307406_12052514 | Ga0307406_120525142 | 90 |
| 163 | 3300031903 | Ga0307407_10021149 | Ga0307407_100211494 | 90 |
| 164 | 3300031903 | Ga0307407_10039911 | Ga0307407_100399112 | 90 |
| 165 | 3300031911 | Ga0307412_10021731 | Ga0307412_100217313 | 90 |
| 166 | 3300031911 | Ga0307412_10063844 | Ga0307412_100638443 | 90 |
| 167 | 3300031911 | Ga0307412_11023170 | Ga0307412_110231702 | 90 |
| 168 | 3300031995 | Ga0307409_100030345 | Ga0307409_1000303453 | 90 |
| 169 | 3300032002 | Ga0307416_100035410 | Ga0307416_1000354104 | 90 |
| 170 | 3300032002 | Ga0307416_100107725 | Ga0307416_1001077252 | 90 |
| 171 | 3300032002 | Ga0307416_100526507 | Ga0307416_1005265071 | 90 |
| 172 | 3300032002 | Ga0307416_102136656 | Ga0307416_1021366562 | 90 |
| 173 | 3300032002 | Ga0307416_102905323 | Ga0307416_1029053232 | 90 |
| 174 | 3300032004 | Ga0307414_10002305 | Ga0307414_100023055 | 90 |
| 175 | 3300032004 | Ga0307414_10098419 | Ga0307414_100984193 | 90 |
| 176 | 3300032005 | Ga0307411_10029315 | Ga0307411_100293153 | 90 |
| 177 | 3300032005 | Ga0307411_10243447 | Ga0307411_102434472 | 90 |
| 178 | 3300032005 | Ga0307411_12104509 | Ga0307411_121045091 | 90 |
| 179 | 3300032126 | Ga0307415_100426662 | Ga0307415_1004266622 | 90 |
| 180 | 3300032126 | Ga0307415_102152804 | Ga0307415_1021528042 | 90 |
| 181 | 3300034820 | Ga0373959_0047005 | Ga0373959_0047005_189_488 | 90 |
| 182 | 3300035090 | Ga0373949_0044550 | Ga0373949_0044550_20_319 | 90 |
| 183 | 3300035115 | Ga0373941_0011043 | Ga0373941_0011043_776_1075 | 90 |
| 184 | 3300035121 | Ga0373960_0059031 | Ga0373960_0059031_752_1051 | 90 |
| 185 | 3300035241 | Ga0373961_0127900 | Ga0373961_0127900_505_804 | 90 |
| 186 | 3300039437 | Ga0436365_0404153 | Ga0436365_0404153_766_1038 | 90 |
| 187 | 3300039437 | Ga0436365_0468139 | Ga0436365_0468139_2660_2932 | 90 |
| 188 | 3300039437 | Ga0436365_1371830 | Ga0436365_1371830_2477_2749 | 90 |
| 189 | 3300039437 | Ga0436365_1677033 | Ga0436365_1677033_131_403 | 90 |
| 190 | 3300039438 | Ga0436360_0609108 | Ga0436360_0609108_277_573 | 90 |
| 191 | 3300039450 | Ga0436363_0198945 | Ga0436363_0198945_68_364 | 90 |
| 192 | 3300039453 | Ga0436362_0732142 | Ga0436362_0732142_104_376 | 90 |
| 193 | 3300042121 | Ga0450919_017048 | Ga0450919_017048_63_338 | 90 |
| 194 | 3300044684 | Ga0466966_0167044 | Ga0466966_0167044_156_428 | 90 |
| 195 | 3300044693 | Ga0466961_0125961 | Ga0466961_0125961_841_1113 | 90 |
| 196 | 3300044694 | Ga0466963_0050051 | Ga0466963_0050051_624_896 | 90 |
| 197 | 3300044694 | Ga0466963_0072183 | Ga0466963_0072183_2005_2283 | 90 |
| 198 | 3300044706 | Ga0466964_0095841 | Ga0466964_0095841_746_1018 | 90 |
| 199 | 3300044719 | Ga0466971_0035187 | Ga0466971_0035187_1750_2022 | 90 |
| 200 | 3300044735 | Ga0466968_0111307 | Ga0466968_0111307_532_804 | 90 |
| 201 | 3300044765 | Ga0466970_0360348 | Ga0466970_0360348_145_417 | 90 |
| 202 | 3300044842 | Ga0466957_0035664 | Ga0466957_0035664_754_1026 | 90 |
| 203 | 3300044842 | Ga0466957_0176148 | Ga0466957_0176148_743_1015 | 90 |
| 204 | 3300044842 | Ga0466957_0575222 | Ga0466957_0575222_316_594 | 90 |
| 205 | 3300045049 | Ga0466959_0423457 | Ga0466959_0423457_338_610 | 90 |
| 206 | 3300045836 | Ga0466958_0010853 | Ga0466958_0010853_780_1052 | 90 |
| 207 | 3300045836 | Ga0466958_0089369 | Ga0466958_0089369_685_963 | 90 |
| 208 | 3300045976 | Ga0466967_0072084 | Ga0466967_0072084_324_596 | 90 |
| 209 | 3300045976 | Ga0466967_0359886 | Ga0466967_0359886_930_1208 | 90 |
| 210 | 3300045976 | Ga0466967_0780884 | Ga0466967_0780884_32_304 | 90 |
| 211 | 3300045976 | Ga0466967_1005303 | Ga0466967_1005303_302_574 | 90 |
| 212 | 3300045976 | Ga0466967_1663894 | Ga0466967_1663894_20_292 | 90 |
| 213 | 3300046499 | Ga0495594_0234034 | Ga0495594_0234034_530_802 | 90 |
| 214 | 3300046674 | Ga0495588_0272951 | Ga0495588_0272951_441_713 | 90 |
| 215 | 3300048914 | Ga0496111_0934097 | Ga0496111_0934097_324_596 | 90 |
| 216 | 3300048915 | Ga0496112_0634585 | Ga0496112_0634585_416_718 | 90 |
| 217 | 3300049585 | Ga0501069_0000856 | Ga0501069_0000856_10534_10806 | 90 |
| 218 | 3300049586 | Ga0501070_0043543 | Ga0501070_0043543_593_865 | 90 |
| 219 | 3300049589 | Ga0501073_0253965 | Ga0501073_0253965_685_957 | 90 |
| 220 | 3300049652 | Ga0501202_217741 | Ga0501202_217741_87_362 | 90 |
| 221 | 3300049656 | Ga0501209_251716 | Ga0501209_251716_256_534 | 90 |
| 222 | 3300049742 | Ga0501080_0000096 | Ga0501080_0000096_52183_52455 | 90 |
| 223 | 3300049765 | Ga0501268_126596 | Ga0501268_126596_24_308 | 90 |
| 224 | 3300049824 | Ga0501045_1025408 | Ga0501045_1025408_13_291 | 90 |
| 225 | 3300050507 | nmdc:mga05p37_1106987_c1 | nmdc:mga05p37_1106987_c1_133_408 | 90 |
| 226 | 3300050510 | nmdc:mga06r32_183496_c1 | nmdc:mga06r32_183496_c1_617_892 | 90 |
| 227 | 3300050510 | nmdc:mga06r32_947006_c1 | nmdc:mga06r32_947006_c1_157_435 | 90 |
| 228 | 3300050512 | nmdc:mga0n895_356419_c1 | nmdc:mga0n895_356419_c1_688_963 | 90 |
| 229 | 3300050513 | nmdc:mga0rr50_73359_c1 | nmdc:mga0rr50_73359_c1_2263_2562 | 90 |
| 230 | 3300050514 | nmdc:mga08x19_304512_c1 | nmdc:mga08x19_304512_c1_555_854 | 90 |
| 231 | 3300050515 | nmdc:mga0a205_1229675_c1 | nmdc:mga0a205_1229675_c1_283_561 | 90 |
| 232 | 3300050515 | nmdc:mga0a205_283833_c1 | nmdc:mga0a205_283833_c1_421_720 | 90 |
| 233 | 3300053131 | Ga0500652_142965 | Ga0500652_142965_488_766 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.8681 | 3 | 83 |
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.839 | 3 | 83 |
| 2ift-assembly1.cif.gz_A | crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102. | 0.7422 | 38 | 59 |
| 2fpo-assembly4.cif.gz_D | putative methyltransferase yhhf from escherichia coli. | 0.6923 | 36 | 57 |
| 2zho-assembly1.cif.gz_B | crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form) | 0.6797 | 5 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8424 | 4 | 83 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8147 | 1 | 80 | 3.30.70.3090 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8141 | 4 | 83 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7717 | 1 | 80 | 3.30.70.3090 |
| 2vjvB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like | 0.7146 | 2 | 83 | 3.30.70.1290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530QG42-F1-model_v4 | DUF4242 domain-containing protein | 0.9957 | 1 | 82 |
|
| AF-A0A286C6H2-F1-model_v4 | DUF4242 domain-containing protein | 0.9902 | 1 | 80 |
|
| AF-A0A4V3UYL4-F1-model_v4 | DUF4242 domain-containing protein | 0.9848 | 1 | 85 |
|
| AF-A0A530QG42-F1-model_v4 | DUF4242 domain-containing protein | 0.9837 | 1 | 82 |
|
| AF-A0A3D8M4I6-F1-model_v4 | DUF4242 domain-containing protein | 0.9788 | 2 | 88 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar