F345959

General Info

Members Datasets Scaffolds Average Seq Length
233 151 233 94

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100190681|Ga0070712_1001906812
Length 101
Sequence MPKFVIERDLPGAGALSADELRAISQKSNKVIADLGPEIRWLESYVTEDKLYCVYVAPDADIIFEHARCGGFPANKVTRVANIIDPSTGDAAERVTAKSAS

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
140 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0.86
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11734451 3300004798 Unclassified 514
2 Ga0058860_10047862 3300004801 Archaea 609
3 Ga0065715_10096520 3300005293 Bacteria 3865
4 Ga0065715_10177489 3300005293 Bacteria 1500
5 Ga0070676_10664087 3300005328 Unclassified 758
6 Ga0070683_100109589 3300005329 Bacteria 2604
7 Ga0070680_100001942 3300005336 Bacteria 15203
8 Ga0070680_100152375 3300005336 Bacteria 1941
9 Ga0070680_100226369 3300005336 Bacteria 1579
10 Ga0070680_100366659 3300005336 Bacteria 1225
11 Ga0070682_100014043 3300005337 Bacteria 4622
12 Ga0070682_100184665 3300005337 Unclassified 1459
13 Ga0070682_100339387 3300005337 Bacteria 1116
14 Ga0070689_100191570 3300005340 Bacteria 1665
15 Ga0070692_10211818 3300005345 Unclassified 1140
16 Ga0070675_100500553 3300005354 Bacteria 1095
17 Ga0070673_100461409 3300005364 Bacteria 1144
18 Ga0070659_100350277 3300005366 Bacteria 1239
19 Ga0070709_10001406 3300005434 Bacteria 13046
20 Ga0070714_100095033 3300005435 Bacteria 2617
21 Ga0070713_100017375 3300005436 Bacteria 5439
22 Ga0070701_11362929 3300005438 Bacteria 509
23 Ga0070681_10011978 3300005458 Bacteria 8598
24 Ga0070681_10060364 3300005458 Bacteria 3769
25 Ga0070681_10494681 3300005458 Bacteria 1136
26 Ga0070706_100073668 3300005467 Bacteria 3161
27 Ga0070706_100125973 3300005467 Bacteria 2388
28 Ga0070707_100415610 3300005468 Bacteria 1305
29 Ga0070707_100855736 3300005468 Bacteria 873
30 Ga0070707_101210848 3300005468 Bacteria 721
31 Ga0070698_101338525 3300005471 Bacteria 666
32 Ga0070699_100001771 3300005518 Bacteria 19664
33 Ga0070699_100125844 3300005518 Bacteria 2256
34 Ga0070679_100245442 3300005530 Unclassified 1747
35 Ga0070679_100641042 3300005530 Bacteria 1005
36 Ga0070697_100048730 3300005536 Bacteria 3435
37 Ga0068853_100642747 3300005539 Unclassified 1009
38 Ga0070686_100130901 3300005544 Bacteria 1735
39 Ga0070695_100039792 3300005545 Bacteria 2973
40 Ga0070695_100984108 3300005545 Bacteria 685
41 Ga0070693_101669356 3300005547 Bacteria 502
42 Ga0070704_100194674 3300005549 Bacteria 1632
43 Ga0068855_101604549 3300005563 Bacteria 665
44 Ga0068855_102497099 3300005563 Bacteria 514
45 Ga0068854_100176669 3300005578 Bacteria 1665
46 Ga0068856_100206275 3300005614 Unclassified 1980
47 Ga0070716_100090027 3300006173 Bacteria 1855
48 Ga0070712_100190681 3300006175 Bacteria 1604
49 Ga0070712_101819181 3300006175 Unclassified 533
50 Ga0075431_100159644 3300006847 Bacteria 2318
51 Ga0075431_100325698 3300006847 Bacteria 1548
52 Ga0075433_10061141 3300006852 Bacteria 3299
53 Ga0075433_10455172 3300006852 Bacteria 1128
54 Ga0075434_100276003 3300006871 Bacteria 1700
55 Ga0075429_101441277 3300006880 Bacteria 599
56 Ga0068865_101554110 3300006881 Bacteria 594
57 Ga0075436_100122871 3300006914 Bacteria 1818
58 Ga0099794_10006732 3300007265 Bacteria 4671
59 Ga0099794_10011099 3300007265 Bacteria 3850
60 Ga0099795_10442266 3300007788 Bacteria 597
61 Ga0105240_10314528 3300009093 Bacteria 1787
62 Ga0111539_10680077 3300009094 Bacteria 1198
63 Ga0105245_10012255 3300009098 Bacteria 7460
64 Ga0105245_10157653 3300009098 Bacteria 2151
65 Ga0105245_10234801 3300009098 Unclassified 1775
66 Ga0105245_10663757 3300009098 Bacteria 1073
67 Ga0105245_13173862 3300009098 Unclassified 509
68 Ga0105247_11759763 3300009101 Bacteria 514
69 Ga0114129_10891959 3300009147 Bacteria 1127
70 Ga0105241_10177201 3300009174 Bacteria 1765
71 Ga0105242_10103227 3300009176 Bacteria 2418
72 Ga0105242_10626292 3300009176 Bacteria 1043
73 Ga0105237_10306788 3300009545 Bacteria 1590
74 Ga0105239_10735927 3300010375 Bacteria 1128
75 Ga0105239_12506764 3300010375 Bacteria 601
76 Ga0105239_13016546 3300010375 Bacteria 549
77 Ga0157371_10615786 3300013102 Bacteria 808
78 Ga0157370_12095498 3300013104 Unclassified 507
79 Ga0157374_10148711 3300013296 Unclassified 2277
80 Ga0157378_10079078 3300013297 Bacteria 2968
81 Ga0157378_10372432 3300013297 Bacteria 1400
82 Ga0163162_10627626 3300013306 Bacteria 1199
83 Ga0157372_10293396 3300013307 Unclassified 1891
84 Ga0157372_10444145 3300013307 Bacteria 1512
85 Ga0157375_10713865 3300013308 Bacteria 1156
86 Ga0157375_11683020 3300013308 Bacteria 751
87 Ga0163163_11404405 3300014325 Bacteria 760
88 Ga0157376_11138963 3300014969 Bacteria 807
89 Ga0206356_11718267 3300020070 Bacteria 500
90 Ga0206352_10970138 3300020078 Bacteria 586
91 Ga0213876_10066540 3300021384 Bacteria 1902
92 Ga0213876_10273300 3300021384 Bacteria 898
93 Ga0213876_10602290 3300021384 Bacteria 585
94 Ga0207699_10000108 3300025906 Bacteria 58752
95 Ga0207699_11215942 3300025906 Unclassified 558
96 Ga0207645_10499210 3300025907 Bacteria 824
97 Ga0207684_10000002 3300025910 Bacteria 1042751
98 Ga0207684_10103890 3300025910 Bacteria 2429
99 Ga0207654_10289692 3300025911 Bacteria 1110
100 Ga0207707_10003730 3300025912 Bacteria 13492
101 Ga0207707_10637340 3300025912 Bacteria 899
102 Ga0207707_11098701 3300025912 Bacteria 648
103 Ga0207671_10475024 3300025914 Bacteria 996
104 Ga0207693_10206000 3300025915 Bacteria 1546
105 Ga0207660_10046242 3300025917 Unclassified 3070
106 Ga0207660_10124029 3300025917 Bacteria 1960
107 Ga0207660_11123961 3300025917 Bacteria 640
108 Ga0207652_10084586 3300025921 Unclassified 2779
109 Ga0207652_11472791 3300025921 Bacteria 585
110 Ga0207652_11515097 3300025921 Unclassified 575
111 Ga0207646_10000402 3300025922 Bacteria 58018
112 Ga0207646_10029400 3300025922 Bacteria 4995
113 Ga0207687_10013476 3300025927 Bacteria 5338
114 Ga0207687_10264434 3300025927 Bacteria 1373
115 Ga0207687_10384681 3300025927 Unclassified 1150
116 Ga0207687_10916417 3300025927 Bacteria 750
117 Ga0207700_10004274 3300025928 Bacteria 8397
118 Ga0207664_10118235 3300025929 Bacteria 2214
119 Ga0207690_10352890 3300025932 Bacteria 1163
120 Ga0207686_10044859 3300025934 Bacteria 2717
121 Ga0207704_11419181 3300025938 Bacteria 595
122 Ga0207665_10164507 3300025939 Bacteria 1598
123 Ga0207667_10022659 3300025949 Bacteria 6929
124 Ga0207667_10614612 3300025949 Unclassified 1095
125 Ga0207640_10157558 3300025981 Bacteria 1676
126 Ga0207658_12186541 3300025986 Bacteria 502
127 Ga0207703_10671546 3300026035 Unclassified 984
128 Ga0207639_11348316 3300026041 Unclassified 669
129 Ga0207648_11065272 3300026089 Bacteria 758
130 Ga0207683_10723554 3300026121 Bacteria 923
131 Ga0209588_1000075 3300027671 Bacteria 33877
132 Ga0209588_1097689 3300027671 Bacteria 946
133 Ga0265334_10162725 3300028573 Bacteria 784
134 Ga0265338_10230561 3300028800 Bacteria 1377
135 Ga0265338_10787523 3300028800 Bacteria 652
136 Ga0265320_10063768 3300031240 Bacteria 1752
137 Ga0265325_10023354 3300031241 Bacteria 3377
138 Ga0265325_10071670 3300031241 Bacteria 1738
139 Ga0265340_10006720 3300031247 Bacteria 6299
140 Ga0265339_10192488 3300031249 Bacteria 1010
141 Ga0265316_10040573 3300031344 Bacteria 3731
142 Ga0265316_10072699 3300031344 Bacteria 2649
143 Ga0307408_100777653 3300031548 Bacteria 867
144 Ga0307408_101396264 3300031548 Bacteria 659
145 Ga0307408_101401710 3300031548 Bacteria 658
146 Ga0307408_101717048 3300031548 Bacteria 598
147 Ga0307408_101979053 3300031548 Bacteria 560
148 Ga0265313_10204456 3300031595 Bacteria 820
149 Ga0265314_10236489 3300031711 Bacteria 1057
150 Ga0265342_10006924 3300031712 Bacteria 8380
151 Ga0307405_10079090 3300031731 Bacteria 2142
152 Ga0307405_10192823 3300031731 Bacteria 1473
153 Ga0307405_10274636 3300031731 Bacteria 1265
154 Ga0307405_10603386 3300031731 Bacteria 896
155 Ga0307413_10040481 3300031824 Bacteria 2719
156 Ga0307413_10273263 3300031824 Bacteria 1266
157 Ga0307410_10020858 3300031852 Bacteria 4018
158 Ga0307410_11803155 3300031852 Unclassified 543
159 Ga0307406_10121266 3300031901 Bacteria 1818
160 Ga0307406_12052514 3300031901 Bacteria 512
161 Ga0307407_10021149 3300031903 Bacteria 3349
162 Ga0307407_10039911 3300031903 Bacteria 2613
163 Ga0307412_10021731 3300031911 Bacteria 3924
164 Ga0307412_10063844 3300031911 Bacteria 2486
165 Ga0307412_11023170 3300031911 Bacteria 731
166 Ga0307409_100030345 3300031995 Bacteria 3882
167 Ga0307416_100035410 3300032002 Bacteria 3812
168 Ga0307416_100107725 3300032002 Bacteria 2446
169 Ga0307416_100526507 3300032002 Bacteria 1251
170 Ga0307416_102136656 3300032002 Unclassified 662
171 Ga0307416_102905323 3300032002 Bacteria 573
172 Ga0307414_10002305 3300032004 Bacteria 9973
173 Ga0307414_10098419 3300032004 Bacteria 2194
174 Ga0307411_10029315 3300032005 Bacteria 3358
175 Ga0307411_10243447 3300032005 Bacteria 1409
176 Ga0307411_12104509 3300032005 Bacteria 528
177 Ga0307415_100426662 3300032126 Bacteria 1139
178 Ga0307415_102152804 3300032126 Bacteria 545
179 Ga0373959_0047005 3300034820 Bacteria 922
180 Ga0373949_0044550 3300035090 Bacteria 1101
181 Ga0373941_0011043 3300035115 Unclassified 2325
182 Ga0373960_0059031 3300035121 Bacteria 1159
183 Ga0373961_0127900 3300035241 Bacteria 848
184 Ga0436365_0404153 3300039437 Bacteria 1590
185 Ga0436365_0468139 3300039437 Bacteria 4884
186 Ga0436365_1371830 3300039437 Bacteria 6255
187 Ga0436365_1677033 3300039437 Bacteria 930
188 Ga0436360_0609108 3300039438 Bacteria 1888
189 Ga0436363_0198945 3300039450 Bacteria 647
190 Ga0436362_0732142 3300039453 Bacteria 603
191 Ga0450919_017048 3300042121 Bacteria 819
192 Ga0439434_0098730 3300042435 Bacteria 939
193 Ga0466966_0167044 3300044684 Bacteria 1338
194 Ga0466961_0125961 3300044693 Bacteria 1607
195 Ga0466963_0050051 3300044694 Bacteria 2765
196 Ga0466963_0072183 3300044694 Bacteria 2325
197 Ga0466964_0095841 3300044706 Bacteria 1299
198 Ga0466971_0035187 3300044719 Bacteria 2245
199 Ga0466968_0111307 3300044735 Bacteria 1231
200 Ga0466970_0360348 3300044765 Bacteria 826
201 Ga0466957_0035664 3300044842 Bacteria 2985
202 Ga0466957_0176148 3300044842 Bacteria 1395
203 Ga0466957_0575222 3300044842 Bacteria 787
204 Ga0466959_0423457 3300045049 Bacteria 904
205 Ga0466958_0010853 3300045836 Bacteria 5115
206 Ga0466958_0089369 3300045836 Bacteria 1905
207 Ga0466967_0072084 3300045976 Bacteria 3095
208 Ga0466967_0359886 3300045976 Bacteria 1410
209 Ga0466967_0780884 3300045976 Unclassified 948
210 Ga0466967_1005303 3300045976 Bacteria 830
211 Ga0466967_1663894 3300045976 Bacteria 636
212 Ga0495594_0234034 3300046499 Unclassified 1047
213 Ga0495588_0272951 3300046674 Bacteria 891
214 Ga0496111_0934097 3300048914 Archaea 624
215 Ga0496112_0634585 3300048915 Bacteria 999
216 Ga0501069_0000856 3300049585 Bacteria 14425
217 Ga0501070_0043543 3300049586 Bacteria 3735
218 Ga0501073_0253965 3300049589 Bacteria 1213
219 Ga0501202_217741 3300049652 Bacteria 528
220 Ga0501209_251716 3300049656 Bacteria 552
221 Ga0501080_0000096 3300049742 Bacteria 59454
222 Ga0501268_126596 3300049765 Bacteria 571
223 Ga0501045_1025408 3300049824 Bacteria 605
224 nmdc:mga05p37_1106987_c1 3300050507 Bacteria 829
225 nmdc:mga06r32_183496_c1 3300050510 Bacteria 2079
226 nmdc:mga06r32_947006_c1 3300050510 Bacteria 816
227 nmdc:mga0n895_356419_c1 3300050512 Bacteria 1481
228 nmdc:mga0rr50_73359_c1 3300050513 Bacteria 2616
229 nmdc:mga08x19_304512_c1 3300050514 Unclassified 1107
230 nmdc:mga0a205_1229675_c1 3300050515 Bacteria 597
231 nmdc:mga0a205_283833_c1 3300050515 Unclassified 1531
232 Ga0500652_142965 3300053131 Bacteria 995
233 Ga0590077_049384 3300059426 Bacteria 943

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059426 Ga0590077_049384 Ga0590077_049384_622_924 75
2 3300042435 Ga0439434_0098730 Ga0439434_0098730_328_594 88
3 3300004798 Ga0058859_11734451 Ga0058859_117344512 90
4 3300004801 Ga0058860_10047862 Ga0058860_100478621 90
5 3300005293 Ga0065715_10096520 Ga0065715_100965205 90
6 3300005293 Ga0065715_10177489 Ga0065715_101774891 90
7 3300005328 Ga0070676_10664087 Ga0070676_106640872 90
8 3300005329 Ga0070683_100109589 Ga0070683_1001095893 90
9 3300005336 Ga0070680_100001942 Ga0070680_1000019428 90
10 3300005336 Ga0070680_100152375 Ga0070680_1001523753 90
11 3300005336 Ga0070680_100226369 Ga0070680_1002263693 90
12 3300005336 Ga0070680_100366659 Ga0070680_1003666592 90
13 3300005337 Ga0070682_100014043 Ga0070682_1000140433 90
14 3300005337 Ga0070682_100184665 Ga0070682_1001846652 90
15 3300005337 Ga0070682_100339387 Ga0070682_1003393872 90
16 3300005340 Ga0070689_100191570 Ga0070689_1001915703 90
17 3300005345 Ga0070692_10211818 Ga0070692_102118183 90
18 3300005354 Ga0070675_100500553 Ga0070675_1005005532 90
19 3300005364 Ga0070673_100461409 Ga0070673_1004614092 90
20 3300005366 Ga0070659_100350277 Ga0070659_1003502772 90
21 3300005434 Ga0070709_10001406 Ga0070709_100014068 90
22 3300005435 Ga0070714_100095033 Ga0070714_1000950332 90
23 3300005436 Ga0070713_100017375 Ga0070713_1000173753 90
24 3300005438 Ga0070701_11362929 Ga0070701_113629292 90
25 3300005458 Ga0070681_10011978 Ga0070681_100119782 90
26 3300005458 Ga0070681_10060364 Ga0070681_100603646 90
27 3300005458 Ga0070681_10494681 Ga0070681_104946811 90
28 3300005467 Ga0070706_100073668 Ga0070706_1000736683 90
29 3300005467 Ga0070706_100125973 Ga0070706_1001259734 90
30 3300005468 Ga0070707_100415610 Ga0070707_1004156102 90
31 3300005468 Ga0070707_100855736 Ga0070707_1008557362 90
32 3300005468 Ga0070707_101210848 Ga0070707_1012108482 90
33 3300005471 Ga0070698_101338525 Ga0070698_1013385252 90
34 3300005518 Ga0070699_100001771 Ga0070699_1000017712 90
35 3300005518 Ga0070699_100125844 Ga0070699_1001258442 90
36 3300005530 Ga0070679_100245442 Ga0070679_1002454422 90
37 3300005530 Ga0070679_100641042 Ga0070679_1006410422 90
38 3300005536 Ga0070697_100048730 Ga0070697_1000487302 90
39 3300005539 Ga0068853_100642747 Ga0068853_1006427472 90
40 3300005544 Ga0070686_100130901 Ga0070686_1001309012 90
41 3300005545 Ga0070695_100039792 Ga0070695_1000397924 90
42 3300005545 Ga0070695_100984108 Ga0070695_1009841081 90
43 3300005547 Ga0070693_101669356 Ga0070693_1016693562 90
44 3300005549 Ga0070704_100194674 Ga0070704_1001946741 90
45 3300005563 Ga0068855_101604549 Ga0068855_1016045492 90
46 3300005563 Ga0068855_102497099 Ga0068855_1024970992 90
47 3300005578 Ga0068854_100176669 Ga0068854_1001766692 90
48 3300005614 Ga0068856_100206275 Ga0068856_1002062752 90
49 3300006173 Ga0070716_100090027 Ga0070716_1000900272 90
50 3300006175 Ga0070712_100190681 Ga0070712_1001906812 90
51 3300006175 Ga0070712_101819181 Ga0070712_1018191812 90
52 3300006847 Ga0075431_100159644 Ga0075431_1001596442 90
53 3300006847 Ga0075431_100325698 Ga0075431_1003256984 90
54 3300006852 Ga0075433_10061141 Ga0075433_100611411 90
55 3300006852 Ga0075433_10455172 Ga0075433_104551722 90
56 3300006871 Ga0075434_100276003 Ga0075434_1002760032 90
57 3300006880 Ga0075429_101441277 Ga0075429_1014412771 90
58 3300006881 Ga0068865_101554110 Ga0068865_1015541102 90
59 3300006914 Ga0075436_100122871 Ga0075436_1001228711 90
60 3300007265 Ga0099794_10006732 Ga0099794_100067324 90
61 3300007265 Ga0099794_10011099 Ga0099794_100110993 90
62 3300007788 Ga0099795_10442266 Ga0099795_104422662 90
63 3300009093 Ga0105240_10314528 Ga0105240_103145283 90
64 3300009094 Ga0111539_10680077 Ga0111539_106800772 90
65 3300009098 Ga0105245_10012255 Ga0105245_100122552 90
66 3300009098 Ga0105245_10157653 Ga0105245_101576533 90
67 3300009098 Ga0105245_10234801 Ga0105245_102348012 90
68 3300009098 Ga0105245_10663757 Ga0105245_106637571 90
69 3300009098 Ga0105245_13173862 Ga0105245_131738622 90
70 3300009101 Ga0105247_11759763 Ga0105247_117597631 90
71 3300009147 Ga0114129_10891959 Ga0114129_108919592 90
72 3300009174 Ga0105241_10177201 Ga0105241_101772012 90
73 3300009176 Ga0105242_10103227 Ga0105242_101032272 90
74 3300009176 Ga0105242_10626292 Ga0105242_106262922 90
75 3300009545 Ga0105237_10306788 Ga0105237_103067882 90
76 3300010375 Ga0105239_10735927 Ga0105239_107359272 90
77 3300010375 Ga0105239_12506764 Ga0105239_125067642 90
78 3300010375 Ga0105239_13016546 Ga0105239_130165462 90
79 3300013102 Ga0157371_10615786 Ga0157371_106157862 90
80 3300013104 Ga0157370_12095498 Ga0157370_120954981 90
81 3300013296 Ga0157374_10148711 Ga0157374_101487113 90
82 3300013297 Ga0157378_10079078 Ga0157378_100790783 90
83 3300013297 Ga0157378_10372432 Ga0157378_103724322 90
84 3300013306 Ga0163162_10627626 Ga0163162_106276262 90
85 3300013307 Ga0157372_10293396 Ga0157372_102933961 90
86 3300013307 Ga0157372_10444145 Ga0157372_104441452 90
87 3300013308 Ga0157375_10713865 Ga0157375_107138652 90
88 3300013308 Ga0157375_11683020 Ga0157375_116830201 90
89 3300014325 Ga0163163_11404405 Ga0163163_114044052 90
90 3300014969 Ga0157376_11138963 Ga0157376_111389632 90
91 3300020070 Ga0206356_11718267 Ga0206356_117182671 90
92 3300020078 Ga0206352_10970138 Ga0206352_109701382 90
93 3300021384 Ga0213876_10066540 Ga0213876_100665402 90
94 3300021384 Ga0213876_10273300 Ga0213876_102733001 90
95 3300021384 Ga0213876_10602290 Ga0213876_106022902 90
96 3300025906 Ga0207699_10000108 Ga0207699_1000010854 90
97 3300025906 Ga0207699_11215942 Ga0207699_112159422 90
98 3300025907 Ga0207645_10499210 Ga0207645_104992101 90
99 3300025910 Ga0207684_10000002 Ga0207684_10000002800 90
100 3300025910 Ga0207684_10103890 Ga0207684_101038902 90
101 3300025911 Ga0207654_10289692 Ga0207654_102896922 90
102 3300025912 Ga0207707_10003730 Ga0207707_1000373010 90
103 3300025912 Ga0207707_10637340 Ga0207707_106373401 90
104 3300025912 Ga0207707_11098701 Ga0207707_110987012 90
105 3300025914 Ga0207671_10475024 Ga0207671_104750242 90
106 3300025915 Ga0207693_10206000 Ga0207693_102060002 90
107 3300025917 Ga0207660_10046242 Ga0207660_100462422 90
108 3300025917 Ga0207660_10124029 Ga0207660_101240293 90
109 3300025917 Ga0207660_11123961 Ga0207660_111239612 90
110 3300025921 Ga0207652_10084586 Ga0207652_100845862 90
111 3300025921 Ga0207652_11472791 Ga0207652_114727912 90
112 3300025921 Ga0207652_11515097 Ga0207652_115150972 90
113 3300025922 Ga0207646_10000402 Ga0207646_1000040211 90
114 3300025922 Ga0207646_10029400 Ga0207646_100294007 90
115 3300025927 Ga0207687_10013476 Ga0207687_100134766 90
116 3300025927 Ga0207687_10264434 Ga0207687_102644342 90
117 3300025927 Ga0207687_10384681 Ga0207687_103846812 90
118 3300025927 Ga0207687_10916417 Ga0207687_109164171 90
119 3300025928 Ga0207700_10004274 Ga0207700_100042745 90
120 3300025929 Ga0207664_10118235 Ga0207664_101182352 90
121 3300025932 Ga0207690_10352890 Ga0207690_103528902 90
122 3300025934 Ga0207686_10044859 Ga0207686_100448593 90
123 3300025938 Ga0207704_11419181 Ga0207704_114191812 90
124 3300025939 Ga0207665_10164507 Ga0207665_101645073 90
125 3300025949 Ga0207667_10022659 Ga0207667_100226596 90
126 3300025949 Ga0207667_10614612 Ga0207667_106146121 90
127 3300025981 Ga0207640_10157558 Ga0207640_101575582 90
128 3300025986 Ga0207658_12186541 Ga0207658_121865411 90
129 3300026035 Ga0207703_10671546 Ga0207703_106715462 90
130 3300026041 Ga0207639_11348316 Ga0207639_113483162 90
131 3300026089 Ga0207648_11065272 Ga0207648_110652722 90
132 3300026121 Ga0207683_10723554 Ga0207683_107235541 90
133 3300027671 Ga0209588_1000075 Ga0209588_100007535 90
134 3300027671 Ga0209588_1097689 Ga0209588_10976891 90
135 3300028573 Ga0265334_10162725 Ga0265334_101627252 90
136 3300028800 Ga0265338_10230561 Ga0265338_102305612 90
137 3300028800 Ga0265338_10787523 Ga0265338_107875232 90
138 3300031240 Ga0265320_10063768 Ga0265320_100637682 90
139 3300031241 Ga0265325_10023354 Ga0265325_100233545 90
140 3300031241 Ga0265325_10071670 Ga0265325_100716702 90
141 3300031247 Ga0265340_10006720 Ga0265340_100067203 90
142 3300031249 Ga0265339_10192488 Ga0265339_101924882 90
143 3300031344 Ga0265316_10040573 Ga0265316_100405733 90
144 3300031344 Ga0265316_10072699 Ga0265316_100726993 90
145 3300031548 Ga0307408_100777653 Ga0307408_1007776532 90
146 3300031548 Ga0307408_101396264 Ga0307408_1013962641 90
147 3300031548 Ga0307408_101401710 Ga0307408_1014017102 90
148 3300031548 Ga0307408_101717048 Ga0307408_1017170482 90
149 3300031548 Ga0307408_101979053 Ga0307408_1019790532 90
150 3300031595 Ga0265313_10204456 Ga0265313_102044561 90
151 3300031711 Ga0265314_10236489 Ga0265314_102364892 90
152 3300031712 Ga0265342_10006924 Ga0265342_100069249 90
153 3300031731 Ga0307405_10079090 Ga0307405_100790904 90
154 3300031731 Ga0307405_10192823 Ga0307405_101928233 90
155 3300031731 Ga0307405_10274636 Ga0307405_102746362 90
156 3300031731 Ga0307405_10603386 Ga0307405_106033862 90
157 3300031824 Ga0307413_10040481 Ga0307413_100404812 90
158 3300031824 Ga0307413_10273263 Ga0307413_102732631 90
159 3300031852 Ga0307410_10020858 Ga0307410_100208584 90
160 3300031852 Ga0307410_11803155 Ga0307410_118031552 90
161 3300031901 Ga0307406_10121266 Ga0307406_101212664 90
162 3300031901 Ga0307406_12052514 Ga0307406_120525142 90
163 3300031903 Ga0307407_10021149 Ga0307407_100211494 90
164 3300031903 Ga0307407_10039911 Ga0307407_100399112 90
165 3300031911 Ga0307412_10021731 Ga0307412_100217313 90
166 3300031911 Ga0307412_10063844 Ga0307412_100638443 90
167 3300031911 Ga0307412_11023170 Ga0307412_110231702 90
168 3300031995 Ga0307409_100030345 Ga0307409_1000303453 90
169 3300032002 Ga0307416_100035410 Ga0307416_1000354104 90
170 3300032002 Ga0307416_100107725 Ga0307416_1001077252 90
171 3300032002 Ga0307416_100526507 Ga0307416_1005265071 90
172 3300032002 Ga0307416_102136656 Ga0307416_1021366562 90
173 3300032002 Ga0307416_102905323 Ga0307416_1029053232 90
174 3300032004 Ga0307414_10002305 Ga0307414_100023055 90
175 3300032004 Ga0307414_10098419 Ga0307414_100984193 90
176 3300032005 Ga0307411_10029315 Ga0307411_100293153 90
177 3300032005 Ga0307411_10243447 Ga0307411_102434472 90
178 3300032005 Ga0307411_12104509 Ga0307411_121045091 90
179 3300032126 Ga0307415_100426662 Ga0307415_1004266622 90
180 3300032126 Ga0307415_102152804 Ga0307415_1021528042 90
181 3300034820 Ga0373959_0047005 Ga0373959_0047005_189_488 90
182 3300035090 Ga0373949_0044550 Ga0373949_0044550_20_319 90
183 3300035115 Ga0373941_0011043 Ga0373941_0011043_776_1075 90
184 3300035121 Ga0373960_0059031 Ga0373960_0059031_752_1051 90
185 3300035241 Ga0373961_0127900 Ga0373961_0127900_505_804 90
186 3300039437 Ga0436365_0404153 Ga0436365_0404153_766_1038 90
187 3300039437 Ga0436365_0468139 Ga0436365_0468139_2660_2932 90
188 3300039437 Ga0436365_1371830 Ga0436365_1371830_2477_2749 90
189 3300039437 Ga0436365_1677033 Ga0436365_1677033_131_403 90
190 3300039438 Ga0436360_0609108 Ga0436360_0609108_277_573 90
191 3300039450 Ga0436363_0198945 Ga0436363_0198945_68_364 90
192 3300039453 Ga0436362_0732142 Ga0436362_0732142_104_376 90
193 3300042121 Ga0450919_017048 Ga0450919_017048_63_338 90
194 3300044684 Ga0466966_0167044 Ga0466966_0167044_156_428 90
195 3300044693 Ga0466961_0125961 Ga0466961_0125961_841_1113 90
196 3300044694 Ga0466963_0050051 Ga0466963_0050051_624_896 90
197 3300044694 Ga0466963_0072183 Ga0466963_0072183_2005_2283 90
198 3300044706 Ga0466964_0095841 Ga0466964_0095841_746_1018 90
199 3300044719 Ga0466971_0035187 Ga0466971_0035187_1750_2022 90
200 3300044735 Ga0466968_0111307 Ga0466968_0111307_532_804 90
201 3300044765 Ga0466970_0360348 Ga0466970_0360348_145_417 90
202 3300044842 Ga0466957_0035664 Ga0466957_0035664_754_1026 90
203 3300044842 Ga0466957_0176148 Ga0466957_0176148_743_1015 90
204 3300044842 Ga0466957_0575222 Ga0466957_0575222_316_594 90
205 3300045049 Ga0466959_0423457 Ga0466959_0423457_338_610 90
206 3300045836 Ga0466958_0010853 Ga0466958_0010853_780_1052 90
207 3300045836 Ga0466958_0089369 Ga0466958_0089369_685_963 90
208 3300045976 Ga0466967_0072084 Ga0466967_0072084_324_596 90
209 3300045976 Ga0466967_0359886 Ga0466967_0359886_930_1208 90
210 3300045976 Ga0466967_0780884 Ga0466967_0780884_32_304 90
211 3300045976 Ga0466967_1005303 Ga0466967_1005303_302_574 90
212 3300045976 Ga0466967_1663894 Ga0466967_1663894_20_292 90
213 3300046499 Ga0495594_0234034 Ga0495594_0234034_530_802 90
214 3300046674 Ga0495588_0272951 Ga0495588_0272951_441_713 90
215 3300048914 Ga0496111_0934097 Ga0496111_0934097_324_596 90
216 3300048915 Ga0496112_0634585 Ga0496112_0634585_416_718 90
217 3300049585 Ga0501069_0000856 Ga0501069_0000856_10534_10806 90
218 3300049586 Ga0501070_0043543 Ga0501070_0043543_593_865 90
219 3300049589 Ga0501073_0253965 Ga0501073_0253965_685_957 90
220 3300049652 Ga0501202_217741 Ga0501202_217741_87_362 90
221 3300049656 Ga0501209_251716 Ga0501209_251716_256_534 90
222 3300049742 Ga0501080_0000096 Ga0501080_0000096_52183_52455 90
223 3300049765 Ga0501268_126596 Ga0501268_126596_24_308 90
224 3300049824 Ga0501045_1025408 Ga0501045_1025408_13_291 90
225 3300050507 nmdc:mga05p37_1106987_c1 nmdc:mga05p37_1106987_c1_133_408 90
226 3300050510 nmdc:mga06r32_183496_c1 nmdc:mga06r32_183496_c1_617_892 90
227 3300050510 nmdc:mga06r32_947006_c1 nmdc:mga06r32_947006_c1_157_435 90
228 3300050512 nmdc:mga0n895_356419_c1 nmdc:mga0n895_356419_c1_688_963 90
229 3300050513 nmdc:mga0rr50_73359_c1 nmdc:mga0rr50_73359_c1_2263_2562 90
230 3300050514 nmdc:mga08x19_304512_c1 nmdc:mga08x19_304512_c1_555_854 90
231 3300050515 nmdc:mga0a205_1229675_c1 nmdc:mga0a205_1229675_c1_283_561 90
232 3300050515 nmdc:mga0a205_283833_c1 nmdc:mga0a205_283833_c1_421_720 90
233 3300053131 Ga0500652_142965 Ga0500652_142965_488_766 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

4

80

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8681 3 83
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.839 3 83
2ift-assembly1.cif.gz_A crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102. 0.7422 38 59
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.6923 36 57
2zho-assembly1.cif.gz_B crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form) 0.6797 5 68
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8424 4 83 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8147 1 80 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8141 4 83 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7717 1 80 3.30.70.3090
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7146 2 83 3.30.70.1290
ID Description Score Start End GO Terms
AF-A0A530QG42-F1-model_v4 DUF4242 domain-containing protein 0.9957 1 82
AF-A0A286C6H2-F1-model_v4 DUF4242 domain-containing protein 0.9902 1 80
AF-A0A4V3UYL4-F1-model_v4 DUF4242 domain-containing protein 0.9848 1 85
AF-A0A530QG42-F1-model_v4 DUF4242 domain-containing protein 0.9837 1 82
AF-A0A3D8M4I6-F1-model_v4 DUF4242 domain-containing protein 0.9788 2 88

Feature Viewer

pLDDT pTM Quality
92.58 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map