F345439

General Info

Members Datasets Scaffolds Average Seq Length
232 148 464 182

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0623170|Ga0496100_0623170_56_694
Length 212
Sequence MSVRLDPRAPLVLDTRELGRRPGSERRVTLTAPAPADLGIEVLRVPEDSPVELELRLEAVVEGVLVTGTAQAELAGECVRCLEEIHPRIDAEYCELFVYEGEEAGGSPQSVQAGDTEDGETSRLHGDLLDLEPLLRDAVVLALPFQPLCRDDCPGLCVECGARLADDPGHRHEAPVDPRWSALQVLAGGESAQPEPQHQQDTSGRANGRTEE

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
55 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
77 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2643221604 Nocardioides sp. Root190 Isolate Unclassified
142 2643221620 Nocardioides sp. Root240 Isolate Unclassified
143 2738541305 Nocardioides sp. CF167 Isolate Unclassified
144 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
145 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
146 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
147 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
148 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 68.53
Metatranscriptomes 28.02
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.91
Nodule 0
Rhizoplane 3.88
Rhizosphere 81.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0623170 3300048903 Bacteria 839
2 Ga0006778J45830_1026837 3300003162 Bacteria 905
3 Ga0007417J51691_1042164 3300003544 Bacteria 1617
4 Ga0007409J51694_1033002 3300003575 Bacteria 1801
5 Ga0007416J51690_1028376 3300003577 Bacteria 1276
6 Ga0032354_1017310 3300003693 Bacteria 1909
7 Ga0058863_11631965 3300004799 Bacteria 2024
8 Ga0070683_101466676 3300005329 Bacteria 656
9 Ga0068869_100672447 3300005334 Bacteria 881
10 Ga0070680_100001800 3300005336 Bacteria 15728
11 Ga0070680_100144071 3300005336 Bacteria 1998
12 Ga0070680_100309707 3300005336 Bacteria 1339
13 Ga0070661_100182151 3300005344 Bacteria 1599
14 Ga0070659_100115938 3300005366 Bacteria 2165
15 Ga0070659_100373750 3300005366 Bacteria 1199
16 Ga0070714_100000837 3300005435 Bacteria 21788
17 Ga0070663_100454278 3300005455 Bacteria 1056
18 Ga0070681_10000046 3300005458 Bacteria 84043
19 Ga0070681_10188947 3300005458 Bacteria 1980
20 Ga0070679_100040504 3300005530 Bacteria 4634
21 Ga0070679_100384175 3300005530 Bacteria 1351
22 Ga0070684_100035116 3300005535 Bacteria 4289
23 Ga0081539_10073768 3300005985 Bacteria 1819
24 Ga0075365_10026131 3300006038 Bacteria 3703
25 Ga0075368_10000414 3300006042 Bacteria 12548
26 Ga0075363_100032546 3300006048 Bacteria 2709
27 Ga0075364_10013034 3300006051 Bacteria 5101
28 Ga0075362_10025785 3300006177 Bacteria 2506
29 Ga0075370_10011857 3300006353 Bacteria 4590
30 Ga0075370_10095592 3300006353 Bacteria 1716
31 Ga0105242_11887812 3300009176 Bacteria 637
32 Ga0105237_10136539 3300009545 Bacteria 2447
33 Ga0105239_10205339 3300010375 Bacteria 2208
34 Ga0105239_10732850 3300010375 Bacteria 1131
35 Ga0157373_10263537 3300013100 Bacteria 1220
36 Ga0157370_10462343 3300013104 Bacteria 1166
37 Ga0157370_10501331 3300013104 Bacteria 1115
38 Ga0157369_10706111 3300013105 Bacteria 1038
39 Ga0157372_10489788 3300013307 Bacteria 1434
40 Ga0182008_10168236 3300014497 Bacteria 1106
41 Ga0197907_11487039 3300020069 Bacteria 848
42 Ga0206356_10098261 3300020070 Bacteria 1970
43 Ga0206355_1182000 3300020076 Bacteria 721
44 Ga0206353_10143438 3300020082 Bacteria 1866
45 Ga0206353_10222151 3300020082 Bacteria 2103
46 Ga0224712_10074995 3300022467 Bacteria 1383
47 Ga0207643_10372103 3300025908 Bacteria 900
48 Ga0207707_10000737 3300025912 Bacteria 32379
49 Ga0207660_10000168 3300025917 Bacteria 41428
50 Ga0207660_10156660 3300025917 Bacteria 1754
51 Ga0207652_10000461 3300025921 Bacteria 41921
52 Ga0207652_10130335 3300025921 Bacteria 2243
53 Ga0207664_10093248 3300025929 Bacteria 2473
54 Ga0207706_10047970 3300025933 Bacteria 3777
55 Ga0207678_10581403 3300026067 Bacteria 981
56 Ga0209813_10000714 3300027866 Bacteria 7606
57 Ga0209813_10005913 3300027866 Bacteria 3001
58 Ga0316181_1097465 3300030744 Bacteria 1223
59 Ga0307413_10083189 3300031824 Bacteria 2059
60 Ga0307410_10397851 3300031852 Bacteria 1112
61 Ga0307410_10643835 3300031852 Bacteria 888
62 Ga0307409_100340857 3300031995 Bacteria 1410
63 Ga0307409_100426002 3300031995 Bacteria 1274
64 Ga0307409_100490264 3300031995 Bacteria 1194
65 Ga0307409_101093599 3300031995 Bacteria 818
66 Ga0307415_100976322 3300032126 Bacteria 786
67 Ga0395900_0806513 3300037418 Bacteria 866
68 Ga0395898_0069820 3300037466 Bacteria 3398
69 Ga0395901_0355942 3300038443 Bacteria 1510
70 Ga0439461_0125157 3300041410 Bacteria 646
71 Ga0451793_1502870 3300041452 Bacteria 1039
72 Ga0451853_3294102 3300041512 Bacteria 1644
73 Ga0466972_0011926 3300044658 Bacteria 4367
74 Ga0466972_0026080 3300044658 Bacteria 2895
75 Ga0466965_0009409 3300044683 Bacteria 4542
76 Ga0466965_0016715 3300044683 Bacteria 3497
77 Ga0466965_0017849 3300044683 Bacteria 3394
78 Ga0466965_0288140 3300044683 Bacteria 888
79 Ga0466961_0070032 3300044693 Bacteria 2226
80 Ga0466963_0118352 3300044694 Bacteria 1822
81 Ga0466963_0317867 3300044694 Bacteria 1095
82 Ga0466964_0030445 3300044706 Bacteria 2136
83 Ga0466971_0011578 3300044719 Bacteria 3862
84 Ga0466970_0010523 3300044765 Bacteria 4698
85 Ga0466970_0399314 3300044765 Bacteria 784
86 Ga0466957_0010592 3300044842 Bacteria 5299
87 Ga0466957_0077498 3300044842 Bacteria 2065
88 Ga0466960_0001334 3300044901 Bacteria 8970
89 Ga0466960_0012746 3300044901 Bacteria 3556
90 Ga0466960_0028328 3300044901 Bacteria 2562
91 Ga0466960_0322235 3300044901 Bacteria 875
92 Ga0466958_0510488 3300045836 Bacteria 780
93 Ga0466967_0036748 3300045976 Bacteria 4184
94 Ga0466967_0050386 3300045976 Bacteria 3646
95 Ga0466967_0057108 3300045976 Bacteria 3444
96 Ga0466967_0318125 3300045976 Bacteria 1500
97 Ga0466967_0698725 3300045976 Bacteria 1004
98 Ga0495629_0510026 3300046459 Bacteria 810
99 Ga0495664_0007125 3300046477 Bacteria 6198
100 Ga0495658_0161371 3300046683 Bacteria 1383
101 Ga0496101_0497083 3300048904 Bacteria 963
102 Ga0496102_0181522 3300048905 Bacteria 1983
103 Ga0496102_0854722 3300048905 Bacteria 832
104 Ga0496109_0239787 3300048912 Bacteria 1706
105 Ga0496109_1008830 3300048912 Bacteria 770
106 Ga0496110_0596504 3300048913 Bacteria 1002
107 Ga0496115_0262145 3300048918 Bacteria 1421
108 Ga0496119_0050296 3300048922 Bacteria 2570
109 Ga0501306_053905 3300049127 Bacteria 650
110 Ga0501306_078606 3300049127 Bacteria 566
111 Ga0501308_025002 3300049128 Bacteria 771
112 Ga0501308_037918 3300049128 Bacteria 670
113 Ga0501309_040047 3300049129 Bacteria 714
114 Ga0501309_048528 3300049129 Bacteria 663
115 Ga0501309_056263 3300049129 Bacteria 626
116 Ga0501310_006593 3300049130 Bacteria 1222
117 Ga0501310_033096 3300049130 Bacteria 694
118 Ga0501341_09568 3300049131 Bacteria 630
119 Ga0501304_015043 3300049160 Bacteria 721
120 Ga0501307_037612 3300049162 Bacteria 693
121 Ga0501307_038491 3300049162 Bacteria 687
122 Ga0501307_051769 3300049162 Bacteria 619
123 Ga0501311_012250 3300049527 Bacteria 1067
124 Ga0501311_019965 3300049527 Bacteria 903
125 Ga0501311_038220 3300049527 Bacteria 720
126 Ga0501312_005674 3300049528 Bacteria 1528
127 Ga0501312_064016 3300049528 Bacteria 641
128 Ga0501313_013978 3300049529 Bacteria 947
129 Ga0501313_037052 3300049529 Bacteria 647
130 Ga0501314_038103 3300049530 Bacteria 554
131 Ga0501315_031540 3300049531 Bacteria 766
132 Ga0501315_039302 3300049531 Bacteria 711
133 Ga0501315_055798 3300049531 Bacteria 630
134 Ga0501315_066468 3300049531 Bacteria 591
135 Ga0501316_007590 3300049532 Bacteria 1182
136 Ga0501316_038384 3300049532 Bacteria 661
137 Ga0501316_041861 3300049532 Bacteria 641
138 Ga0501317_006394 3300049533 Bacteria 1295
139 Ga0501317_015751 3300049533 Bacteria 973
140 Ga0501317_030564 3300049533 Bacteria 779
141 Ga0501317_044155 3300049533 Bacteria 690
142 Ga0501317_051035 3300049533 Bacteria 657
143 Ga0501318_030542 3300049534 Bacteria 731
144 Ga0501318_036039 3300049534 Bacteria 691
145 Ga0501318_047989 3300049534 Bacteria 628
146 Ga0501319_018162 3300049535 Bacteria 614
147 Ga0501320_041870 3300049536 Bacteria 602
148 Ga0501321_035351 3300049537 Bacteria 684
149 Ga0501321_035867 3300049537 Bacteria 681
150 Ga0501322_016272 3300049538 Bacteria 621
151 Ga0501325_005528 3300049541 Bacteria 1007
152 Ga0501325_023052 3300049541 Bacteria 669
153 Ga0501333_011874 3300049549 Bacteria 633
154 Ga0501031_0050263 3300049568 Bacteria 2716
155 Ga0501031_0122582 3300049568 Bacteria 1698
156 Ga0501031_0304620 3300049568 Bacteria 1033
157 Ga0501031_0324925 3300049568 Bacteria 996
158 Ga0501032_0313739 3300049569 Bacteria 1013
159 Ga0501036_0210003 3300049572 Bacteria 1636
160 Ga0501036_0738313 3300049572 Bacteria 812
161 Ga0501037_0297356 3300049573 Bacteria 1122
162 Ga0501038_0370987 3300049574 Bacteria 1112
163 Ga0501039_0355673 3300049575 Bacteria 1151
164 Ga0501040_0059243 3300049576 Bacteria 2631
165 Ga0501040_0200616 3300049576 Bacteria 1416
166 Ga0501040_0764209 3300049576 Bacteria 699
167 Ga0501041_0124142 3300049577 Bacteria 1606
168 Ga0501041_0177057 3300049577 Bacteria 1335
169 Ga0501041_0539604 3300049577 Bacteria 743
170 Ga0501042_0081023 3300049578 Bacteria 2326
171 Ga0501042_0128754 3300049578 Bacteria 1824
172 Ga0501042_0297471 3300049578 Bacteria 1166
173 Ga0501042_0570333 3300049578 Bacteria 823
174 Ga0501043_0555151 3300049579 Bacteria 853
175 Ga0501048_0495762 3300049582 Bacteria 876
176 Ga0501068_0396026 3300049584 Bacteria 890
177 Ga0501068_0765025 3300049584 Bacteria 633
178 Ga0501070_0176197 3300049586 Bacteria 1760
179 Ga0501070_0206397 3300049586 Bacteria 1613
180 Ga0501070_0750766 3300049586 Bacteria 769
181 Ga0501071_0068530 3300049587 Bacteria 2582
182 Ga0501071_0249402 3300049587 Bacteria 1340
183 Ga0501074_0089622 3300049590 Bacteria 2203
184 Ga0501075_0196312 3300049591 Bacteria 1539
185 Ga0501075_0349927 3300049591 Bacteria 1126
186 Ga0501075_0733396 3300049591 Bacteria 752
187 Ga0501076_0120364 3300049592 Bacteria 2126
188 Ga0501076_0400505 3300049592 Bacteria 1129
189 Ga0501076_0426969 3300049592 Bacteria 1091
190 Ga0501077_0490316 3300049593 Bacteria 788
191 Ga0501081_0989847 3300049743 Bacteria 635
192 Ga0501044_0803745 3300049823 Bacteria 820
193 Ga0501044_1035640 3300049823 Bacteria 692
194 Ga0501045_0226489 3300049824 Bacteria 1392
195 Ga0501045_0668871 3300049824 Bacteria 767
196 nmdc:mga03683_9801_c1 3300050489 Bacteria 3418
197 nmdc:mga03n38_239216_c1 3300050490 Bacteria 955
198 nmdc:mga03n38_36210_c1 3300050490 Bacteria 2120
199 nmdc:mga03n38_495701_c1 3300050490 Bacteria 685
200 nmdc:mga00v17_159024_c1 3300050491 Bacteria 1454
201 nmdc:mga00v17_266064_c1 3300050491 Bacteria 1113
202 nmdc:mga0yw44_19090_c1 3300050492 Bacteria 3773
203 nmdc:mga06z11_40278_c1 3300050494 Bacteria 2331
204 nmdc:mga04h51_2152_c1 3300050495 Bacteria 4614
205 nmdc:mga04h51_25868_c1 3300050495 Bacteria 1575
206 nmdc:mga07m45_10931_c1 3300050496 Bacteria 3054
207 nmdc:mga07m45_6517_c2 3300050496 Bacteria 4894
208 nmdc:mga0sz30_187695_c1 3300050516 Bacteria 918
209 Ga0495601_0006433 3300053077 Bacteria 6871
210 Ga0500620_006058 3300053155 Bacteria 2860
211 Ga0501084_0072370 3300054114 Bacteria 2887
212 Ga0501084_0596468 3300054114 Bacteria 933
213 Ga0587066_042292 3300059490 Bacteria 864
214 Ga0587106_013574 3300059605 Bacteria 1110
215 Ga0587101_070542 3300059623 Bacteria 643
216 Ga0587115_030867 3300059626 Bacteria 796
217 Ga0587122_018427 3300059628 Bacteria 739
218 Ga0587068_076340 3300059641 Bacteria 670
219 Ga0587075_034940 3300059644 Bacteria 818
220 Ga0587071_143105 3300060344 Bacteria 589
221 Ga0501082_1209748 3300060353 Bacteria 660
222 Ga0501082_1287940 3300060353 Bacteria 638
223 Ga0466962_0128229 3300061719 Bacteria 1225
224 Ga0530510_0052273 3300061734 Bacteria 2953
225 2644034111 2643221604 Bacteria 5014917
226 2644118177 2643221620 Bacteria 5134593
227 2738871318 2738541305 Bacteria 4910150
228 2774393635 2773857762 Bacteria 5971770
229 2809195482 2808606439 Bacteria 5952208
230 2812333826 2811994874 Bacteria 5367947
231 2812350365 2811994878 Bacteria 5992952
232 2891972018 2891968417 Bacteria 5821697
233 Ga0496100_0623170
234 Ga0006778J45830_1026837
235 Ga0007417J51691_1042164
236 Ga0007409J51694_1033002
237 Ga0007416J51690_1028376
238 Ga0032354_1017310
239 Ga0058863_11631965
240 Ga0070683_101466676
241 Ga0068869_100672447
242 Ga0070680_100001800
243 Ga0070680_100144071
244 Ga0070680_100309707
245 Ga0070661_100182151
246 Ga0070659_100115938
247 Ga0070659_100373750
248 Ga0070714_100000837
249 Ga0070663_100454278
250 Ga0070681_10000046
251 Ga0070681_10188947
252 Ga0070679_100040504
253 Ga0070679_100384175
254 Ga0070684_100035116
255 Ga0081539_10073768
256 Ga0075365_10026131
257 Ga0075368_10000414
258 Ga0075363_100032546
259 Ga0075364_10013034
260 Ga0075362_10025785
261 Ga0075370_10011857
262 Ga0075370_10095592
263 Ga0105242_11887812
264 Ga0105237_10136539
265 Ga0105239_10205339
266 Ga0105239_10732850
267 Ga0157373_10263537
268 Ga0157370_10462343
269 Ga0157370_10501331
270 Ga0157369_10706111
271 Ga0157372_10489788
272 Ga0182008_10168236
273 Ga0197907_11487039
274 Ga0206356_10098261
275 Ga0206355_1182000
276 Ga0206353_10143438
277 Ga0206353_10222151
278 Ga0224712_10074995
279 Ga0207643_10372103
280 Ga0207707_10000737
281 Ga0207660_10000168
282 Ga0207660_10156660
283 Ga0207652_10000461
284 Ga0207652_10130335
285 Ga0207664_10093248
286 Ga0207706_10047970
287 Ga0207678_10581403
288 Ga0209813_10000714
289 Ga0209813_10005913
290 Ga0316181_1097465
291 Ga0307413_10083189
292 Ga0307410_10397851
293 Ga0307410_10643835
294 Ga0307409_100340857
295 Ga0307409_100426002
296 Ga0307409_100490264
297 Ga0307409_101093599
298 Ga0307415_100976322
299 Ga0395900_0806513
300 Ga0395898_0069820
301 Ga0395901_0355942
302 Ga0439461_0125157
303 Ga0451793_1502870
304 Ga0451853_3294102
305 Ga0466972_0011926
306 Ga0466972_0026080
307 Ga0466965_0009409
308 Ga0466965_0016715
309 Ga0466965_0017849
310 Ga0466965_0288140
311 Ga0466961_0070032
312 Ga0466963_0118352
313 Ga0466963_0317867
314 Ga0466964_0030445
315 Ga0466971_0011578
316 Ga0466970_0010523
317 Ga0466970_0399314
318 Ga0466957_0010592
319 Ga0466957_0077498
320 Ga0466960_0001334
321 Ga0466960_0012746
322 Ga0466960_0028328
323 Ga0466960_0322235
324 Ga0466958_0510488
325 Ga0466967_0036748
326 Ga0466967_0050386
327 Ga0466967_0057108
328 Ga0466967_0318125
329 Ga0466967_0698725
330 Ga0495629_0510026
331 Ga0495664_0007125
332 Ga0495658_0161371
333 Ga0496101_0497083
334 Ga0496102_0181522
335 Ga0496102_0854722
336 Ga0496109_0239787
337 Ga0496109_1008830
338 Ga0496110_0596504
339 Ga0496115_0262145
340 Ga0496119_0050296
341 Ga0501306_053905
342 Ga0501306_078606
343 Ga0501308_025002
344 Ga0501308_037918
345 Ga0501309_040047
346 Ga0501309_048528
347 Ga0501309_056263
348 Ga0501310_006593
349 Ga0501310_033096
350 Ga0501341_09568
351 Ga0501304_015043
352 Ga0501307_037612
353 Ga0501307_038491
354 Ga0501307_051769
355 Ga0501311_012250
356 Ga0501311_019965
357 Ga0501311_038220
358 Ga0501312_005674
359 Ga0501312_064016
360 Ga0501313_013978
361 Ga0501313_037052
362 Ga0501314_038103
363 Ga0501315_031540
364 Ga0501315_039302
365 Ga0501315_055798
366 Ga0501315_066468
367 Ga0501316_007590
368 Ga0501316_038384
369 Ga0501316_041861
370 Ga0501317_006394
371 Ga0501317_015751
372 Ga0501317_030564
373 Ga0501317_044155
374 Ga0501317_051035
375 Ga0501318_030542
376 Ga0501318_036039
377 Ga0501318_047989
378 Ga0501319_018162
379 Ga0501320_041870
380 Ga0501321_035351
381 Ga0501321_035867
382 Ga0501322_016272
383 Ga0501325_005528
384 Ga0501325_023052
385 Ga0501333_011874
386 Ga0501031_0050263
387 Ga0501031_0122582
388 Ga0501031_0304620
389 Ga0501031_0324925
390 Ga0501032_0313739
391 Ga0501036_0210003
392 Ga0501036_0738313
393 Ga0501037_0297356
394 Ga0501038_0370987
395 Ga0501039_0355673
396 Ga0501040_0059243
397 Ga0501040_0200616
398 Ga0501040_0764209
399 Ga0501041_0124142
400 Ga0501041_0177057
401 Ga0501041_0539604
402 Ga0501042_0081023
403 Ga0501042_0128754
404 Ga0501042_0297471
405 Ga0501042_0570333
406 Ga0501043_0555151
407 Ga0501048_0495762
408 Ga0501068_0396026
409 Ga0501068_0765025
410 Ga0501070_0176197
411 Ga0501070_0206397
412 Ga0501070_0750766
413 Ga0501071_0068530
414 Ga0501071_0249402
415 Ga0501074_0089622
416 Ga0501075_0196312
417 Ga0501075_0349927
418 Ga0501075_0733396
419 Ga0501076_0120364
420 Ga0501076_0400505
421 Ga0501076_0426969
422 Ga0501077_0490316
423 Ga0501081_0989847
424 Ga0501044_0803745
425 Ga0501044_1035640
426 Ga0501045_0226489
427 Ga0501045_0668871
428 nmdc:mga03683_9801_c1
429 nmdc:mga03n38_239216_c1
430 nmdc:mga03n38_36210_c1
431 nmdc:mga03n38_495701_c1
432 nmdc:mga00v17_159024_c1
433 nmdc:mga00v17_266064_c1
434 nmdc:mga0yw44_19090_c1
435 nmdc:mga06z11_40278_c1
436 nmdc:mga04h51_2152_c1
437 nmdc:mga04h51_25868_c1
438 nmdc:mga07m45_10931_c1
439 nmdc:mga07m45_6517_c2
440 nmdc:mga0sz30_187695_c1
441 Ga0495601_0006433
442 Ga0500620_006058
443 Ga0501084_0072370
444 Ga0501084_0596468
445 Ga0587066_042292
446 Ga0587106_013574
447 Ga0587101_070542
448 Ga0587115_030867
449 Ga0587122_018427
450 Ga0587068_076340
451 Ga0587075_034940
452 Ga0587071_143105
453 Ga0501082_1209748
454 Ga0501082_1287940
455 Ga0466962_0128229
456 Ga0530510_0052273
457 2644034111
458 2644118177
459 2738871318
460 2774393635
461 2809195482
462 2812333826
463 2812350365
464 2891972018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

66

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5adx-assembly1.cif.gz_K cryoem structure of dynactin complex at 4.0 angstrom resolution 0.5806 21 96
5fp2-assembly1.cif.gz_A crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.4803 20 92
4akr-assembly1.cif.gz_A crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum 0.463 23 92
4aiq-assembly1.cif.gz_A the frpb iron transporter from neisseria meningitidis (f5-1 variant) 0.4626 47 126
4b7o-assembly1.cif.gz_A the frpb iron transporter from neisseria meningitidis (f5-1 variant) apoprotein form 0.4616 47 126
ID Description Score Start End Superfamily
4aiqA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.659 47 92 2.40.170.20
af_A4IDS8_71_212_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5747 42 96 3.10.450.50
af_P13517_96_287_3.90.1150.210 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit 0.5658 23 96 3.90.1150.210
2ra5A01 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.5429 19 68 3.40.1410.10
af_A0A1D6LPQ2_728_879_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.4829 23 68 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A519FZS4-F1-model_v4 DUF177 domain-containing protein 0.9669 2 95
AF-A0A520ENT6-F1-model_v4 DUF177 domain-containing protein 0.9631 11 140
AF-A0A2W4J8X0-F1-model_v4 DNA-binding protein 0.9627 2 130 GO:0003677
AF-A0A3B9W555-F1-model_v4 DNA-binding protein 0.9596 10 146 GO:0003677
AF-A0A6G3VP78-F1-model_v4 deleted 0.957 10 155

Map