F345297
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 53 | 464 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_216953|Ga0400483_216953_5231_5971 |
| Length | 246 |
| Sequence | VESLWDALADYLFGFCMREFGMIKKPEMILIDVDGTLVDSVPDLAYCVDEMMKQLGRPVHGEEKVRDWVGNGVERLVRRALIGQLNGEPDETEFDKAYPIFLELYAENTSQRSVLYPGVREGLDYLKGQGYRLGCVTNKAAQFTLPLLKDLGVHDDFEIIIAGDTLPNKKPDPLPLLHAAENLGVDPSAALMVGDSQSDVKAARAASFQIVCMSYGYNHGEDIRNYNPDAVIDSLTEIQEILENAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 2 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 3 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 4 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 5 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 6 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 7 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 8 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 9 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 10 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 11 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 18 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 19 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 20 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 21 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 22 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 23 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 24 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 25 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 26 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 27 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 28 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 29 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 30 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 31 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 32 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 33 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 34 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 35 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 36 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 37 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 38 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 39 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 40 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 41 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 42 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 43 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 44 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 45 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 46 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 47 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 48 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 49 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 50 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 51 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 52 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 53 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.6 |
| Metatranscriptomes | 19.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 82.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400483_216953 | 3300039062 | Bacteria | 8439 |
| 2 | Ga0207674_10077496 | 3300026116 | Bacteria | 3329 |
| 3 | Ga0316575_10000075 | 3300031665 | Bacteria | 24312 |
| 4 | Ga0316575_10000487 | 3300031665 | Bacteria | 11510 |
| 5 | Ga0316575_10008164 | 3300031665 | Bacteria | 3806 |
| 6 | Ga0316579_10000112 | 3300031691 | Bacteria | 21688 |
| 7 | Ga0316579_10000762 | 3300031691 | Bacteria | 11025 |
| 8 | Ga0316579_10000799 | 3300031691 | Bacteria | 10848 |
| 9 | Ga0316579_10002543 | 3300031691 | Bacteria | 6896 |
| 10 | Ga0316579_10013311 | 3300031691 | Bacteria | 3536 |
| 11 | Ga0316579_10015975 | 3300031691 | Bacteria | 3269 |
| 12 | Ga0316579_10033968 | 3300031691 | Bacteria | 2344 |
| 13 | Ga0316579_10118354 | 3300031691 | Bacteria | 1272 |
| 14 | Ga0316579_10187276 | 3300031691 | Bacteria | 1000 |
| 15 | Ga0316576_10000521 | 3300031727 | Bacteria | 18030 |
| 16 | Ga0316576_10000941 | 3300031727 | Bacteria | 14878 |
| 17 | Ga0316576_10008009 | 3300031727 | Bacteria | 6699 |
| 18 | Ga0316576_10008752 | 3300031727 | Bacteria | 6484 |
| 19 | Ga0316576_10062232 | 3300031727 | Bacteria | 2736 |
| 20 | Ga0316576_10198064 | 3300031727 | Bacteria | 1513 |
| 21 | Ga0316576_10498973 | 3300031727 | Bacteria | 895 |
| 22 | Ga0316578_10000036 | 3300031728 | Bacteria | 27635 |
| 23 | Ga0316578_10000232 | 3300031728 | Bacteria | 16402 |
| 24 | Ga0316578_10000708 | 3300031728 | Bacteria | 12056 |
| 25 | Ga0316578_10002132 | 3300031728 | Bacteria | 8507 |
| 26 | Ga0316578_10009548 | 3300031728 | Bacteria | 4991 |
| 27 | Ga0316578_10011500 | 3300031728 | Bacteria | 4635 |
| 28 | Ga0316578_10013848 | 3300031728 | Bacteria | 4287 |
| 29 | Ga0316578_10018208 | 3300031728 | Bacteria | 3843 |
| 30 | Ga0316578_10031097 | 3300031728 | Bacteria | 3039 |
| 31 | Ga0316578_10038370 | 3300031728 | Bacteria | 2762 |
| 32 | Ga0316578_10051140 | 3300031728 | Bacteria | 2419 |
| 33 | Ga0316578_10075773 | 3300031728 | Bacteria | 1996 |
| 34 | Ga0316577_10000097 | 3300031733 | Bacteria | 24000 |
| 35 | Ga0316577_10014855 | 3300031733 | Bacteria | 4280 |
| 36 | Ga0316577_10024593 | 3300031733 | Bacteria | 3348 |
| 37 | Ga0316577_10030751 | 3300031733 | Bacteria | 2997 |
| 38 | Ga0316577_10064679 | 3300031733 | Bacteria | 2041 |
| 39 | Ga0316577_10067836 | 3300031733 | Bacteria | 1991 |
| 40 | Ga0316577_10097023 | 3300031733 | Bacteria | 1651 |
| 41 | Ga0316577_10102249 | 3300031733 | Bacteria | 1606 |
| 42 | Ga0316577_10275787 | 3300031733 | Bacteria | 952 |
| 43 | Ga0316577_10436383 | 3300031733 | Bacteria | 744 |
| 44 | Ga0316583_10005061 | 3300032133 | Bacteria | 4719 |
| 45 | Ga0316583_10011643 | 3300032133 | Bacteria | 3172 |
| 46 | Ga0316583_10021124 | 3300032133 | Bacteria | 2334 |
| 47 | Ga0316583_10035883 | 3300032133 | Bacteria | 1760 |
| 48 | Ga0316583_10054450 | 3300032133 | Bacteria | 1407 |
| 49 | Ga0316585_10000137 | 3300032137 | Bacteria | 14253 |
| 50 | Ga0316585_10002326 | 3300032137 | Bacteria | 5112 |
| 51 | Ga0316585_10014175 | 3300032137 | Bacteria | 2380 |
| 52 | Ga0316585_10043913 | 3300032137 | Bacteria | 1427 |
| 53 | Ga0316585_10051468 | 3300032137 | Bacteria | 1323 |
| 54 | Ga0316580_10000114 | 3300032139 | Bacteria | 15009 |
| 55 | Ga0316580_10008584 | 3300032139 | Bacteria | 3062 |
| 56 | Ga0316580_10015299 | 3300032139 | Bacteria | 2346 |
| 57 | Ga0316580_10016175 | 3300032139 | Bacteria | 2286 |
| 58 | Ga0316580_10029771 | 3300032139 | Bacteria | 1690 |
| 59 | Ga0316593_10000230 | 3300032168 | Bacteria | 8970 |
| 60 | Ga0316593_10001260 | 3300032168 | Bacteria | 5481 |
| 61 | Ga0316593_10002399 | 3300032168 | Bacteria | 4427 |
| 62 | Ga0316593_10004392 | 3300032168 | Bacteria | 3615 |
| 63 | Ga0316593_10005984 | 3300032168 | Bacteria | 3253 |
| 64 | Ga0316593_10007796 | 3300032168 | Bacteria | 2956 |
| 65 | Ga0316593_10010640 | 3300032168 | Bacteria | 2646 |
| 66 | Ga0316593_10013730 | 3300032168 | Bacteria | 2405 |
| 67 | Ga0316593_10014909 | 3300032168 | Bacteria | 2328 |
| 68 | Ga0316593_10019723 | 3300032168 | Bacteria | 2087 |
| 69 | Ga0316593_10022133 | 3300032168 | Bacteria | 1994 |
| 70 | Ga0316593_10023213 | 3300032168 | Bacteria | 1956 |
| 71 | Ga0316593_10030035 | 3300032168 | Bacteria | 1762 |
| 72 | Ga0316593_10042329 | 3300032168 | Bacteria | 1519 |
| 73 | Ga0316593_10049514 | 3300032168 | Bacteria | 1416 |
| 74 | Ga0316593_10050664 | 3300032168 | Bacteria | 1402 |
| 75 | Ga0316593_10073519 | 3300032168 | Bacteria | 1185 |
| 76 | Ga0316593_10075740 | 3300032168 | Bacteria | 1169 |
| 77 | Ga0316593_10117027 | 3300032168 | Unclassified | 955 |
| 78 | Ga0316592_1000541 | 3300033524 | Bacteria | 5358 |
| 79 | Ga0316592_1003259 | 3300033524 | Bacteria | 2903 |
| 80 | Ga0316592_1004940 | 3300033524 | Bacteria | 2510 |
| 81 | Ga0316592_1005082 | 3300033524 | Bacteria | 2481 |
| 82 | Ga0316592_1016095 | 3300033524 | Bacteria | 1561 |
| 83 | Ga0316592_1016976 | 3300033524 | Bacteria | 1525 |
| 84 | Ga0316586_1006674 | 3300033527 | Bacteria | 1662 |
| 85 | Ga0316586_1007598 | 3300033527 | Bacteria | 1585 |
| 86 | Ga0316588_1000713 | 3300033528 | Bacteria | 4882 |
| 87 | Ga0316588_1001009 | 3300033528 | Bacteria | 4394 |
| 88 | Ga0316588_1008449 | 3300033528 | Bacteria | 2120 |
| 89 | Ga0316588_1022797 | 3300033528 | Bacteria | 1433 |
| 90 | Ga0316587_1001605 | 3300033529 | Bacteria | 2843 |
| 91 | Ga0316587_1003970 | 3300033529 | Bacteria | 2116 |
| 92 | Ga0316587_1004172 | 3300033529 | Bacteria | 2085 |
| 93 | Ga0316587_1004525 | 3300033529 | Bacteria | 2028 |
| 94 | Ga0316587_1015542 | 3300033529 | Bacteria | 1263 |
| 95 | Ga0316596_1000141 | 3300033541 | Bacteria | 9849 |
| 96 | Ga0316596_1001863 | 3300033541 | Bacteria | 4397 |
| 97 | Ga0316596_1005378 | 3300033541 | Bacteria | 2923 |
| 98 | Ga0316596_1006089 | 3300033541 | Bacteria | 2790 |
| 99 | Ga0316596_1008911 | 3300033541 | Bacteria | 2400 |
| 100 | Ga0316596_1009383 | 3300033541 | Bacteria | 2347 |
| 101 | Ga0316596_1013424 | 3300033541 | Bacteria | 2023 |
| 102 | Ga0316596_1014921 | 3300033541 | Bacteria | 1932 |
| 103 | Ga0316596_1022149 | 3300033541 | Bacteria | 1623 |
| 104 | Ga0316574_0003574 | 3300035398 | Bacteria | 8036 |
| 105 | Ga0316574_0003652 | 3300035398 | Bacteria | 7964 |
| 106 | Ga0316574_0007807 | 3300035398 | Bacteria | 5896 |
| 107 | Ga0316574_0012415 | 3300035398 | Bacteria | 4873 |
| 108 | Ga0316574_0051118 | 3300035398 | Bacteria | 2575 |
| 109 | Ga0316574_0076933 | 3300035398 | Bacteria | 2114 |
| 110 | Ga0316574_0079578 | 3300035398 | Bacteria | 2079 |
| 111 | Ga0316574_0098146 | 3300035398 | Bacteria | 1873 |
| 112 | Ga0316574_0112234 | 3300035398 | Bacteria | 1748 |
| 113 | Ga0316574_0113227 | 3300035398 | Bacteria | 1739 |
| 114 | Ga0316574_0122388 | 3300035398 | Bacteria | 1671 |
| 115 | Ga0316574_0130692 | 3300035398 | Bacteria | 1616 |
| 116 | Ga0316574_0193761 | 3300035398 | Bacteria | 1306 |
| 117 | Ga0316574_0381276 | 3300035398 | Bacteria | 889 |
| 118 | Ga0316582_0000029 | 3300036647 | Bacteria | 34187 |
| 119 | Ga0316582_0002572 | 3300036647 | Bacteria | 8594 |
| 120 | Ga0316582_0008202 | 3300036647 | Bacteria | 5603 |
| 121 | Ga0316582_0012942 | 3300036647 | Bacteria | 4678 |
| 122 | Ga0316582_0016488 | 3300036647 | Bacteria | 4249 |
| 123 | Ga0316582_0021577 | 3300036647 | Bacteria | 3809 |
| 124 | Ga0316582_0021646 | 3300036647 | Bacteria | 3804 |
| 125 | Ga0316582_0025077 | 3300036647 | Bacteria | 3575 |
| 126 | Ga0316582_0038586 | 3300036647 | Bacteria | 2969 |
| 127 | Ga0316582_0051956 | 3300036647 | Bacteria | 2603 |
| 128 | Ga0316582_0052493 | 3300036647 | Bacteria | 2591 |
| 129 | Ga0316582_0065292 | 3300036647 | Bacteria | 2343 |
| 130 | Ga0316582_0072619 | 3300036647 | Bacteria | 2231 |
| 131 | Ga0316582_0131469 | 3300036647 | Bacteria | 1681 |
| 132 | Ga0316582_0475299 | 3300036647 | Bacteria | 861 |
| 133 | Ga0316582_0531025 | 3300036647 | Bacteria | 811 |
| 134 | Ga0316584_0001251 | 3300036712 | Bacteria | 15016 |
| 135 | Ga0316584_0003738 | 3300036712 | Bacteria | 9965 |
| 136 | Ga0316584_0004310 | 3300036712 | Bacteria | 9407 |
| 137 | Ga0316584_0008448 | 3300036712 | Bacteria | 7097 |
| 138 | Ga0316584_0011038 | 3300036712 | Bacteria | 6331 |
| 139 | Ga0316584_0014049 | 3300036712 | Bacteria | 5686 |
| 140 | Ga0316584_0018078 | 3300036712 | Bacteria | 5082 |
| 141 | Ga0316584_0018669 | 3300036712 | Bacteria | 5005 |
| 142 | Ga0316584_0022357 | 3300036712 | Bacteria | 4611 |
| 143 | Ga0316584_0029539 | 3300036712 | Bacteria | 4046 |
| 144 | Ga0316584_0033032 | 3300036712 | Bacteria | 3831 |
| 145 | Ga0316584_0033074 | 3300036712 | Bacteria | 3828 |
| 146 | Ga0316584_0042892 | 3300036712 | Bacteria | 3372 |
| 147 | Ga0316584_0048085 | 3300036712 | Bacteria | 3187 |
| 148 | Ga0316584_0082358 | 3300036712 | Bacteria | 2410 |
| 149 | Ga0316584_0093255 | 3300036712 | Bacteria | 2254 |
| 150 | Ga0316584_0114206 | 3300036712 | Bacteria | 2020 |
| 151 | Ga0316584_0134680 | 3300036712 | Bacteria | 1845 |
| 152 | Ga0316584_0143839 | 3300036712 | Bacteria | 1777 |
| 153 | Ga0316584_0146852 | 3300036712 | Bacteria | 1757 |
| 154 | Ga0316584_0195019 | 3300036712 | Bacteria | 1496 |
| 155 | Ga0316584_0209294 | 3300036712 | Bacteria | 1436 |
| 156 | Ga0316584_0264388 | 3300036712 | Bacteria | 1254 |
| 157 | Ga0316581_0001690 | 3300037588 | Bacteria | 5066 |
| 158 | Ga0316581_0010560 | 3300037588 | Bacteria | 2564 |
| 159 | Ga0316581_0010769 | 3300037588 | Bacteria | 2543 |
| 160 | Ga0316581_0032586 | 3300037588 | Bacteria | 1572 |
| 161 | Ga0400484_03423 | 3300038725 | Bacteria | 7007 |
| 162 | Ga0400484_06989 | 3300038725 | Bacteria | 26353 |
| 163 | Ga0400484_22869 | 3300038725 | Bacteria | 1308 |
| 164 | Ga0400484_33172 | 3300038725 | Bacteria | 13183 |
| 165 | Ga0400490_41479 | 3300038726 | Bacteria | 36091 |
| 166 | Ga0400490_41641 | 3300038726 | Bacteria | 18538 |
| 167 | Ga0400490_51925 | 3300038726 | Bacteria | 1209 |
| 168 | Ga0400490_52136 | 3300038726 | Bacteria | 70831 |
| 169 | Ga0400490_54255 | 3300038726 | Bacteria | 6184 |
| 170 | Ga0400491_14470 | 3300038727 | Bacteria | 1513 |
| 171 | Ga0400491_25622 | 3300038727 | Bacteria | 3066 |
| 172 | Ga0400485_17163 | 3300038735 | Bacteria | 43508 |
| 173 | Ga0400485_17222 | 3300038735 | Bacteria | 8009 |
| 174 | Ga0400488_03755 | 3300038741 | Bacteria | 3022 |
| 175 | Ga0400488_31193 | 3300038741 | Bacteria | 1635 |
| 176 | Ga0400488_43853 | 3300038741 | Bacteria | 10190 |
| 177 | Ga0400488_50200 | 3300038741 | Bacteria | 9554 |
| 178 | Ga0400488_50703 | 3300038741 | Bacteria | 4850 |
| 179 | Ga0400486_01662 | 3300038742 | Bacteria | 43450 |
| 180 | Ga0400486_07086 | 3300038742 | Bacteria | 2350 |
| 181 | Ga0400486_08898 | 3300038742 | Bacteria | 6821 |
| 182 | Ga0400486_18154 | 3300038742 | Bacteria | 9419 |
| 183 | Ga0400483_007858 | 3300039062 | Bacteria | 4232 |
| 184 | Ga0400483_012122 | 3300039062 | Bacteria | 5059 |
| 185 | Ga0400483_072362 | 3300039062 | Bacteria | 16811 |
| 186 | Ga0400483_119064 | 3300039062 | Bacteria | 13617 |
| 187 | Ga0400483_147588 | 3300039062 | Bacteria | 1450 |
| 188 | Ga0400483_206793 | 3300039062 | Bacteria | 4733 |
| 189 | Ga0400483_208106 | 3300039062 | Bacteria | 26334 |
| 190 | Ga0400483_244214 | 3300039062 | Bacteria | 1936 |
| 191 | Ga0400489_09946 | 3300039093 | Bacteria | 2569 |
| 192 | Ga0400487_04649 | 3300039110 | Bacteria | 2973 |
| 193 | Ga0400487_10072 | 3300039110 | Bacteria | 12506 |
| 194 | Ga0400487_17601 | 3300039110 | Bacteria | 48398 |
| 195 | Ga0400487_27950 | 3300039110 | Bacteria | 76746 |
| 196 | Ga0400487_47308 | 3300039110 | Bacteria | 1082 |
| 197 | Ga0400487_52635 | 3300039110 | Bacteria | 6520 |
| 198 | Ga0400487_62547 | 3300039110 | Bacteria | 3194 |
| 199 | Ga0400487_64684 | 3300039110 | Bacteria | 2720 |
| 200 | Ga0451577_0000104 | 3300042876 | Bacteria | 186417 |
| 201 | Ga0451577_0191022 | 3300042876 | Bacteria | 1847 |
| 202 | Ga0466966_0026201 | 3300044684 | Bacteria | 3808 |
| 203 | Ga0466963_0102636 | 3300044694 | Bacteria | 1958 |
| 204 | Ga0453684_0000364 | 3300044712 | Bacteria | 186418 |
| 205 | Ga0453684_0015773 | 3300044712 | Bacteria | 11890 |
| 206 | Ga0466971_0020402 | 3300044719 | Bacteria | 2947 |
| 207 | Ga0501033_0122598 | 3300049570 | Bacteria | 1885 |
| 208 | Ga0501034_0161373 | 3300049571 | Bacteria | 2212 |
| 209 | Ga0501036_0045591 | 3300049572 | Bacteria | 3714 |
| 210 | Ga0501037_0003604 | 3300049573 | Bacteria | 11229 |
| 211 | Ga0501037_0005270 | 3300049573 | Bacteria | 9408 |
| 212 | Ga0501037_0024124 | 3300049573 | Bacteria | 4497 |
| 213 | Ga0501037_0448190 | 3300049573 | Bacteria | 881 |
| 214 | Ga0501038_0001822 | 3300049574 | Bacteria | 19745 |
| 215 | Ga0501038_0010994 | 3300049574 | Bacteria | 8265 |
| 216 | Ga0501039_0099529 | 3300049575 | Bacteria | 2269 |
| 217 | Ga0501043_0106482 | 3300049579 | Bacteria | 2202 |
| 218 | Ga0501046_0015340 | 3300049580 | Bacteria | 6442 |
| 219 | Ga0501068_0013082 | 3300049584 | Bacteria | 4717 |
| 220 | Ga0501069_0050982 | 3300049585 | Bacteria | 2303 |
| 221 | Ga0501070_0014829 | 3300049586 | Bacteria | 6557 |
| 222 | Ga0501070_0168992 | 3300049586 | Bacteria | 1801 |
| 223 | Ga0501073_0053380 | 3300049589 | Bacteria | 2830 |
| 224 | Ga0501074_0002484 | 3300049590 | Bacteria | 12858 |
| 225 | Ga0501075_0643485 | 3300049591 | Bacteria | 808 |
| 226 | Ga0501076_0314769 | 3300049592 | Bacteria | 1284 |
| 227 | Ga0501080_0004627 | 3300049742 | Bacteria | 12263 |
| 228 | Ga0501080_0067225 | 3300049742 | Bacteria | 3333 |
| 229 | Ga0501083_0195062 | 3300049744 | Bacteria | 1321 |
| 230 | Ga0501044_0200216 | 3300049823 | Bacteria | 1955 |
| 231 | Ga0501084_0309097 | 3300054114 | Bacteria | 1335 |
| 232 | Ga0501082_0053273 | 3300060353 | Bacteria | 3488 |
| 233 | Ga0400483_216953 | |||
| 234 | Ga0207674_10077496 | |||
| 235 | Ga0316575_10000075 | |||
| 236 | Ga0316575_10000487 | |||
| 237 | Ga0316575_10008164 | |||
| 238 | Ga0316579_10000112 | |||
| 239 | Ga0316579_10000762 | |||
| 240 | Ga0316579_10000799 | |||
| 241 | Ga0316579_10002543 | |||
| 242 | Ga0316579_10013311 | |||
| 243 | Ga0316579_10015975 | |||
| 244 | Ga0316579_10033968 | |||
| 245 | Ga0316579_10118354 | |||
| 246 | Ga0316579_10187276 | |||
| 247 | Ga0316576_10000521 | |||
| 248 | Ga0316576_10000941 | |||
| 249 | Ga0316576_10008009 | |||
| 250 | Ga0316576_10008752 | |||
| 251 | Ga0316576_10062232 | |||
| 252 | Ga0316576_10198064 | |||
| 253 | Ga0316576_10498973 | |||
| 254 | Ga0316578_10000036 | |||
| 255 | Ga0316578_10000232 | |||
| 256 | Ga0316578_10000708 | |||
| 257 | Ga0316578_10002132 | |||
| 258 | Ga0316578_10009548 | |||
| 259 | Ga0316578_10011500 | |||
| 260 | Ga0316578_10013848 | |||
| 261 | Ga0316578_10018208 | |||
| 262 | Ga0316578_10031097 | |||
| 263 | Ga0316578_10038370 | |||
| 264 | Ga0316578_10051140 | |||
| 265 | Ga0316578_10075773 | |||
| 266 | Ga0316577_10000097 | |||
| 267 | Ga0316577_10014855 | |||
| 268 | Ga0316577_10024593 | |||
| 269 | Ga0316577_10030751 | |||
| 270 | Ga0316577_10064679 | |||
| 271 | Ga0316577_10067836 | |||
| 272 | Ga0316577_10097023 | |||
| 273 | Ga0316577_10102249 | |||
| 274 | Ga0316577_10275787 | |||
| 275 | Ga0316577_10436383 | |||
| 276 | Ga0316583_10005061 | |||
| 277 | Ga0316583_10011643 | |||
| 278 | Ga0316583_10021124 | |||
| 279 | Ga0316583_10035883 | |||
| 280 | Ga0316583_10054450 | |||
| 281 | Ga0316585_10000137 | |||
| 282 | Ga0316585_10002326 | |||
| 283 | Ga0316585_10014175 | |||
| 284 | Ga0316585_10043913 | |||
| 285 | Ga0316585_10051468 | |||
| 286 | Ga0316580_10000114 | |||
| 287 | Ga0316580_10008584 | |||
| 288 | Ga0316580_10015299 | |||
| 289 | Ga0316580_10016175 | |||
| 290 | Ga0316580_10029771 | |||
| 291 | Ga0316593_10000230 | |||
| 292 | Ga0316593_10001260 | |||
| 293 | Ga0316593_10002399 | |||
| 294 | Ga0316593_10004392 | |||
| 295 | Ga0316593_10005984 | |||
| 296 | Ga0316593_10007796 | |||
| 297 | Ga0316593_10010640 | |||
| 298 | Ga0316593_10013730 | |||
| 299 | Ga0316593_10014909 | |||
| 300 | Ga0316593_10019723 | |||
| 301 | Ga0316593_10022133 | |||
| 302 | Ga0316593_10023213 | |||
| 303 | Ga0316593_10030035 | |||
| 304 | Ga0316593_10042329 | |||
| 305 | Ga0316593_10049514 | |||
| 306 | Ga0316593_10050664 | |||
| 307 | Ga0316593_10073519 | |||
| 308 | Ga0316593_10075740 | |||
| 309 | Ga0316593_10117027 | |||
| 310 | Ga0316592_1000541 | |||
| 311 | Ga0316592_1003259 | |||
| 312 | Ga0316592_1004940 | |||
| 313 | Ga0316592_1005082 | |||
| 314 | Ga0316592_1016095 | |||
| 315 | Ga0316592_1016976 | |||
| 316 | Ga0316586_1006674 | |||
| 317 | Ga0316586_1007598 | |||
| 318 | Ga0316588_1000713 | |||
| 319 | Ga0316588_1001009 | |||
| 320 | Ga0316588_1008449 | |||
| 321 | Ga0316588_1022797 | |||
| 322 | Ga0316587_1001605 | |||
| 323 | Ga0316587_1003970 | |||
| 324 | Ga0316587_1004172 | |||
| 325 | Ga0316587_1004525 | |||
| 326 | Ga0316587_1015542 | |||
| 327 | Ga0316596_1000141 | |||
| 328 | Ga0316596_1001863 | |||
| 329 | Ga0316596_1005378 | |||
| 330 | Ga0316596_1006089 | |||
| 331 | Ga0316596_1008911 | |||
| 332 | Ga0316596_1009383 | |||
| 333 | Ga0316596_1013424 | |||
| 334 | Ga0316596_1014921 | |||
| 335 | Ga0316596_1022149 | |||
| 336 | Ga0316574_0003574 | |||
| 337 | Ga0316574_0003652 | |||
| 338 | Ga0316574_0007807 | |||
| 339 | Ga0316574_0012415 | |||
| 340 | Ga0316574_0051118 | |||
| 341 | Ga0316574_0076933 | |||
| 342 | Ga0316574_0079578 | |||
| 343 | Ga0316574_0098146 | |||
| 344 | Ga0316574_0112234 | |||
| 345 | Ga0316574_0113227 | |||
| 346 | Ga0316574_0122388 | |||
| 347 | Ga0316574_0130692 | |||
| 348 | Ga0316574_0193761 | |||
| 349 | Ga0316574_0381276 | |||
| 350 | Ga0316582_0000029 | |||
| 351 | Ga0316582_0002572 | |||
| 352 | Ga0316582_0008202 | |||
| 353 | Ga0316582_0012942 | |||
| 354 | Ga0316582_0016488 | |||
| 355 | Ga0316582_0021577 | |||
| 356 | Ga0316582_0021646 | |||
| 357 | Ga0316582_0025077 | |||
| 358 | Ga0316582_0038586 | |||
| 359 | Ga0316582_0051956 | |||
| 360 | Ga0316582_0052493 | |||
| 361 | Ga0316582_0065292 | |||
| 362 | Ga0316582_0072619 | |||
| 363 | Ga0316582_0131469 | |||
| 364 | Ga0316582_0475299 | |||
| 365 | Ga0316582_0531025 | |||
| 366 | Ga0316584_0001251 | |||
| 367 | Ga0316584_0003738 | |||
| 368 | Ga0316584_0004310 | |||
| 369 | Ga0316584_0008448 | |||
| 370 | Ga0316584_0011038 | |||
| 371 | Ga0316584_0014049 | |||
| 372 | Ga0316584_0018078 | |||
| 373 | Ga0316584_0018669 | |||
| 374 | Ga0316584_0022357 | |||
| 375 | Ga0316584_0029539 | |||
| 376 | Ga0316584_0033032 | |||
| 377 | Ga0316584_0033074 | |||
| 378 | Ga0316584_0042892 | |||
| 379 | Ga0316584_0048085 | |||
| 380 | Ga0316584_0082358 | |||
| 381 | Ga0316584_0093255 | |||
| 382 | Ga0316584_0114206 | |||
| 383 | Ga0316584_0134680 | |||
| 384 | Ga0316584_0143839 | |||
| 385 | Ga0316584_0146852 | |||
| 386 | Ga0316584_0195019 | |||
| 387 | Ga0316584_0209294 | |||
| 388 | Ga0316584_0264388 | |||
| 389 | Ga0316581_0001690 | |||
| 390 | Ga0316581_0010560 | |||
| 391 | Ga0316581_0010769 | |||
| 392 | Ga0316581_0032586 | |||
| 393 | Ga0400484_03423 | |||
| 394 | Ga0400484_06989 | |||
| 395 | Ga0400484_22869 | |||
| 396 | Ga0400484_33172 | |||
| 397 | Ga0400490_41479 | |||
| 398 | Ga0400490_41641 | |||
| 399 | Ga0400490_51925 | |||
| 400 | Ga0400490_52136 | |||
| 401 | Ga0400490_54255 | |||
| 402 | Ga0400491_14470 | |||
| 403 | Ga0400491_25622 | |||
| 404 | Ga0400485_17163 | |||
| 405 | Ga0400485_17222 | |||
| 406 | Ga0400488_03755 | |||
| 407 | Ga0400488_31193 | |||
| 408 | Ga0400488_43853 | |||
| 409 | Ga0400488_50200 | |||
| 410 | Ga0400488_50703 | |||
| 411 | Ga0400486_01662 | |||
| 412 | Ga0400486_07086 | |||
| 413 | Ga0400486_08898 | |||
| 414 | Ga0400486_18154 | |||
| 415 | Ga0400483_007858 | |||
| 416 | Ga0400483_012122 | |||
| 417 | Ga0400483_072362 | |||
| 418 | Ga0400483_119064 | |||
| 419 | Ga0400483_147588 | |||
| 420 | Ga0400483_206793 | |||
| 421 | Ga0400483_208106 | |||
| 422 | Ga0400483_244214 | |||
| 423 | Ga0400489_09946 | |||
| 424 | Ga0400487_04649 | |||
| 425 | Ga0400487_10072 | |||
| 426 | Ga0400487_17601 | |||
| 427 | Ga0400487_27950 | |||
| 428 | Ga0400487_47308 | |||
| 429 | Ga0400487_52635 | |||
| 430 | Ga0400487_62547 | |||
| 431 | Ga0400487_64684 | |||
| 432 | Ga0451577_0000104 | |||
| 433 | Ga0451577_0191022 | |||
| 434 | Ga0466966_0026201 | |||
| 435 | Ga0466963_0102636 | |||
| 436 | Ga0453684_0000364 | |||
| 437 | Ga0453684_0015773 | |||
| 438 | Ga0466971_0020402 | |||
| 439 | Ga0501033_0122598 | |||
| 440 | Ga0501034_0161373 | |||
| 441 | Ga0501036_0045591 | |||
| 442 | Ga0501037_0003604 | |||
| 443 | Ga0501037_0005270 | |||
| 444 | Ga0501037_0024124 | |||
| 445 | Ga0501037_0448190 | |||
| 446 | Ga0501038_0001822 | |||
| 447 | Ga0501038_0010994 | |||
| 448 | Ga0501039_0099529 | |||
| 449 | Ga0501043_0106482 | |||
| 450 | Ga0501046_0015340 | |||
| 451 | Ga0501068_0013082 | |||
| 452 | Ga0501069_0050982 | |||
| 453 | Ga0501070_0014829 | |||
| 454 | Ga0501070_0168992 | |||
| 455 | Ga0501073_0053380 | |||
| 456 | Ga0501074_0002484 | |||
| 457 | Ga0501075_0643485 | |||
| 458 | Ga0501076_0314769 | |||
| 459 | Ga0501080_0004627 | |||
| 460 | Ga0501080_0067225 | |||
| 461 | Ga0501083_0195062 | |||
| 462 | Ga0501044_0200216 | |||
| 463 | Ga0501084_0309097 | |||
| 464 | Ga0501082_0053273 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hsz-assembly2.cif.gz_B | crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution | 0.9277 | 15 | 228 |
| 2yy6-assembly2.cif.gz_B | crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5 | 0.9122 | 16 | 228 |
| 2hi0-assembly2.cif.gz_B | crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution | 0.9058 | 13 | 229 |
| 2nyv-assembly1.cif.gz_A | x-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus | 0.9014 | 13 | 232 |
| 3d6j-assembly1.cif.gz_A | crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis | 0.8987 | 14 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9596 | 104 | 216 | 3.40.50.1000 |
| 2hszB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9359 | 102 | 228 | 3.40.50.1000 |
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9202 | 104 | 216 | 3.40.50.1000 |
| af_K7VLP6_12_77_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9176 | 108 | 172 | 3.40.50.1000 |
| af_Q652P6_229_339_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9158 | 114 | 224 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9E6S7-F1-model_v4 | Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) | 0.9772 | 15 | 232 |
GO:0005829
GO:0005975 GO:0006281 GO:0008967 GO:0046295 GO:0046872 |
| AF-A0A3S1QVU3-F1-model_v4 | deleted | 0.9754 | 13 | 150 |
|
| AF-A0A846N137-F1-model_v4 | phosphoglycolate phosphatase (EC 3.1.3.18) | 0.9753 | 13 | 231 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A2E6E0E0-F1-model_v4 | phosphoglycolate phosphatase (EC 3.1.3.18) | 0.9747 | 13 | 232 |
GO:0005829
GO:0006281 GO:0008967 |
| AF-A0A6C1SVL6-F1-model_v4 | Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) | 0.9721 | 13 | 233 |
GO:0005829
GO:0005975 GO:0006281 GO:0008967 GO:0046295 GO:0046872 |