F345036

General Info

Members Datasets Scaffolds Average Seq Length
232 182 198 209

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10037651|Ga0105246_100376512
Length 247
Sequence VNVVVRDLQQAGIEPVRIERLAAWCTLERTNVALNGENMYGPDPANPHPMEGFPQVCFIKNTVKNPNIIIGDFTYYDDPEDSENFERNVLYHFPFIGDKLIMGKFCAIARGVQFIMNGANHNMAGFSTFPFYIFGNGWETAQPQSGDLPYKGDTVIGNDVWMGYQALIMPGVKIGNGAIISSRSVVTSDVPAYSIVGGNPARVIRQRFTDETISRLEKLAWWDWPVEKITQNLPAIISADLEALPDE

Samples

Sample ID Description Type Environment
1 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
2 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
3 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
4 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
5 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
6 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
7 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
8 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
9 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
10 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
11 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
12 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
13 2847085930 Erwinia persicina B64 Isolate Bulb
14 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
15 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
16 2865014394 Pantoea sp. R-71966 Isolate Unclassified
17 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
18 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
19 2904424332 Duganella sp. 1411 Isolate Rhizosphere
20 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
21 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
22 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
23 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
24 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
25 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
26 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
27 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
28 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
29 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
30 2952252522 Salinicola sp. DM10 Isolate Unclassified
31 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
180 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
181 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
182 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.34
Metatranscriptomes 0
Isolates 14.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0.43
Endosphere 3.02
Nodule 1.29
Rhizoplane 5.17
Rhizosphere 75
Stem 0
Stem Tuber 0.86
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001225 3300002737 Bacteria 14832
2 Ga0065714_10086162 3300005288 Bacteria 2114
3 Ga0070658_10268357 3300005327 Bacteria 1451
4 Ga0070658_10464705 3300005327 Bacteria 1091
5 Ga0070676_10268524 3300005328 Bacteria 1145
6 Ga0070670_100021941 3300005331 Bacteria 5494
7 Ga0070660_100533580 3300005339 Bacteria 978
8 Ga0070687_100231597 3300005343 Bacteria 1137
9 Ga0070692_10095551 3300005345 Bacteria 1622
10 Ga0070668_100254563 3300005347 Bacteria 1458
11 Ga0070669_100124687 3300005353 Bacteria 1970
12 Ga0070675_100036009 3300005354 Bacteria 4025
13 Ga0070714_100201295 3300005435 Bacteria 1821
14 Ga0070710_10108822 3300005437 Bacteria 1662
15 Ga0070678_101317714 3300005456 Bacteria 672
16 Ga0070662_100208571 3300005457 Bacteria 1554
17 Ga0070664_100020551 3300005564 Bacteria 5437
18 Ga0068859_100303922 3300005617 Bacteria 1689
19 Ga0068864_100355255 3300005618 Bacteria 1384
20 Ga0068870_10225687 3300005840 Bacteria 1149
21 Ga0075364_10013904 3300006051 Bacteria 4961
22 Ga0075430_100026349 3300006846 Bacteria 4947
23 Ga0068865_100206809 3300006881 Bacteria 1527
24 Ga0068865_100850875 3300006881 Bacteria 790
25 Ga0097620_100303884 3300006931 Bacteria 1689
26 Ga0079104_1055855 3300006946 Bacteria 864
27 Ga0105251_10001893 3300009011 Bacteria 17158
28 Ga0105251_10137728 3300009011 Bacteria 1105
29 Ga0105244_10014062 3300009036 Bacteria 4645
30 Ga0105244_10024432 3300009036 Bacteria 3298
31 Ga0105250_10003795 3300009092 Bacteria 7094
32 Ga0111539_10179792 3300009094 Bacteria 2471
33 Ga0105248_10208682 3300009177 Bacteria 2201
34 Ga0105237_10079787 3300009545 Bacteria 3263
35 Ga0105249_10534530 3300009553 Bacteria 1221
36 Ga0105246_10037651 3300011119 Bacteria 3247
37 Ga0157371_10038614 3300013102 Bacteria 3416
38 Ga0157371_10239007 3300013102 Bacteria 1306
39 Ga0157370_10407004 3300013104 Bacteria 1252
40 Ga0157369_10092664 3300013105 Bacteria 3225
41 Ga0163162_11589612 3300013306 Bacteria 746
42 Ga0157372_10005968 3300013307 Bacteria 12946
43 Ga0157372_10960451 3300013307 Bacteria 990
44 Ga0157375_10328628 3300013308 Bacteria 1694
45 Ga0163163_10686235 3300014325 Bacteria 1088
46 Ga0182006_1006920 3300015261 Bacteria 5224
47 Ga0182007_10030374 3300015262 Bacteria 1847
48 Ga0163161_10138966 3300017792 Bacteria 1838
49 Ga0209437_100212 3300025233 Bacteria 107265
50 Ga0209025_1028692 3300025294 Bacteria 2717
51 Ga0209257_1000434 3300025304 Bacteria 80353
52 Ga0207696_1005341 3300025711 Bacteria 5346
53 Ga0207696_1008130 3300025711 Bacteria 4045
54 Ga0207696_1020240 3300025711 Bacteria 2151
55 Ga0207655_1013350 3300025728 Bacteria 4725
56 Ga0207713_1000001 3300025735 Bacteria 2295391
57 Ga0207692_10121036 3300025898 Bacteria 1466
58 Ga0207662_10259767 3300025918 Bacteria 1143
59 Ga0207657_10076049 3300025919 Bacteria 2833
60 Ga0207649_10036863 3300025920 Bacteria 2949
61 Ga0207659_10274342 3300025926 Bacteria 1376
62 Ga0207700_10981237 3300025928 Bacteria 756
63 Ga0207664_10114859 3300025929 Bacteria 2244
64 Ga0207706_10156545 3300025933 Bacteria 2003
65 Ga0207704_10373368 3300025938 Bacteria 1117
66 Ga0207691_10008846 3300025940 Bacteria 9662
67 Ga0207711_10384428 3300025941 Bacteria 1303
68 Ga0207679_10267528 3300025945 Bacteria 1460
69 Ga0207668_10192225 3300025972 Bacteria 1618
70 Ga0209281_1000838 3300027111 Bacteria 27470
71 Ga0209281_1006342 3300027111 Bacteria 3102
72 Ga0307414_10331138 3300032004 Bacteria 1300
73 Ga0316584_0195713 3300036712 Bacteria 1493
74 Ga0400490_56441 3300038726 Bacteria 1645
75 Ga0439436_0019480 3300041404 Bacteria 2025
76 Ga0439438_000005 3300041405 Bacteria 408610
77 Ga0439447_001153 3300041407 Bacteria 9615
78 Ga0439447_009326 3300041407 Bacteria 2982
79 Ga0439432_002791 3300042006 Bacteria 6511
80 Ga0439462_0097929 3300042015 Bacteria 807
81 Ga0451577_0010635 3300042876 Bacteria 8770
82 Ga0451577_0371080 3300042876 Bacteria 1298
83 Ga0453683_0005383 3300044673 Bacteria 8944
84 Ga0453684_0000295 3300044712 Bacteria 211570
85 Ga0453684_0000375 3300044712 Bacteria 183706
86 Ga0453684_0005745 3300044712 Bacteria 24240
87 Ga0453684_0029499 3300044712 Bacteria 7785
88 Ga0453684_0049833 3300044712 Bacteria 5515
89 Ga0453684_0290574 3300044712 Unclassified 1862
90 Ga0453684_0347426 3300044712 Bacteria 1674
91 Ga0466957_0150521 3300044842 Bacteria 1505
92 Ga0451576_0000359 3300045051 Bacteria 109461
93 Ga0451576_0005475 3300045051 Bacteria 15901
94 Ga0451576_0222209 3300045051 Bacteria 1972
95 Ga0495591_018833 3300046458 Bacteria 2331
96 Ga0495638_0000157 3300046460 Bacteria 107187
97 Ga0495638_0085349 3300046460 Bacteria 1909
98 Ga0495653_0071575 3300046463 Bacteria 2591
99 Ga0495653_0263012 3300046463 Bacteria 1139
100 Ga0495650_0000410 3300046471 Bacteria 70515
101 Ga0495650_0001021 3300046471 Bacteria 31497
102 Ga0495580_0011787 3300046472 Bacteria 6747
103 Ga0495582_0006467 3300046473 Bacteria 6504
104 Ga0495639_0000522 3300046475 Bacteria 18043
105 Ga0495594_0032867 3300046499 Bacteria 2818
106 Ga0495596_0027345 3300046500 Bacteria 2295
107 Ga0495607_0085916 3300046501 Bacteria 1717
108 Ga0495583_0000006 3300046506 Bacteria 436893
109 Ga0495583_0013865 3300046506 Bacteria 4469
110 Ga0495583_0021596 3300046506 Bacteria 3307
111 Ga0495620_0010274 3300046515 Bacteria 4941
112 Ga0495628_0065483 3300046516 Bacteria 2842
113 Ga0495630_0324790 3300046517 Bacteria 1176
114 Ga0495643_0000117 3300046522 Bacteria 129698
115 Ga0495648_0000283 3300046524 Bacteria 57574
116 Ga0495648_0185527 3300046524 Bacteria 1053
117 Ga0495666_0003122 3300046526 Bacteria 8328
118 Ga0495642_0004735 3300046528 Bacteria 5266
119 Ga0495665_0146272 3300046531 Bacteria 1234
120 Ga0495586_0000429 3300046535 Bacteria 25339
121 Ga0495586_0001130 3300046535 Bacteria 15006
122 Ga0495587_0014328 3300046536 Bacteria 4976
123 Ga0495597_0001677 3300046542 Bacteria 15363
124 Ga0495645_0001709 3300046543 Bacteria 14912
125 Ga0495622_0000048 3300046557 Bacteria 108955
126 Ga0495633_0013000 3300046558 Bacteria 4404
127 Ga0495667_0114605 3300046559 Bacteria 1741
128 Ga0495668_0009675 3300046616 Bacteria 5894
129 Ga0495668_0025489 3300046616 Bacteria 3359
130 Ga0495611_0010508 3300046648 Bacteria 3916
131 Ga0495625_0000241 3300046660 Bacteria 85835
132 Ga0495635_0014174 3300046663 Bacteria 5578
133 Ga0495635_0024592 3300046663 Bacteria 4197
134 Ga0495588_0045205 3300046674 Bacteria 2257
135 Ga0495588_0075054 3300046674 Bacteria 1761
136 Ga0495646_0004015 3300046680 Bacteria 9220
137 Ga0495646_0037111 3300046680 Bacteria 3017
138 Ga0495669_0006378 3300046684 Bacteria 4928
139 Ga0495613_0024530 3300046689 Bacteria 4493
140 Ga0495613_0399305 3300046689 Bacteria 938
141 Ga0495613_0499246 3300046689 Bacteria 819
142 Ga0495670_0313117 3300046691 Bacteria 842
143 Ga0495671_0130750 3300046692 Bacteria 1224
144 Ga0495649_0000327 3300046694 Bacteria 41383
145 Ga0495649_0001472 3300046694 Bacteria 17707
146 Ga0495600_0066382 3300046809 Bacteria 2358
147 Ga0495581_0001122 3300047315 Bacteria 14649
148 Ga0495581_0001392 3300047315 Bacteria 13384
149 Ga0495604_0007776 3300047317 Bacteria 8488
150 Ga0495604_0007777 3300047317 Bacteria 8487
151 Ga0495672_0034140 3300047320 Bacteria 3146
152 Ga0495676_0111864 3300047321 Bacteria 2002
153 Ga0495680_0012605 3300047322 Bacteria 7428
154 Ga0495680_0171510 3300047322 Unclassified 1570
155 Ga0495683_0006816 3300047323 Bacteria 6207
156 Ga0495675_0001057 3300047444 Bacteria 16728
157 Ga0495675_0071893 3300047444 Bacteria 2183
158 Ga0495679_000416 3300047446 Bacteria 31556
159 Ga0495679_008052 3300047446 Bacteria 4324
160 Ga0495593_0000337 3300047673 Bacteria 26031
161 Ga0495593_0015583 3300047673 Bacteria 4302
162 Ga0495593_0045361 3300047673 Bacteria 2346
163 Ga0495614_0002721 3300048089 Bacteria 7862
164 Ga0496101_0007399 3300048904 Bacteria 7116
165 Ga0496102_0005513 3300048905 Bacteria 10747
166 Ga0496103_0019910 3300048906 Bacteria 4030
167 Ga0496104_0745133 3300048907 Bacteria 887
168 Ga0496105_0044099 3300048908 Bacteria 3677
169 Ga0496106_0142842 3300048909 Bacteria 1884
170 Ga0496108_0731383 3300048911 Bacteria 857
171 Ga0496109_0376566 3300048912 Bacteria 1341
172 Ga0496114_0105494 3300048917 Bacteria 2410
173 Ga0496116_0320807 3300048919 Bacteria 725
174 Ga0496117_0000009 3300048920 Bacteria 613759
175 Ga0496117_0000327 3300048920 Bacteria 83713
176 Ga0496117_0002974 3300048920 Bacteria 20439
177 Ga0496118_0000017 3300048921 Bacteria 549445
178 Ga0496118_0000112 3300048921 Bacteria 150756
179 Ga0496118_0000212 3300048921 Bacteria 101586
180 Ga0496119_0000018 3300048922 Bacteria 306476
181 Ga0496119_0000027 3300048922 Bacteria 249124
182 Ga0496120_0000002 3300048923 Bacteria 547999
183 Ga0496120_0000022 3300048923 Bacteria 249124
184 Ga0496120_0033541 3300048923 Bacteria 3083
185 Ga0496121_0000215 3300048924 Bacteria 127059
186 Ga0496121_0005779 3300048924 Bacteria 15692
187 Ga0496122_0000755 3300048925 Bacteria 62678
188 Ga0496122_0042400 3300048925 Bacteria 3581
189 Ga0496123_0001395 3300048926 Bacteria 33860
190 Ga0496124_0004293 3300048927 Bacteria 16743
191 Ga0496124_0177829 3300048927 Bacteria 1640
192 Ga0496125_0056976 3300048928 Bacteria 3169
193 Ga0501047_0098692 3300049581 Bacteria 2799
194 Ga0501069_0221382 3300049585 Bacteria 1100
195 Ga0501070_0099437 3300049586 Bacteria 2406
196 nmdc:mga00v17_14934_c1 3300050491 Bacteria 4348
197 nmdc:mga0qj67_56532_c1 3300050509 Bacteria 3110
198 Ga0500600_0011885 3300053149 Bacteria 5289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10108822 Ga0070710_101088221 189
2 3300025898 Ga0207692_10121036 Ga0207692_101210362 189
3 3300025928 Ga0207700_10981237 Ga0207700_109812371 189
4 3300005327 Ga0070658_10268357 Ga0070658_102683572 198
5 3300005328 Ga0070676_10268524 Ga0070676_102685242 198
6 3300005331 Ga0070670_100021941 Ga0070670_1000219412 198
7 3300005339 Ga0070660_100533580 Ga0070660_1005335802 198
8 3300005343 Ga0070687_100231597 Ga0070687_1002315971 198
9 3300005345 Ga0070692_10095551 Ga0070692_100955512 198
10 3300005353 Ga0070669_100124687 Ga0070669_1001246872 198
11 3300005354 Ga0070675_100036009 Ga0070675_1000360094 198
12 3300005435 Ga0070714_100201295 Ga0070714_1002012952 198
13 3300005456 Ga0070678_101317714 Ga0070678_1013177141 198
14 3300005457 Ga0070662_100208571 Ga0070662_1002085712 198
15 3300005564 Ga0070664_100020551 Ga0070664_1000205511 198
16 3300005617 Ga0068859_100303922 Ga0068859_1003039222 198
17 3300005618 Ga0068864_100355255 Ga0068864_1003552551 198
18 3300005840 Ga0068870_10225687 Ga0068870_102256872 198
19 3300006846 Ga0075430_100026349 Ga0075430_1000263496 198
20 3300006881 Ga0068865_100206809 Ga0068865_1002068092 198
21 3300006881 Ga0068865_100850875 Ga0068865_1008508751 198
22 3300006931 Ga0097620_100303884 Ga0097620_1003038842 198
23 3300009177 Ga0105248_10208682 Ga0105248_102086822 198
24 3300009545 Ga0105237_10079787 Ga0105237_100797873 198
25 3300009553 Ga0105249_10534530 Ga0105249_105345302 198
26 3300013102 Ga0157371_10239007 Ga0157371_102390071 198
27 3300013306 Ga0163162_11589612 Ga0163162_115896121 198
28 3300013308 Ga0157375_10328628 Ga0157375_103286282 198
29 3300014325 Ga0163163_10686235 Ga0163163_106862352 198
30 3300015261 Ga0182006_1006920 Ga0182006_10069203 198
31 3300025918 Ga0207662_10259767 Ga0207662_102597671 198
32 3300025919 Ga0207657_10076049 Ga0207657_100760492 198
33 3300025920 Ga0207649_10036863 Ga0207649_100368632 198
34 3300025926 Ga0207659_10274342 Ga0207659_102743421 198
35 3300025929 Ga0207664_10114859 Ga0207664_101148593 198
36 3300025933 Ga0207706_10156545 Ga0207706_101565452 198
37 3300025940 Ga0207691_10008846 Ga0207691_100088466 198
38 3300025941 Ga0207711_10384428 Ga0207711_103844281 198
39 3300025945 Ga0207679_10267528 Ga0207679_102675281 198
40 3300032004 Ga0307414_10331138 Ga0307414_103311382 198
41 3300041404 Ga0439436_0019480 Ga0439436_0019480_307_915 198
42 3300042015 Ga0439462_0097929 Ga0439462_0097929_176_775 198
43 3300044712 Ga0453684_0029499 Ga0453684_0029499_6717_7349 198
44 3300044842 Ga0466957_0150521 Ga0466957_0150521_532_1146 198
45 3300046463 Ga0495653_0263012 Ga0495653_0263012_495_1112 198
46 3300046535 Ga0495586_0000429 Ga0495586_0000429_6981_7598 198
47 3300046616 Ga0495668_0009675 Ga0495668_0009675_3059_3673 198
48 3300046663 Ga0495635_0014174 Ga0495635_0014174_192_809 198
49 3300046674 Ga0495588_0075054 Ga0495588_0075054_140_757 198
50 3300046689 Ga0495613_0399305 Ga0495613_0399305_306_914 198
51 3300046689 Ga0495613_0499246 Ga0495613_0499246_105_722 198
52 3300047317 Ga0495604_0007776 Ga0495604_0007776_2401_3018 198
53 3300047322 Ga0495680_0012605 Ga0495680_0012605_1873_2490 198
54 3300047673 Ga0495593_0000337 Ga0495593_0000337_18593_19210 198
55 3300048089 Ga0495614_0002721 Ga0495614_0002721_5997_6614 198
56 3300049585 Ga0501069_0221382 Ga0501069_0221382_35_634 198
57 3300049586 Ga0501070_0099437 Ga0501070_0099437_1362_1970 198
58 3300050509 nmdc:mga0qj67_56532_c1 nmdc:mga0qj67_56532_c1_44_661 198
59 3300053149 Ga0500600_0011885 Ga0500600_0011885_4099_4701 198
60 3300044673 Ga0453683_0005383 Ga0453683_0005383_1290_1907 204
61 iso_pu_bacteria 2767802442 2770195599 204
62 iso_pu_bacteria 2808606418 2809145964 204
63 iso_pu_bacteria 2919543075 2919545487 204
64 iso_pu_bacteria 2608642108 2608671806 205
65 iso_pu_bacteria 2648501693 2650897440 205
66 iso_pu_bacteria 2687453341 2688391888 205
67 iso_pu_bacteria 2687453601 2689442861 205
68 iso_pu_bacteria 2711768156 2712469900 205
69 iso_pu_bacteria 2765235802 2765465576 205
70 iso_pu_bacteria 2808606377 2808933455 205
71 iso_pu_bacteria 2808606381 2808955577 205
72 iso_pu_bacteria 2840764183 2840770462 205
73 iso_pu_bacteria 2844528606 2844528882 205
74 iso_pu_bacteria 2847085930 2847087559 205
75 iso_pu_bacteria 2855195626 2855198354 205
76 iso_pu_bacteria 2865014394 2865017963 205
77 iso_pu_bacteria 2891670763 2891674238 205
78 iso_pu_bacteria 2900051742 2900053209 205
79 iso_pu_bacteria 2904424332 2904427103 205
80 iso_pu_bacteria 2904578770 2904583194 205
81 iso_pu_bacteria 2919119836 2919123843 205
82 iso_pu_bacteria 2919493220 2919495219 205
83 iso_pu_bacteria 2923525760 2923526781 205
84 iso_pu_bacteria 2932410948 2932414196 205
85 iso_pu_bacteria 2932416698 2932416805 205
86 iso_pu_bacteria 2939631187 2939633531 205
87 iso_pu_bacteria 2945951305 2945952480 205
88 iso_pu_bacteria 2952252522 2952255824 205
89 iso_pu_bacteria 2990261002 2990263403 205
90 iso_pu_bacteria 8002745576 8002748283 205
91 iso_pu_bacteria 8054844752 8054847370 205
92 iso_pu_bacteria 8054849141 8054849266 205
93 3300048922 Ga0496119_0000018 Ga0496119_0000018_9331_9954 207
94 3300048923 Ga0496120_0000002 Ga0496120_0000002_326222_326845 207
95 3300006946 Ga0079104_1055855 Ga0079104_10558552 208
96 3300009092 Ga0105250_10003795 Ga0105250_100037953 208
97 3300025711 Ga0207696_1008130 Ga0207696_10081305 208
98 3300027111 Ga0209281_1000838 Ga0209281_100083817 208
99 3300041405 Ga0439438_000005 Ga0439438_000005_275895_276620 208
100 3300041407 Ga0439447_009326 Ga0439447_009326_1534_2259 208
101 3300042006 Ga0439432_002791 Ga0439432_002791_449_1174 208
102 3300044712 Ga0453684_0005745 Ga0453684_0005745_20612_21241 208
103 3300048920 Ga0496117_0002974 Ga0496117_0002974_15546_16172 208
104 3300048924 Ga0496121_0005779 Ga0496121_0005779_11048_11674 208
105 3300048928 Ga0496125_0056976 Ga0496125_0056976_515_1141 208
106 3300002737 JGI25162J39368_1001225 JGI25162J39368_100122513 209
107 3300005288 Ga0065714_10086162 Ga0065714_100861623 209
108 3300005327 Ga0070658_10464705 Ga0070658_104647052 209
109 3300005347 Ga0070668_100254563 Ga0070668_1002545632 209
110 3300006051 Ga0075364_10013904 Ga0075364_100139044 209
111 3300009011 Ga0105251_10001893 Ga0105251_100018939 209
112 3300009011 Ga0105251_10137728 Ga0105251_101377281 209
113 3300009036 Ga0105244_10014062 Ga0105244_100140623 209
114 3300009036 Ga0105244_10024432 Ga0105244_100244323 209
115 3300009094 Ga0111539_10179792 Ga0111539_101797921 209
116 3300011119 Ga0105246_10037651 Ga0105246_100376512 209
117 3300013102 Ga0157371_10038614 Ga0157371_100386143 209
118 3300013104 Ga0157370_10407004 Ga0157370_104070041 209
119 3300013105 Ga0157369_10092664 Ga0157369_100926644 209
120 3300013307 Ga0157372_10005968 Ga0157372_100059684 209
121 3300013307 Ga0157372_10960451 Ga0157372_109604511 209
122 3300015262 Ga0182007_10030374 Ga0182007_100303743 209
123 3300017792 Ga0163161_10138966 Ga0163161_101389661 209
124 3300025233 Ga0209437_100212 Ga0209437_10021226 209
125 3300025294 Ga0209025_1028692 Ga0209025_10286922 209
126 3300025304 Ga0209257_1000434 Ga0209257_100043445 209
127 3300025711 Ga0207696_1005341 Ga0207696_10053414 209
128 3300025711 Ga0207696_1020240 Ga0207696_10202402 209
129 3300025728 Ga0207655_1013350 Ga0207655_10133503 209
130 3300025735 Ga0207713_1000001 Ga0207713_10000011575 209
131 3300025938 Ga0207704_10373368 Ga0207704_103733682 209
132 3300025972 Ga0207668_10192225 Ga0207668_101922252 209
133 3300027111 Ga0209281_1006342 Ga0209281_10063422 209
134 3300036712 Ga0316584_0195713 Ga0316584_0195713_132_785 209
135 3300038726 Ga0400490_56441 Ga0400490_56441_734_1372 209
136 3300041407 Ga0439447_001153 Ga0439447_001153_3151_3780 209
137 3300042876 Ga0451577_0010635 Ga0451577_0010635_711_1343 209
138 3300042876 Ga0451577_0371080 Ga0451577_0371080_236_868 209
139 3300044712 Ga0453684_0000295 Ga0453684_0000295_30898_31530 209
140 3300044712 Ga0453684_0000375 Ga0453684_0000375_129726_130358 209
141 3300044712 Ga0453684_0049833 Ga0453684_0049833_3217_3855 209
142 3300044712 Ga0453684_0290574 Ga0453684_0290574_171_803 209
143 3300044712 Ga0453684_0347426 Ga0453684_0347426_98_730 209
144 3300045051 Ga0451576_0000359 Ga0451576_0000359_30917_31549 209
145 3300045051 Ga0451576_0005475 Ga0451576_0005475_6349_6981 209
146 3300045051 Ga0451576_0222209 Ga0451576_0222209_571_1209 209
147 3300046458 Ga0495591_018833 Ga0495591_018833_232_864 209
148 3300046460 Ga0495638_0000157 Ga0495638_0000157_30218_30859 209
149 3300046460 Ga0495638_0085349 Ga0495638_0085349_85_717 209
150 3300046463 Ga0495653_0071575 Ga0495653_0071575_968_1612 209
151 3300046471 Ga0495650_0000410 Ga0495650_0000410_6617_7258 209
152 3300046471 Ga0495650_0001021 Ga0495650_0001021_2584_3225 209
153 3300046472 Ga0495580_0011787 Ga0495580_0011787_3207_3848 209
154 3300046473 Ga0495582_0006467 Ga0495582_0006467_5459_6100 209
155 3300046475 Ga0495639_0000522 Ga0495639_0000522_6158_6802 209
156 3300046499 Ga0495594_0032867 Ga0495594_0032867_1520_2164 209
157 3300046500 Ga0495596_0027345 Ga0495596_0027345_1054_1695 209
158 3300046501 Ga0495607_0085916 Ga0495607_0085916_532_1173 209
159 3300046506 Ga0495583_0000006 Ga0495583_0000006_184555_185196 209
160 3300046506 Ga0495583_0013865 Ga0495583_0013865_2054_2695 209
161 3300046506 Ga0495583_0021596 Ga0495583_0021596_1311_1970 209
162 3300046515 Ga0495620_0010274 Ga0495620_0010274_3458_4090 209
163 3300046516 Ga0495628_0065483 Ga0495628_0065483_1286_1930 209
164 3300046517 Ga0495630_0324790 Ga0495630_0324790_223_867 209
165 3300046522 Ga0495643_0000117 Ga0495643_0000117_60350_60991 209
166 3300046524 Ga0495648_0000283 Ga0495648_0000283_2786_3427 209
167 3300046524 Ga0495648_0185527 Ga0495648_0185527_403_1032 209
168 3300046526 Ga0495666_0003122 Ga0495666_0003122_6760_7404 209
169 3300046528 Ga0495642_0004735 Ga0495642_0004735_698_1339 209
170 3300046531 Ga0495665_0146272 Ga0495665_0146272_162_803 209
171 3300046535 Ga0495586_0001130 Ga0495586_0001130_125_769 209
172 3300046536 Ga0495587_0014328 Ga0495587_0014328_1379_2023 209
173 3300046542 Ga0495597_0001677 Ga0495597_0001677_6664_7305 209
174 3300046543 Ga0495645_0001709 Ga0495645_0001709_9388_10029 209
175 3300046557 Ga0495622_0000048 Ga0495622_0000048_32397_33038 209
176 3300046558 Ga0495633_0013000 Ga0495633_0013000_2848_3489 209
177 3300046559 Ga0495667_0114605 Ga0495667_0114605_541_1182 209
178 3300046616 Ga0495668_0025489 Ga0495668_0025489_1340_1999 209
179 3300046648 Ga0495611_0010508 Ga0495611_0010508_1311_1970 209
180 3300046660 Ga0495625_0000241 Ga0495625_0000241_15088_15729 209
181 3300046663 Ga0495635_0024592 Ga0495635_0024592_1153_1797 209
182 3300046674 Ga0495588_0045205 Ga0495588_0045205_1172_1816 209
183 3300046680 Ga0495646_0004015 Ga0495646_0004015_1311_1955 209
184 3300046680 Ga0495646_0037111 Ga0495646_0037111_1264_1905 209
185 3300046684 Ga0495669_0006378 Ga0495669_0006378_1993_2634 209
186 3300046689 Ga0495613_0024530 Ga0495613_0024530_2268_2912 209
187 3300046691 Ga0495670_0313117 Ga0495670_0313117_85_726 209
188 3300046692 Ga0495671_0130750 Ga0495671_0130750_84_725 209
189 3300046694 Ga0495649_0000327 Ga0495649_0000327_32384_33016 209
190 3300046694 Ga0495649_0001472 Ga0495649_0001472_6402_7034 209
191 3300046809 Ga0495600_0066382 Ga0495600_0066382_831_1475 209
192 3300047315 Ga0495581_0001122 Ga0495581_0001122_6688_7332 209
193 3300047315 Ga0495581_0001392 Ga0495581_0001392_3812_4453 209
194 3300047317 Ga0495604_0007777 Ga0495604_0007777_2174_2818 209
195 3300047320 Ga0495672_0034140 Ga0495672_0034140_896_1525 209
196 3300047321 Ga0495676_0111864 Ga0495676_0111864_320_955 209
197 3300047322 Ga0495680_0171510 Ga0495680_0171510_884_1528 209
198 3300047323 Ga0495683_0006816 Ga0495683_0006816_4908_5540 209
199 3300047444 Ga0495675_0001057 Ga0495675_0001057_10732_11376 209
200 3300047444 Ga0495675_0071893 Ga0495675_0071893_10_651 209
201 3300047446 Ga0495679_000416 Ga0495679_000416_26222_26854 209
202 3300047446 Ga0495679_008052 Ga0495679_008052_483_1226 209
203 3300047673 Ga0495593_0015583 Ga0495593_0015583_2386_3027 209
204 3300047673 Ga0495593_0045361 Ga0495593_0045361_1574_2218 209
205 3300048904 Ga0496101_0007399 Ga0496101_0007399_1217_1858 209
206 3300048905 Ga0496102_0005513 Ga0496102_0005513_7826_8455 209
207 3300048906 Ga0496103_0019910 Ga0496103_0019910_1598_2227 209
208 3300048907 Ga0496104_0745133 Ga0496104_0745133_97_744 209
209 3300048908 Ga0496105_0044099 Ga0496105_0044099_2176_2817 209
210 3300048909 Ga0496106_0142842 Ga0496106_0142842_851_1492 209
211 3300048911 Ga0496108_0731383 Ga0496108_0731383_73_714 209
212 3300048912 Ga0496109_0376566 Ga0496109_0376566_467_1108 209
213 3300048917 Ga0496114_0105494 Ga0496114_0105494_39_680 209
214 3300048919 Ga0496116_0320807 Ga0496116_0320807_78_707 209
215 3300048920 Ga0496117_0000009 Ga0496117_0000009_170260_170889 209
216 3300048920 Ga0496117_0000327 Ga0496117_0000327_74583_75272 209
217 3300048921 Ga0496118_0000017 Ga0496118_0000017_105946_106575 209
218 3300048921 Ga0496118_0000112 Ga0496118_0000112_72399_73028 209
219 3300048921 Ga0496118_0000212 Ga0496118_0000212_81832_82521 209
220 3300048922 Ga0496119_0000027 Ga0496119_0000027_64050_64679 209
221 3300048923 Ga0496120_0000022 Ga0496120_0000022_64050_64679 209
222 3300048923 Ga0496120_0033541 Ga0496120_0033541_1558_2247 209
223 3300048924 Ga0496121_0000215 Ga0496121_0000215_25173_25802 209
224 3300048925 Ga0496122_0000755 Ga0496122_0000755_26264_26893 209
225 3300048925 Ga0496122_0042400 Ga0496122_0042400_363_992 209
226 3300048926 Ga0496123_0001395 Ga0496123_0001395_6978_7607 209
227 3300048927 Ga0496124_0004293 Ga0496124_0004293_4567_5196 209
228 3300048927 Ga0496124_0177829 Ga0496124_0177829_651_1280 209
229 3300049581 Ga0501047_0098692 Ga0501047_0098692_877_1509 209
230 3300050491 nmdc:mga00v17_14934_c1 nmdc:mga00v17_14934_c1_1390_2019 209
231 iso_pu_bacteria 2861691609 2861693209 209
232 iso_pu_bacteria 2919497567 2919499064 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

153

188

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x3c-assembly2.cif.gz_B crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) 0.961 3 206
1mr9-assembly2.cif.gz_Y crystal structure of streptogramin a acetyltransferase with acetyl-coa bound 0.9519 3 203
1mr7-assembly1.cif.gz_C crystal structure of streptogramin a acetyltransferase 0.949 3 203
6x3c-assembly2.cif.gz_B crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) 0.9473 3 206
1mr9-assembly1.cif.gz_B crystal structure of streptogramin a acetyltransferase with acetyl-coa bound 0.9429 3 203
ID Description Score Start End Superfamily
1mr9Z00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9335 3 205 2.160.10.10
1mr9Z00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9242 3 205 2.160.10.10
3eevB00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9128 23 206 2.160.10.10
af_A0A0G2K0C0_378_439_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8727 116 157 2.160.10.10
af_Q7SXP8_268_354_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.853 116 164 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3G897-F1-model_v4 deleted 0.988 1 206
AF-A0A1Y0RMY1-F1-model_v4 Chloramphenicol acetyltransferase 0.9878 1 206 GO:0016740
GO:0031470
GO:0043886
AF-A0A0T9PW17-F1-model_v4 Transferase hexapeptide repeat containing protein (EC 2.3.1.-) 0.9872 2 206 GO:0016746
AF-A0A4R3LBS7-F1-model_v4 Virginiamycin A acetyltransferase 0.9869 1 206 GO:0016746
AF-A0A1M5Z8L4-F1-model_v4 Streptogramin A acetyltransferase (EC 2.3.1.-) 0.9866 1 206 GO:0016746

Feature Viewer

pLDDT pTM Quality
93.55 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map