F345012

General Info

Members Datasets Scaffolds Average Seq Length
232 157 232 145

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10185346|Ga0105248_101853462
Length 162
Sequence MMRIRNTLMTTMAGTVCLVALAVSASAHHAFNAEFDAKRPLVLKGKVVKVEWVNPHAWIHIEVSECSGSVTKCVNPDGTRQVWMVEGGTPNTLQRNGVTRDSLKIGTVIVVSGYRAKDGRMRANGRDITLPDGRTLFMGSSGTGAPRDGKDPNERGPVKKGN

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 2.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.88
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11587917 3300004799 Bacteria 1104
2 Ga0058863_11789072 3300004799 Bacteria 609
3 Ga0058861_10032529 3300004800 Bacteria 556
4 Ga0058862_11961652 3300004803 Unclassified 505
5 Ga0065715_10614613 3300005293 Bacteria 699
6 Ga0065707_10453227 3300005295 Unclassified 798
7 Ga0070658_10253446 3300005327 Bacteria 1493
8 Ga0070690_100708955 3300005330 Unclassified 773
9 Ga0068869_100504372 3300005334 Bacteria 1011
10 Ga0070680_100080610 3300005336 Bacteria 2684
11 Ga0070680_100421962 3300005336 Unclassified 1138
12 Ga0068868_100498084 3300005338 Bacteria 1067
13 Ga0070689_101442685 3300005340 Bacteria 622
14 Ga0070687_100526127 3300005343 Unclassified 800
15 Ga0070669_100923365 3300005353 Unclassified 746
16 Ga0070671_100135838 3300005355 Bacteria 2073
17 Ga0070673_100061532 3300005364 Bacteria 2979
18 Ga0070673_100248900 3300005364 Bacteria 1548
19 Ga0070667_100383053 3300005367 Bacteria 1278
20 Ga0070711_100091912 3300005439 Bacteria 2189
21 Ga0070694_100278129 3300005444 Bacteria 1275
22 Ga0070678_100282275 3300005456 Bacteria 1405
23 Ga0070662_100030301 3300005457 Bacteria 3784
24 Ga0070681_10056623 3300005458 Bacteria 3901
25 Ga0070698_100702077 3300005471 Bacteria 954
26 Ga0070699_100653928 3300005518 Bacteria 959
27 Ga0070679_100769598 3300005530 Bacteria 906
28 Ga0070684_100066925 3300005535 Unclassified 3154
29 Ga0070697_101455385 3300005536 Bacteria 612
30 Ga0068853_100145505 3300005539 Bacteria 2129
31 Ga0068855_100207636 3300005563 Bacteria 2203
32 Ga0068855_100240428 3300005563 Bacteria 2023
33 Ga0068854_101040363 3300005578 Bacteria 727
34 Ga0068852_100023421 3300005616 Bacteria 4970
35 Ga0068852_100609305 3300005616 Bacteria 1097
36 Ga0068859_100564732 3300005617 Unclassified 1232
37 Ga0068864_100013399 3300005618 Bacteria 6795
38 Ga0068863_100065854 3300005841 Bacteria 3428
39 Ga0068863_100136385 3300005841 Bacteria 2344
40 Ga0068860_101297118 3300005843 Bacteria 749
41 Ga0097621_100654353 3300006237 Bacteria 964
42 Ga0068871_100700351 3300006358 Unclassified 928
43 Ga0075428_100014314 3300006844 Bacteria 8819
44 Ga0075428_100153284 3300006844 Unclassified 2503
45 Ga0075428_100223215 3300006844 Bacteria 2034
46 Ga0075428_100256582 3300006844 Bacteria 1883
47 Ga0075428_100425989 3300006844 Bacteria 1422
48 Ga0075430_100302080 3300006846 Bacteria 1324
49 Ga0075431_100060414 3300006847 Bacteria 3911
50 Ga0075431_100449701 3300006847 Bacteria 1284
51 Ga0075431_100897021 3300006847 Unclassified 856
52 Ga0075431_100976231 3300006847 Unclassified 815
53 Ga0075434_100406677 3300006871 Unclassified 1382
54 Ga0075434_101219303 3300006871 Bacteria 764
55 Ga0075429_100008946 3300006880 Bacteria 8702
56 Ga0075429_100044638 3300006880 Bacteria 3855
57 Ga0075429_100067428 3300006880 Unclassified 3114
58 Ga0075429_101146859 3300006880 Unclassified 679
59 Ga0068865_100623401 3300006881 Bacteria 914
60 Ga0097620_100564643 3300006931 Unclassified 1232
61 Ga0075435_100076016 3300007076 Bacteria 2751
62 Ga0105240_10000463 3300009093 Bacteria 74767
63 Ga0105240_10211699 3300009093 Bacteria 2265
64 Ga0111539_10042011 3300009094 Bacteria 5494
65 Ga0111539_10089858 3300009094 Bacteria 3610
66 Ga0111539_10290031 3300009094 Bacteria 1904
67 Ga0111539_12008325 3300009094 Unclassified 671
68 Ga0114129_10049618 3300009147 Bacteria 5896
69 Ga0114129_10273371 3300009147 Bacteria 2260
70 Ga0114129_10733555 3300009147 Unclassified 1266
71 Ga0114129_10747120 3300009147 Bacteria 1253
72 Ga0114129_10880687 3300009147 Bacteria 1136
73 Ga0114129_11053941 3300009147 Unclassified 1021
74 Ga0114129_11107317 3300009147 Bacteria 991
75 Ga0105241_10038924 3300009174 Bacteria 3586
76 Ga0105242_10088239 3300009176 Bacteria 2605
77 Ga0105242_10259066 3300009176 Bacteria 1570
78 Ga0105242_10973706 3300009176 Unclassified 854
79 Ga0105248_10185346 3300009177 Unclassified 2345
80 Ga0105248_10354167 3300009177 Bacteria 1653
81 Ga0105237_10051854 3300009545 Bacteria 4121
82 Ga0105237_10167684 3300009545 Bacteria 2195
83 Ga0105237_10268788 3300009545 Bacteria 1708
84 Ga0105238_10025004 3300009551 Bacteria 6088
85 Ga0105238_10031235 3300009551 Bacteria 5422
86 Ga0105238_10334687 3300009551 Bacteria 1501
87 Ga0105238_10548353 3300009551 Bacteria 1160
88 Ga0105249_10542201 3300009553 Bacteria 1213
89 Ga0105239_10000225 3300010375 Bacteria 83296
90 Ga0157369_10118825 3300013105 Bacteria 2806
91 Ga0157369_11238445 3300013105 Bacteria 761
92 Ga0157378_10083232 3300013297 Bacteria 2895
93 Ga0157378_10317239 3300013297 Bacteria 1513
94 Ga0157378_10869234 3300013297 Bacteria 931
95 Ga0163162_10175793 3300013306 Bacteria 2266
96 Ga0163162_11853220 3300013306 Bacteria 690
97 Ga0157372_10097860 3300013307 Bacteria 3347
98 Ga0157375_10884706 3300013308 Bacteria 1038
99 Ga0157375_12205589 3300013308 Unclassified 656
100 Ga0163163_10338762 3300014325 Bacteria 1559
101 Ga0163163_10742105 3300014325 Bacteria 1045
102 Ga0157379_10219114 3300014968 Bacteria 1724
103 Ga0157376_10094022 3300014969 Unclassified 2604
104 Ga0157376_10111727 3300014969 Bacteria 2406
105 Ga0157376_10203401 3300014969 Unclassified 1824
106 Ga0163161_10205875 3300017792 Bacteria 1518
107 Ga0207680_10647615 3300025903 Unclassified 756
108 Ga0207705_10332176 3300025909 Bacteria 1169
109 Ga0207654_10056089 3300025911 Bacteria 2284
110 Ga0207707_10323411 3300025912 Bacteria 1331
111 Ga0207695_10000868 3300025913 Bacteria 55031
112 Ga0207695_10051232 3300025913 Bacteria 4337
113 Ga0207671_10092468 3300025914 Bacteria 2281
114 Ga0207671_10182022 3300025914 Bacteria 1636
115 Ga0207660_10082332 3300025917 Bacteria 2367
116 Ga0207652_10071859 3300025921 Bacteria 3008
117 Ga0207652_10638905 3300025921 Bacteria 952
118 Ga0207681_10760085 3300025923 Unclassified 808
119 Ga0207694_10112216 3300025924 Bacteria 2169
120 Ga0207694_10275280 3300025924 Bacteria 1381
121 Ga0207694_10465622 3300025924 Bacteria 1056
122 Ga0207687_10164994 3300025927 Bacteria 1703
123 Ga0207706_10040036 3300025933 Bacteria 4154
124 Ga0207686_10028139 3300025934 Bacteria 3300
125 Ga0207686_10984277 3300025934 Unclassified 684
126 Ga0207711_10144873 3300025941 Bacteria 2140
127 Ga0207689_10157454 3300025942 Bacteria 1872
128 Ga0207689_10390589 3300025942 Bacteria 1159
129 Ga0207661_10879533 3300025944 Unclassified 825
130 Ga0207679_10214855 3300025945 Bacteria 1615
131 Ga0207667_10299077 3300025949 Bacteria 1644
132 Ga0207703_10188935 3300026035 Bacteria 1823
133 Ga0207702_11561645 3300026078 Bacteria 653
134 Ga0207641_10063329 3300026088 Bacteria 3159
135 Ga0207641_10112647 3300026088 Bacteria 2414
136 Ga0207676_10002050 3300026095 Bacteria 14622
137 Ga0207676_10141764 3300026095 Bacteria 2058
138 Ga0207676_11204350 3300026095 Unclassified 751
139 Ga0207675_100253460 3300026118 Bacteria 1704
140 Ga0207698_10421777 3300026142 Bacteria 1280
141 Ga0207698_10431804 3300026142 Bacteria 1267
142 Ga0268264_11765145 3300028381 Bacteria 629
143 Ga0307517_10000710 3300028786 Bacteria 57392
144 Ga0307517_10048038 3300028786 Bacteria 4405
145 Ga0307513_10005771 3300031456 Bacteria 16278
146 Ga0307414_11999603 3300032004 Unclassified 541
147 Ga0307510_10069053 3300033180 Bacteria 3542
148 Ga0373928_0100023 3300035084 Unclassified 755
149 Ga0373944_0059234 3300035089 Bacteria 1225
150 Ga0373952_0065705 3300035092 Unclassified 897
151 Ga0373952_0126499 3300035092 Unclassified 698
152 Ga0373941_0179720 3300035115 Unclassified 793
153 Ga0373953_0255172 3300035117 Unclassified 762
154 Ga0373931_0041007 3300035691 Bacteria 2431
155 Ga0373931_0360079 3300035691 Unclassified 913
156 Ga0373937_0041649 3300036401 Bacteria 4189
157 Ga0373925_0462437 3300037068 Bacteria 1040
158 Ga0395898_0353015 3300037466 Bacteria 1402
159 Ga0395905_0279440 3300037471 Bacteria 1556
160 Ga0395905_0351669 3300037471 Bacteria 1366
161 Ga0395905_0694012 3300037471 Bacteria 920
162 Ga0466963_0791461 3300044694 Bacteria 669
163 Ga0495592_0078906 3300046454 Bacteria 2384
164 Ga0495651_0167347 3300046462 Bacteria 1569
165 Ga0495582_0620176 3300046473 Bacteria 626
166 Ga0495605_0402711 3300046474 Bacteria 569
167 Ga0495584_0541860 3300046491 Bacteria 593
168 Ga0495585_0428570 3300046492 Bacteria 635
169 Ga0495583_0045922 3300046506 Bacteria 2017
170 Ga0495608_0052764 3300046511 Bacteria 2691
171 Ga0495618_0063569 3300046514 Bacteria 2344
172 Ga0495628_0122701 3300046516 Bacteria 1992
173 Ga0495663_0107645 3300046525 Bacteria 924
174 Ga0495642_0145078 3300046528 Bacteria 1025
175 Ga0495652_0511750 3300046529 Bacteria 831
176 Ga0495621_0298397 3300046539 Unclassified 667
177 Ga0495611_0024082 3300046648 Bacteria 2646
178 Ga0495599_0259026 3300046678 Bacteria 1057
179 Ga0495658_0155737 3300046683 Unclassified 1406
180 Ga0495658_0223116 3300046683 Bacteria 1180
181 Ga0495658_0780982 3300046683 Unclassified 611
182 Ga0495669_0508079 3300046684 Bacteria 586
183 Ga0495613_0104987 3300046689 Bacteria 2040
184 Ga0495624_0110360 3300046690 Bacteria 1692
185 Ga0495581_0475330 3300047315 Bacteria 727
186 Ga0495636_0147121 3300047318 Archaea 1055
187 Ga0495636_0178276 3300047318 Bacteria 963
188 Ga0495636_0345979 3300047318 Unclassified 701
189 Ga0495674_0026632 3300047319 Bacteria 5291
190 Ga0495674_1372248 3300047319 Bacteria 528
191 Ga0495677_0089866 3300047445 Bacteria 1157
192 Ga0495684_0062479 3300047471 Bacteria 2833
193 Ga0495686_0136929 3300047472 Bacteria 1448
194 Ga0495602_0285736 3300048088 Unclassified 1213
195 Ga0496101_0753289 3300048904 Bacteria 768
196 Ga0496102_0021425 3300048905 Bacteria 5716
197 Ga0496103_0290392 3300048906 Bacteria 1052
198 Ga0496104_0083147 3300048907 Bacteria 3053
199 Ga0496108_0046668 3300048911 Bacteria 3620
200 Ga0496109_0001775 3300048912 Bacteria 17923
201 Ga0496112_0397280 3300048915 Bacteria 1318
202 Ga0496113_0444140 3300048916 Bacteria 1042
203 Ga0496115_0308557 3300048918 Bacteria 1296
204 Ga0501033_0148039 3300049570 Unclassified 1695
205 Ga0501037_0271252 3300049573 Unclassified 1184
206 Ga0501043_0080006 3300049579 Bacteria 2568
207 Ga0501047_0613063 3300049581 Bacteria 909
208 Ga0501044_0022243 3300049823 Bacteria 6757
209 nmdc:mga05p37_1051956_c1 3300050507 Unclassified 858
210 nmdc:mga05p37_148462_c1 3300050507 Unclassified 2869
211 nmdc:mga05p37_354438_c1 3300050507 Unclassified 1727
212 nmdc:mga09592_1111477_c1 3300050508 Bacteria 657
213 nmdc:mga09592_133213_c1 3300050508 Unclassified 2140
214 nmdc:mga09592_31163_c1 3300050508 Unclassified 4441
215 nmdc:mga0qj67_209571_c1 3300050509 Bacteria 1583
216 nmdc:mga06r32_161629_c1 3300050510 Bacteria 2222
217 nmdc:mga06r32_1630927_c1 3300050510 Unclassified 583
218 nmdc:mga06r32_18765_c1 3300050510 Bacteria 6338
219 nmdc:mga06r32_572440_c1 3300050510 Bacteria 1102
220 nmdc:mga06r32_666284_c1 3300050510 Unclassified 1008
221 nmdc:mga08y16_293933_c1 3300050511 Bacteria 1675
222 nmdc:mga08y16_568598_c1 3300050511 Unclassified 1146
223 nmdc:mga0n895_388341_c1 3300050512 Unclassified 1412
224 nmdc:mga0n895_557696_c1 3300050512 Bacteria 1151
225 nmdc:mga0rr50_68637_c1 3300050513 Unclassified 2696
226 nmdc:mga08x19_757309_c1 3300050514 Bacteria 689
227 nmdc:mga0a205_203620_c1 3300050515 Bacteria 1869
228 nmdc:mga0a205_398781_c1 3300050515 Unclassified 1239
229 Ga0495601_0193981 3300053077 Bacteria 1327
230 Ga0495595_0547815 3300053084 Bacteria 591
231 Ga0495619_0159906 3300053085 Bacteria 1555
232 Ga0587077_105654 3300059493 Bacteria 683

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10747120 Ga0114129_107471202 125
2 3300005330 Ga0070690_100708955 Ga0070690_1007089552 127
3 3300005343 Ga0070687_100526127 Ga0070687_1005261272 127
4 3300005617 Ga0068859_100564732 Ga0068859_1005647321 127
5 3300006358 Ga0068871_100700351 Ga0068871_1007003511 127
6 3300006931 Ga0097620_100564643 Ga0097620_1005646432 127
7 3300025903 Ga0207680_10647615 Ga0207680_106476152 127
8 3300037471 Ga0395905_0279440 Ga0395905_0279440_136_582 127
9 3300037471 Ga0395905_0351669 Ga0395905_0351669_561_1007 127
10 3300050514 nmdc:mga08x19_757309_c1 nmdc:mga08x19_757309_c1_131_586 127
11 3300037471 Ga0395905_0694012 Ga0395905_0694012_299_745 129
12 3300005340 Ga0070689_101442685 Ga0070689_1014426851 130
13 3300005364 Ga0070673_100248900 Ga0070673_1002489002 130
14 3300005439 Ga0070711_100091912 Ga0070711_1000919123 130
15 3300013297 Ga0157378_10317239 Ga0157378_103172392 130
16 3300028786 Ga0307517_10000710 Ga0307517_1000071051 130
17 3300031456 Ga0307513_10005771 Ga0307513_100057717 130
18 3300047319 Ga0495674_1372248 Ga0495674_1372248_19_501 131
19 3300050515 nmdc:mga0a205_398781_c1 nmdc:mga0a205_398781_c1_371_787 131
20 3300009147 Ga0114129_10049618 Ga0114129_100496184 132
21 3300009176 Ga0105242_10259066 Ga0105242_102590662 132
22 3300013306 Ga0163162_10175793 Ga0163162_101757932 132
23 3300013308 Ga0157375_10884706 Ga0157375_108847062 132
24 3300014969 Ga0157376_10111727 Ga0157376_101117273 132
25 3300014969 Ga0157376_10203401 Ga0157376_102034012 132
26 3300025934 Ga0207686_10028139 Ga0207686_100281392 132
27 3300050507 nmdc:mga05p37_148462_c1 nmdc:mga05p37_148462_c1_592_999 132
28 3300050508 nmdc:mga09592_133213_c1 nmdc:mga09592_133213_c1_788_1195 132
29 3300050509 nmdc:mga0qj67_209571_c1 nmdc:mga0qj67_209571_c1_406_813 132
30 3300050510 nmdc:mga06r32_18765_c1 nmdc:mga06r32_18765_c1_5253_5660 132
31 3300035117 Ga0373953_0255172 Ga0373953_0255172_129_551 133
32 3300005353 Ga0070669_100923365 Ga0070669_1009233651 134
33 3300009094 Ga0111539_10290031 Ga0111539_102900311 134
34 3300025923 Ga0207681_10760085 Ga0207681_107600851 134
35 3300032004 Ga0307414_11999603 Ga0307414_119996032 134
36 3300046683 Ga0495658_0780982 Ga0495658_0780982_13_417 134
37 3300005295 Ga0065707_10453227 Ga0065707_104532271 135
38 3300005471 Ga0070698_100702077 Ga0070698_1007020772 135
39 3300005518 Ga0070699_100653928 Ga0070699_1006539281 135
40 3300006237 Ga0097621_100654353 Ga0097621_1006543532 135
41 3300006844 Ga0075428_100014314 Ga0075428_1000143146 135
42 3300006880 Ga0075429_100008946 Ga0075429_1000089462 135
43 3300009094 Ga0111539_10042011 Ga0111539_100420114 135
44 3300013297 Ga0157378_10083232 Ga0157378_100832322 135
45 3300014969 Ga0157376_10094022 Ga0157376_100940222 135
46 3300026118 Ga0207675_100253460 Ga0207675_1002534602 135
47 3300046539 Ga0495621_0298397 Ga0495621_0298397_244_651 135
48 3300047318 Ga0495636_0147121 Ga0495636_0147121_621_1028 135
49 3300050511 nmdc:mga08y16_293933_c1 nmdc:mga08y16_293933_c1_994_1401 135
50 3300050515 nmdc:mga0a205_203620_c1 nmdc:mga0a205_203620_c1_528_935 135
51 3300005444 Ga0070694_100278129 Ga0070694_1002781292 136
52 3300006844 Ga0075428_100425989 Ga0075428_1004259892 136
53 3300006871 Ga0075434_100406677 Ga0075434_1004066772 136
54 3300009094 Ga0111539_10089858 Ga0111539_100898582 136
55 3300009147 Ga0114129_11107317 Ga0114129_111073172 136
56 3300013308 Ga0157375_12205589 Ga0157375_122055892 136
57 3300025942 Ga0207689_10390589 Ga0207689_103905892 136
58 3300035092 Ga0373952_0065705 Ga0373952_0065705_223_633 136
59 3300050510 nmdc:mga06r32_572440_c1 nmdc:mga06r32_572440_c1_441_851 136
60 3300050511 nmdc:mga08y16_568598_c1 nmdc:mga08y16_568598_c1_691_1101 136
61 3300050512 nmdc:mga0n895_388341_c1 nmdc:mga0n895_388341_c1_128_538 136
62 3300006847 Ga0075431_100060414 Ga0075431_1000604143 137
63 3300006880 Ga0075429_101146859 Ga0075429_1011468592 137
64 3300009176 Ga0105242_10973706 Ga0105242_109737062 137
65 3300025934 Ga0207686_10984277 Ga0207686_109842772 137
66 3300026095 Ga0207676_11204350 Ga0207676_112043502 137
67 3300035084 Ga0373928_0100023 Ga0373928_0100023_80_496 137
68 3300035092 Ga0373952_0126499 Ga0373952_0126499_108_524 137
69 3300035115 Ga0373941_0179720 Ga0373941_0179720_128_544 137
70 3300035691 Ga0373931_0041007 Ga0373931_0041007_1824_2240 137
71 3300046683 Ga0495658_0155737 Ga0495658_0155737_742_1155 137
72 3300047318 Ga0495636_0345979 Ga0495636_0345979_58_471 137
73 3300048088 Ga0495602_0285736 Ga0495602_0285736_649_1161 137
74 3300048906 Ga0496103_0290392 Ga0496103_0290392_229_675 137
75 3300050510 nmdc:mga06r32_161629_c1 nmdc:mga06r32_161629_c1_977_1390 137
76 3300004803 Ga0058862_11961652 Ga0058862_119616521 138
77 3300005334 Ga0068869_100504372 Ga0068869_1005043721 138
78 3300005536 Ga0070697_101455385 Ga0070697_1014553851 138
79 3300006844 Ga0075428_100153284 Ga0075428_1001532842 138
80 3300006844 Ga0075428_100223215 Ga0075428_1002232152 138
81 3300006844 Ga0075428_100256582 Ga0075428_1002565821 138
82 3300006846 Ga0075430_100302080 Ga0075430_1003020802 138
83 3300006847 Ga0075431_100449701 Ga0075431_1004497012 138
84 3300006847 Ga0075431_100897021 Ga0075431_1008970211 138
85 3300006847 Ga0075431_100976231 Ga0075431_1009762312 138
86 3300006871 Ga0075434_101219303 Ga0075434_1012193031 138
87 3300006880 Ga0075429_100044638 Ga0075429_1000446381 138
88 3300006880 Ga0075429_100067428 Ga0075429_1000674282 138
89 3300007076 Ga0075435_100076016 Ga0075435_1000760164 138
90 3300009147 Ga0114129_10273371 Ga0114129_102733713 138
91 3300009147 Ga0114129_10733555 Ga0114129_107335552 138
92 3300009147 Ga0114129_10880687 Ga0114129_108806872 138
93 3300009147 Ga0114129_11053941 Ga0114129_110539412 138
94 3300014325 Ga0163163_10338762 Ga0163163_103387622 138
95 3300035691 Ga0373931_0360079 Ga0373931_0360079_324_740 138
96 3300048907 Ga0496104_0083147 Ga0496104_0083147_2456_2872 138
97 3300049570 Ga0501033_0148039 Ga0501033_0148039_111_551 138
98 3300049573 Ga0501037_0271252 Ga0501037_0271252_89_529 138
99 3300049579 Ga0501043_0080006 Ga0501043_0080006_598_1038 138
100 3300049581 Ga0501047_0613063 Ga0501047_0613063_364_804 138
101 3300049823 Ga0501044_0022243 Ga0501044_0022243_5953_6393 138
102 3300050507 nmdc:mga05p37_1051956_c1 nmdc:mga05p37_1051956_c1_32_448 138
103 3300050507 nmdc:mga05p37_354438_c1 nmdc:mga05p37_354438_c1_1177_1593 138
104 3300050508 nmdc:mga09592_1111477_c1 nmdc:mga09592_1111477_c1_107_523 138
105 3300050508 nmdc:mga09592_31163_c1 nmdc:mga09592_31163_c1_2042_2458 138
106 3300050510 nmdc:mga06r32_1630927_c1 nmdc:mga06r32_1630927_c1_96_512 138
107 3300050510 nmdc:mga06r32_666284_c1 nmdc:mga06r32_666284_c1_239_655 138
108 3300050512 nmdc:mga0n895_557696_c1 nmdc:mga0n895_557696_c1_596_1012 138
109 3300050513 nmdc:mga0rr50_68637_c1 nmdc:mga0rr50_68637_c1_261_677 138
110 3300009094 Ga0111539_12008325 Ga0111539_120083251 139
111 3300009545 Ga0105237_10268788 Ga0105237_102687882 139
112 3300009551 Ga0105238_10031235 Ga0105238_100312354 139
113 3300014968 Ga0157379_10219114 Ga0157379_102191144 139
114 3300025914 Ga0207671_10182022 Ga0207671_101820222 139
115 3300025924 Ga0207694_10275280 Ga0207694_102752802 139
116 3300035089 Ga0373944_0059234 Ga0373944_0059234_277_735 139
117 3300036401 Ga0373937_0041649 Ga0373937_0041649_2807_3265 139
118 3300037068 Ga0373925_0462437 Ga0373925_0462437_11_469 139
119 3300046454 Ga0495592_0078906 Ga0495592_0078906_828_1286 139
120 3300046462 Ga0495651_0167347 Ga0495651_0167347_977_1435 139
121 3300046511 Ga0495608_0052764 Ga0495608_0052764_1150_1608 139
122 3300046514 Ga0495618_0063569 Ga0495618_0063569_1865_2323 139
123 3300046516 Ga0495628_0122701 Ga0495628_0122701_334_792 139
124 3300046529 Ga0495652_0511750 Ga0495652_0511750_197_652 139
125 3300046678 Ga0495599_0259026 Ga0495599_0259026_392_850 139
126 3300046683 Ga0495658_0223116 Ga0495658_0223116_411_869 139
127 3300046689 Ga0495613_0104987 Ga0495613_0104987_1090_1548 139
128 3300046690 Ga0495624_0110360 Ga0495624_0110360_344_802 139
129 3300047315 Ga0495581_0475330 Ga0495581_0475330_95_553 139
130 3300047319 Ga0495674_0026632 Ga0495674_0026632_2243_2701 139
131 3300047471 Ga0495684_0062479 Ga0495684_0062479_1816_2274 139
132 3300053077 Ga0495601_0193981 Ga0495601_0193981_137_595 139
133 3300053084 Ga0495595_0547815 Ga0495595_0547815_88_546 139
134 3300053085 Ga0495619_0159906 Ga0495619_0159906_15_473 139
135 3300009177 Ga0105248_10185346 Ga0105248_101853462 140
136 3300028786 Ga0307517_10048038 Ga0307517_100480382 140
137 3300046492 Ga0495585_0428570 Ga0495585_0428570_126_578 140
138 3300046506 Ga0495583_0045922 Ga0495583_0045922_1103_1558 140
139 3300046648 Ga0495611_0024082 Ga0495611_0024082_660_1115 140
140 3300046684 Ga0495669_0508079 Ga0495669_0508079_98_553 140
141 3300047472 Ga0495686_0136929 Ga0495686_0136929_451_906 140
142 3300004799 Ga0058863_11587917 Ga0058863_115879171 142
143 3300004799 Ga0058863_11789072 Ga0058863_117890721 142
144 3300004800 Ga0058861_10032529 Ga0058861_100325291 142
145 3300005293 Ga0065715_10614613 Ga0065715_106146131 142
146 3300005327 Ga0070658_10253446 Ga0070658_102534461 142
147 3300005336 Ga0070680_100080610 Ga0070680_1000806101 142
148 3300005336 Ga0070680_100421962 Ga0070680_1004219622 142
149 3300005338 Ga0068868_100498084 Ga0068868_1004980842 142
150 3300005355 Ga0070671_100135838 Ga0070671_1001358382 142
151 3300005364 Ga0070673_100061532 Ga0070673_1000615324 142
152 3300005367 Ga0070667_100383053 Ga0070667_1003830531 142
153 3300005456 Ga0070678_100282275 Ga0070678_1002822752 142
154 3300005457 Ga0070662_100030301 Ga0070662_1000303012 142
155 3300005458 Ga0070681_10056623 Ga0070681_100566235 142
156 3300005530 Ga0070679_100769598 Ga0070679_1007695981 142
157 3300005535 Ga0070684_100066925 Ga0070684_1000669253 142
158 3300005539 Ga0068853_100145505 Ga0068853_1001455052 142
159 3300005563 Ga0068855_100207636 Ga0068855_1002076362 142
160 3300005563 Ga0068855_100240428 Ga0068855_1002404282 142
161 3300005578 Ga0068854_101040363 Ga0068854_1010403632 142
162 3300005616 Ga0068852_100023421 Ga0068852_1000234217 142
163 3300005616 Ga0068852_100609305 Ga0068852_1006093052 142
164 3300005618 Ga0068864_100013399 Ga0068864_1000133993 142
165 3300005841 Ga0068863_100065854 Ga0068863_1000658542 142
166 3300005841 Ga0068863_100136385 Ga0068863_1001363853 142
167 3300005843 Ga0068860_101297118 Ga0068860_1012971181 142
168 3300006881 Ga0068865_100623401 Ga0068865_1006234011 142
169 3300009093 Ga0105240_10000463 Ga0105240_1000046359 142
170 3300009093 Ga0105240_10211699 Ga0105240_102116992 142
171 3300009174 Ga0105241_10038924 Ga0105241_100389243 142
172 3300009176 Ga0105242_10088239 Ga0105242_100882392 142
173 3300009177 Ga0105248_10354167 Ga0105248_103541672 142
174 3300009545 Ga0105237_10051854 Ga0105237_100518543 142
175 3300009545 Ga0105237_10167684 Ga0105237_101676842 142
176 3300009551 Ga0105238_10025004 Ga0105238_100250046 142
177 3300009551 Ga0105238_10334687 Ga0105238_103346872 142
178 3300009551 Ga0105238_10548353 Ga0105238_105483532 142
179 3300009553 Ga0105249_10542201 Ga0105249_105422012 142
180 3300010375 Ga0105239_10000225 Ga0105239_1000022553 142
181 3300013105 Ga0157369_10118825 Ga0157369_101188252 142
182 3300013105 Ga0157369_11238445 Ga0157369_112384451 142
183 3300013297 Ga0157378_10869234 Ga0157378_108692342 142
184 3300013306 Ga0163162_11853220 Ga0163162_118532201 142
185 3300013307 Ga0157372_10097860 Ga0157372_100978602 142
186 3300014325 Ga0163163_10742105 Ga0163163_107421052 142
187 3300017792 Ga0163161_10205875 Ga0163161_102058751 142
188 3300025909 Ga0207705_10332176 Ga0207705_103321762 142
189 3300025911 Ga0207654_10056089 Ga0207654_100560892 142
190 3300025912 Ga0207707_10323411 Ga0207707_103234112 142
191 3300025913 Ga0207695_10000868 Ga0207695_1000086847 142
192 3300025913 Ga0207695_10051232 Ga0207695_100512324 142
193 3300025914 Ga0207671_10092468 Ga0207671_100924682 142
194 3300025917 Ga0207660_10082332 Ga0207660_100823323 142
195 3300025921 Ga0207652_10071859 Ga0207652_100718592 142
196 3300025921 Ga0207652_10638905 Ga0207652_106389052 142
197 3300025924 Ga0207694_10112216 Ga0207694_101122162 142
198 3300025924 Ga0207694_10465622 Ga0207694_104656221 142
199 3300025927 Ga0207687_10164994 Ga0207687_101649942 142
200 3300025933 Ga0207706_10040036 Ga0207706_100400362 142
201 3300025941 Ga0207711_10144873 Ga0207711_101448732 142
202 3300025942 Ga0207689_10157454 Ga0207689_101574542 142
203 3300025944 Ga0207661_10879533 Ga0207661_108795331 142
204 3300025945 Ga0207679_10214855 Ga0207679_102148552 142
205 3300025949 Ga0207667_10299077 Ga0207667_102990772 142
206 3300026035 Ga0207703_10188935 Ga0207703_101889352 142
207 3300026078 Ga0207702_11561645 Ga0207702_115616451 142
208 3300026088 Ga0207641_10063329 Ga0207641_100633294 142
209 3300026088 Ga0207641_10112647 Ga0207641_101126472 142
210 3300026095 Ga0207676_10002050 Ga0207676_1000205010 142
211 3300026095 Ga0207676_10141764 Ga0207676_101417642 142
212 3300026142 Ga0207698_10421777 Ga0207698_104217772 142
213 3300026142 Ga0207698_10431804 Ga0207698_104318042 142
214 3300028381 Ga0268264_11765145 Ga0268264_117651451 142
215 3300033180 Ga0307510_10069053 Ga0307510_100690535 142
216 3300037466 Ga0395898_0353015 Ga0395898_0353015_91_552 142
217 3300044694 Ga0466963_0791461 Ga0466963_0791461_46_501 142
218 3300046473 Ga0495582_0620176 Ga0495582_0620176_35_496 142
219 3300046474 Ga0495605_0402711 Ga0495605_0402711_78_533 142
220 3300046491 Ga0495584_0541860 Ga0495584_0541860_13_474 142
221 3300046525 Ga0495663_0107645 Ga0495663_0107645_251_712 142
222 3300046528 Ga0495642_0145078 Ga0495642_0145078_388_849 142
223 3300047318 Ga0495636_0178276 Ga0495636_0178276_101_562 142
224 3300047445 Ga0495677_0089866 Ga0495677_0089866_159_620 142
225 3300048904 Ga0496101_0753289 Ga0496101_0753289_216_677 142
226 3300048905 Ga0496102_0021425 Ga0496102_0021425_3771_4232 142
227 3300048911 Ga0496108_0046668 Ga0496108_0046668_1976_2437 142
228 3300048912 Ga0496109_0001775 Ga0496109_0001775_6373_6834 142
229 3300048915 Ga0496112_0397280 Ga0496112_0397280_48_509 142
230 3300048916 Ga0496113_0444140 Ga0496113_0444140_520_981 142
231 3300048918 Ga0496115_0308557 Ga0496115_0308557_210_707 142
232 3300059493 Ga0587077_105654 Ga0587077_105654_79_537 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

14

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7999 43 76
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.798 43 76
8fok-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex in the dna elongation state 0.7929 44 76
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.7719 42 76
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.7685 42 76
ID Description Score Start End Superfamily
4fxdA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7999 43 76 2.40.50.730
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.798 43 76 2.40.50.730
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7871 46 80 2.30.29.30
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7678 40 122 2.40.50.140
af_Q95Y97_40_169_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7674 39 120 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1Y2K178-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9639 22 130
AF-A0A381VHI2-F1-model_v4 Uncharacterized protein 0.9572 39 131
AF-A0A2V8LL89-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9517 22 130
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.951 35 128
AF-A0A7Y4WDA8-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9474 22 128

Feature Viewer

pLDDT pTM Quality
79.74 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map