F345012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 157 | 232 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10185346|Ga0105248_101853462 |
| Length | 162 |
| Sequence | MMRIRNTLMTTMAGTVCLVALAVSASAHHAFNAEFDAKRPLVLKGKVVKVEWVNPHAWIHIEVSECSGSVTKCVNPDGTRQVWMVEGGTPNTLQRNGVTRDSLKIGTVIVVSGYRAKDGRMRANGRDITLPDGRTLFMGSSGTGAPRDGKDPNERGPVKKGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 90 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 91 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 92 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 93 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 94 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 95 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 96 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 97 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 104 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 133 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.84 |
| Metatranscriptomes | 2.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.88 |
| Rhizosphere | 94.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11587917 | 3300004799 | Bacteria | 1104 |
| 2 | Ga0058863_11789072 | 3300004799 | Bacteria | 609 |
| 3 | Ga0058861_10032529 | 3300004800 | Bacteria | 556 |
| 4 | Ga0058862_11961652 | 3300004803 | Unclassified | 505 |
| 5 | Ga0065715_10614613 | 3300005293 | Bacteria | 699 |
| 6 | Ga0065707_10453227 | 3300005295 | Unclassified | 798 |
| 7 | Ga0070658_10253446 | 3300005327 | Bacteria | 1493 |
| 8 | Ga0070690_100708955 | 3300005330 | Unclassified | 773 |
| 9 | Ga0068869_100504372 | 3300005334 | Bacteria | 1011 |
| 10 | Ga0070680_100080610 | 3300005336 | Bacteria | 2684 |
| 11 | Ga0070680_100421962 | 3300005336 | Unclassified | 1138 |
| 12 | Ga0068868_100498084 | 3300005338 | Bacteria | 1067 |
| 13 | Ga0070689_101442685 | 3300005340 | Bacteria | 622 |
| 14 | Ga0070687_100526127 | 3300005343 | Unclassified | 800 |
| 15 | Ga0070669_100923365 | 3300005353 | Unclassified | 746 |
| 16 | Ga0070671_100135838 | 3300005355 | Bacteria | 2073 |
| 17 | Ga0070673_100061532 | 3300005364 | Bacteria | 2979 |
| 18 | Ga0070673_100248900 | 3300005364 | Bacteria | 1548 |
| 19 | Ga0070667_100383053 | 3300005367 | Bacteria | 1278 |
| 20 | Ga0070711_100091912 | 3300005439 | Bacteria | 2189 |
| 21 | Ga0070694_100278129 | 3300005444 | Bacteria | 1275 |
| 22 | Ga0070678_100282275 | 3300005456 | Bacteria | 1405 |
| 23 | Ga0070662_100030301 | 3300005457 | Bacteria | 3784 |
| 24 | Ga0070681_10056623 | 3300005458 | Bacteria | 3901 |
| 25 | Ga0070698_100702077 | 3300005471 | Bacteria | 954 |
| 26 | Ga0070699_100653928 | 3300005518 | Bacteria | 959 |
| 27 | Ga0070679_100769598 | 3300005530 | Bacteria | 906 |
| 28 | Ga0070684_100066925 | 3300005535 | Unclassified | 3154 |
| 29 | Ga0070697_101455385 | 3300005536 | Bacteria | 612 |
| 30 | Ga0068853_100145505 | 3300005539 | Bacteria | 2129 |
| 31 | Ga0068855_100207636 | 3300005563 | Bacteria | 2203 |
| 32 | Ga0068855_100240428 | 3300005563 | Bacteria | 2023 |
| 33 | Ga0068854_101040363 | 3300005578 | Bacteria | 727 |
| 34 | Ga0068852_100023421 | 3300005616 | Bacteria | 4970 |
| 35 | Ga0068852_100609305 | 3300005616 | Bacteria | 1097 |
| 36 | Ga0068859_100564732 | 3300005617 | Unclassified | 1232 |
| 37 | Ga0068864_100013399 | 3300005618 | Bacteria | 6795 |
| 38 | Ga0068863_100065854 | 3300005841 | Bacteria | 3428 |
| 39 | Ga0068863_100136385 | 3300005841 | Bacteria | 2344 |
| 40 | Ga0068860_101297118 | 3300005843 | Bacteria | 749 |
| 41 | Ga0097621_100654353 | 3300006237 | Bacteria | 964 |
| 42 | Ga0068871_100700351 | 3300006358 | Unclassified | 928 |
| 43 | Ga0075428_100014314 | 3300006844 | Bacteria | 8819 |
| 44 | Ga0075428_100153284 | 3300006844 | Unclassified | 2503 |
| 45 | Ga0075428_100223215 | 3300006844 | Bacteria | 2034 |
| 46 | Ga0075428_100256582 | 3300006844 | Bacteria | 1883 |
| 47 | Ga0075428_100425989 | 3300006844 | Bacteria | 1422 |
| 48 | Ga0075430_100302080 | 3300006846 | Bacteria | 1324 |
| 49 | Ga0075431_100060414 | 3300006847 | Bacteria | 3911 |
| 50 | Ga0075431_100449701 | 3300006847 | Bacteria | 1284 |
| 51 | Ga0075431_100897021 | 3300006847 | Unclassified | 856 |
| 52 | Ga0075431_100976231 | 3300006847 | Unclassified | 815 |
| 53 | Ga0075434_100406677 | 3300006871 | Unclassified | 1382 |
| 54 | Ga0075434_101219303 | 3300006871 | Bacteria | 764 |
| 55 | Ga0075429_100008946 | 3300006880 | Bacteria | 8702 |
| 56 | Ga0075429_100044638 | 3300006880 | Bacteria | 3855 |
| 57 | Ga0075429_100067428 | 3300006880 | Unclassified | 3114 |
| 58 | Ga0075429_101146859 | 3300006880 | Unclassified | 679 |
| 59 | Ga0068865_100623401 | 3300006881 | Bacteria | 914 |
| 60 | Ga0097620_100564643 | 3300006931 | Unclassified | 1232 |
| 61 | Ga0075435_100076016 | 3300007076 | Bacteria | 2751 |
| 62 | Ga0105240_10000463 | 3300009093 | Bacteria | 74767 |
| 63 | Ga0105240_10211699 | 3300009093 | Bacteria | 2265 |
| 64 | Ga0111539_10042011 | 3300009094 | Bacteria | 5494 |
| 65 | Ga0111539_10089858 | 3300009094 | Bacteria | 3610 |
| 66 | Ga0111539_10290031 | 3300009094 | Bacteria | 1904 |
| 67 | Ga0111539_12008325 | 3300009094 | Unclassified | 671 |
| 68 | Ga0114129_10049618 | 3300009147 | Bacteria | 5896 |
| 69 | Ga0114129_10273371 | 3300009147 | Bacteria | 2260 |
| 70 | Ga0114129_10733555 | 3300009147 | Unclassified | 1266 |
| 71 | Ga0114129_10747120 | 3300009147 | Bacteria | 1253 |
| 72 | Ga0114129_10880687 | 3300009147 | Bacteria | 1136 |
| 73 | Ga0114129_11053941 | 3300009147 | Unclassified | 1021 |
| 74 | Ga0114129_11107317 | 3300009147 | Bacteria | 991 |
| 75 | Ga0105241_10038924 | 3300009174 | Bacteria | 3586 |
| 76 | Ga0105242_10088239 | 3300009176 | Bacteria | 2605 |
| 77 | Ga0105242_10259066 | 3300009176 | Bacteria | 1570 |
| 78 | Ga0105242_10973706 | 3300009176 | Unclassified | 854 |
| 79 | Ga0105248_10185346 | 3300009177 | Unclassified | 2345 |
| 80 | Ga0105248_10354167 | 3300009177 | Bacteria | 1653 |
| 81 | Ga0105237_10051854 | 3300009545 | Bacteria | 4121 |
| 82 | Ga0105237_10167684 | 3300009545 | Bacteria | 2195 |
| 83 | Ga0105237_10268788 | 3300009545 | Bacteria | 1708 |
| 84 | Ga0105238_10025004 | 3300009551 | Bacteria | 6088 |
| 85 | Ga0105238_10031235 | 3300009551 | Bacteria | 5422 |
| 86 | Ga0105238_10334687 | 3300009551 | Bacteria | 1501 |
| 87 | Ga0105238_10548353 | 3300009551 | Bacteria | 1160 |
| 88 | Ga0105249_10542201 | 3300009553 | Bacteria | 1213 |
| 89 | Ga0105239_10000225 | 3300010375 | Bacteria | 83296 |
| 90 | Ga0157369_10118825 | 3300013105 | Bacteria | 2806 |
| 91 | Ga0157369_11238445 | 3300013105 | Bacteria | 761 |
| 92 | Ga0157378_10083232 | 3300013297 | Bacteria | 2895 |
| 93 | Ga0157378_10317239 | 3300013297 | Bacteria | 1513 |
| 94 | Ga0157378_10869234 | 3300013297 | Bacteria | 931 |
| 95 | Ga0163162_10175793 | 3300013306 | Bacteria | 2266 |
| 96 | Ga0163162_11853220 | 3300013306 | Bacteria | 690 |
| 97 | Ga0157372_10097860 | 3300013307 | Bacteria | 3347 |
| 98 | Ga0157375_10884706 | 3300013308 | Bacteria | 1038 |
| 99 | Ga0157375_12205589 | 3300013308 | Unclassified | 656 |
| 100 | Ga0163163_10338762 | 3300014325 | Bacteria | 1559 |
| 101 | Ga0163163_10742105 | 3300014325 | Bacteria | 1045 |
| 102 | Ga0157379_10219114 | 3300014968 | Bacteria | 1724 |
| 103 | Ga0157376_10094022 | 3300014969 | Unclassified | 2604 |
| 104 | Ga0157376_10111727 | 3300014969 | Bacteria | 2406 |
| 105 | Ga0157376_10203401 | 3300014969 | Unclassified | 1824 |
| 106 | Ga0163161_10205875 | 3300017792 | Bacteria | 1518 |
| 107 | Ga0207680_10647615 | 3300025903 | Unclassified | 756 |
| 108 | Ga0207705_10332176 | 3300025909 | Bacteria | 1169 |
| 109 | Ga0207654_10056089 | 3300025911 | Bacteria | 2284 |
| 110 | Ga0207707_10323411 | 3300025912 | Bacteria | 1331 |
| 111 | Ga0207695_10000868 | 3300025913 | Bacteria | 55031 |
| 112 | Ga0207695_10051232 | 3300025913 | Bacteria | 4337 |
| 113 | Ga0207671_10092468 | 3300025914 | Bacteria | 2281 |
| 114 | Ga0207671_10182022 | 3300025914 | Bacteria | 1636 |
| 115 | Ga0207660_10082332 | 3300025917 | Bacteria | 2367 |
| 116 | Ga0207652_10071859 | 3300025921 | Bacteria | 3008 |
| 117 | Ga0207652_10638905 | 3300025921 | Bacteria | 952 |
| 118 | Ga0207681_10760085 | 3300025923 | Unclassified | 808 |
| 119 | Ga0207694_10112216 | 3300025924 | Bacteria | 2169 |
| 120 | Ga0207694_10275280 | 3300025924 | Bacteria | 1381 |
| 121 | Ga0207694_10465622 | 3300025924 | Bacteria | 1056 |
| 122 | Ga0207687_10164994 | 3300025927 | Bacteria | 1703 |
| 123 | Ga0207706_10040036 | 3300025933 | Bacteria | 4154 |
| 124 | Ga0207686_10028139 | 3300025934 | Bacteria | 3300 |
| 125 | Ga0207686_10984277 | 3300025934 | Unclassified | 684 |
| 126 | Ga0207711_10144873 | 3300025941 | Bacteria | 2140 |
| 127 | Ga0207689_10157454 | 3300025942 | Bacteria | 1872 |
| 128 | Ga0207689_10390589 | 3300025942 | Bacteria | 1159 |
| 129 | Ga0207661_10879533 | 3300025944 | Unclassified | 825 |
| 130 | Ga0207679_10214855 | 3300025945 | Bacteria | 1615 |
| 131 | Ga0207667_10299077 | 3300025949 | Bacteria | 1644 |
| 132 | Ga0207703_10188935 | 3300026035 | Bacteria | 1823 |
| 133 | Ga0207702_11561645 | 3300026078 | Bacteria | 653 |
| 134 | Ga0207641_10063329 | 3300026088 | Bacteria | 3159 |
| 135 | Ga0207641_10112647 | 3300026088 | Bacteria | 2414 |
| 136 | Ga0207676_10002050 | 3300026095 | Bacteria | 14622 |
| 137 | Ga0207676_10141764 | 3300026095 | Bacteria | 2058 |
| 138 | Ga0207676_11204350 | 3300026095 | Unclassified | 751 |
| 139 | Ga0207675_100253460 | 3300026118 | Bacteria | 1704 |
| 140 | Ga0207698_10421777 | 3300026142 | Bacteria | 1280 |
| 141 | Ga0207698_10431804 | 3300026142 | Bacteria | 1267 |
| 142 | Ga0268264_11765145 | 3300028381 | Bacteria | 629 |
| 143 | Ga0307517_10000710 | 3300028786 | Bacteria | 57392 |
| 144 | Ga0307517_10048038 | 3300028786 | Bacteria | 4405 |
| 145 | Ga0307513_10005771 | 3300031456 | Bacteria | 16278 |
| 146 | Ga0307414_11999603 | 3300032004 | Unclassified | 541 |
| 147 | Ga0307510_10069053 | 3300033180 | Bacteria | 3542 |
| 148 | Ga0373928_0100023 | 3300035084 | Unclassified | 755 |
| 149 | Ga0373944_0059234 | 3300035089 | Bacteria | 1225 |
| 150 | Ga0373952_0065705 | 3300035092 | Unclassified | 897 |
| 151 | Ga0373952_0126499 | 3300035092 | Unclassified | 698 |
| 152 | Ga0373941_0179720 | 3300035115 | Unclassified | 793 |
| 153 | Ga0373953_0255172 | 3300035117 | Unclassified | 762 |
| 154 | Ga0373931_0041007 | 3300035691 | Bacteria | 2431 |
| 155 | Ga0373931_0360079 | 3300035691 | Unclassified | 913 |
| 156 | Ga0373937_0041649 | 3300036401 | Bacteria | 4189 |
| 157 | Ga0373925_0462437 | 3300037068 | Bacteria | 1040 |
| 158 | Ga0395898_0353015 | 3300037466 | Bacteria | 1402 |
| 159 | Ga0395905_0279440 | 3300037471 | Bacteria | 1556 |
| 160 | Ga0395905_0351669 | 3300037471 | Bacteria | 1366 |
| 161 | Ga0395905_0694012 | 3300037471 | Bacteria | 920 |
| 162 | Ga0466963_0791461 | 3300044694 | Bacteria | 669 |
| 163 | Ga0495592_0078906 | 3300046454 | Bacteria | 2384 |
| 164 | Ga0495651_0167347 | 3300046462 | Bacteria | 1569 |
| 165 | Ga0495582_0620176 | 3300046473 | Bacteria | 626 |
| 166 | Ga0495605_0402711 | 3300046474 | Bacteria | 569 |
| 167 | Ga0495584_0541860 | 3300046491 | Bacteria | 593 |
| 168 | Ga0495585_0428570 | 3300046492 | Bacteria | 635 |
| 169 | Ga0495583_0045922 | 3300046506 | Bacteria | 2017 |
| 170 | Ga0495608_0052764 | 3300046511 | Bacteria | 2691 |
| 171 | Ga0495618_0063569 | 3300046514 | Bacteria | 2344 |
| 172 | Ga0495628_0122701 | 3300046516 | Bacteria | 1992 |
| 173 | Ga0495663_0107645 | 3300046525 | Bacteria | 924 |
| 174 | Ga0495642_0145078 | 3300046528 | Bacteria | 1025 |
| 175 | Ga0495652_0511750 | 3300046529 | Bacteria | 831 |
| 176 | Ga0495621_0298397 | 3300046539 | Unclassified | 667 |
| 177 | Ga0495611_0024082 | 3300046648 | Bacteria | 2646 |
| 178 | Ga0495599_0259026 | 3300046678 | Bacteria | 1057 |
| 179 | Ga0495658_0155737 | 3300046683 | Unclassified | 1406 |
| 180 | Ga0495658_0223116 | 3300046683 | Bacteria | 1180 |
| 181 | Ga0495658_0780982 | 3300046683 | Unclassified | 611 |
| 182 | Ga0495669_0508079 | 3300046684 | Bacteria | 586 |
| 183 | Ga0495613_0104987 | 3300046689 | Bacteria | 2040 |
| 184 | Ga0495624_0110360 | 3300046690 | Bacteria | 1692 |
| 185 | Ga0495581_0475330 | 3300047315 | Bacteria | 727 |
| 186 | Ga0495636_0147121 | 3300047318 | Archaea | 1055 |
| 187 | Ga0495636_0178276 | 3300047318 | Bacteria | 963 |
| 188 | Ga0495636_0345979 | 3300047318 | Unclassified | 701 |
| 189 | Ga0495674_0026632 | 3300047319 | Bacteria | 5291 |
| 190 | Ga0495674_1372248 | 3300047319 | Bacteria | 528 |
| 191 | Ga0495677_0089866 | 3300047445 | Bacteria | 1157 |
| 192 | Ga0495684_0062479 | 3300047471 | Bacteria | 2833 |
| 193 | Ga0495686_0136929 | 3300047472 | Bacteria | 1448 |
| 194 | Ga0495602_0285736 | 3300048088 | Unclassified | 1213 |
| 195 | Ga0496101_0753289 | 3300048904 | Bacteria | 768 |
| 196 | Ga0496102_0021425 | 3300048905 | Bacteria | 5716 |
| 197 | Ga0496103_0290392 | 3300048906 | Bacteria | 1052 |
| 198 | Ga0496104_0083147 | 3300048907 | Bacteria | 3053 |
| 199 | Ga0496108_0046668 | 3300048911 | Bacteria | 3620 |
| 200 | Ga0496109_0001775 | 3300048912 | Bacteria | 17923 |
| 201 | Ga0496112_0397280 | 3300048915 | Bacteria | 1318 |
| 202 | Ga0496113_0444140 | 3300048916 | Bacteria | 1042 |
| 203 | Ga0496115_0308557 | 3300048918 | Bacteria | 1296 |
| 204 | Ga0501033_0148039 | 3300049570 | Unclassified | 1695 |
| 205 | Ga0501037_0271252 | 3300049573 | Unclassified | 1184 |
| 206 | Ga0501043_0080006 | 3300049579 | Bacteria | 2568 |
| 207 | Ga0501047_0613063 | 3300049581 | Bacteria | 909 |
| 208 | Ga0501044_0022243 | 3300049823 | Bacteria | 6757 |
| 209 | nmdc:mga05p37_1051956_c1 | 3300050507 | Unclassified | 858 |
| 210 | nmdc:mga05p37_148462_c1 | 3300050507 | Unclassified | 2869 |
| 211 | nmdc:mga05p37_354438_c1 | 3300050507 | Unclassified | 1727 |
| 212 | nmdc:mga09592_1111477_c1 | 3300050508 | Bacteria | 657 |
| 213 | nmdc:mga09592_133213_c1 | 3300050508 | Unclassified | 2140 |
| 214 | nmdc:mga09592_31163_c1 | 3300050508 | Unclassified | 4441 |
| 215 | nmdc:mga0qj67_209571_c1 | 3300050509 | Bacteria | 1583 |
| 216 | nmdc:mga06r32_161629_c1 | 3300050510 | Bacteria | 2222 |
| 217 | nmdc:mga06r32_1630927_c1 | 3300050510 | Unclassified | 583 |
| 218 | nmdc:mga06r32_18765_c1 | 3300050510 | Bacteria | 6338 |
| 219 | nmdc:mga06r32_572440_c1 | 3300050510 | Bacteria | 1102 |
| 220 | nmdc:mga06r32_666284_c1 | 3300050510 | Unclassified | 1008 |
| 221 | nmdc:mga08y16_293933_c1 | 3300050511 | Bacteria | 1675 |
| 222 | nmdc:mga08y16_568598_c1 | 3300050511 | Unclassified | 1146 |
| 223 | nmdc:mga0n895_388341_c1 | 3300050512 | Unclassified | 1412 |
| 224 | nmdc:mga0n895_557696_c1 | 3300050512 | Bacteria | 1151 |
| 225 | nmdc:mga0rr50_68637_c1 | 3300050513 | Unclassified | 2696 |
| 226 | nmdc:mga08x19_757309_c1 | 3300050514 | Bacteria | 689 |
| 227 | nmdc:mga0a205_203620_c1 | 3300050515 | Bacteria | 1869 |
| 228 | nmdc:mga0a205_398781_c1 | 3300050515 | Unclassified | 1239 |
| 229 | Ga0495601_0193981 | 3300053077 | Bacteria | 1327 |
| 230 | Ga0495595_0547815 | 3300053084 | Bacteria | 591 |
| 231 | Ga0495619_0159906 | 3300053085 | Bacteria | 1555 |
| 232 | Ga0587077_105654 | 3300059493 | Bacteria | 683 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10747120 | Ga0114129_107471202 | 125 |
| 2 | 3300005330 | Ga0070690_100708955 | Ga0070690_1007089552 | 127 |
| 3 | 3300005343 | Ga0070687_100526127 | Ga0070687_1005261272 | 127 |
| 4 | 3300005617 | Ga0068859_100564732 | Ga0068859_1005647321 | 127 |
| 5 | 3300006358 | Ga0068871_100700351 | Ga0068871_1007003511 | 127 |
| 6 | 3300006931 | Ga0097620_100564643 | Ga0097620_1005646432 | 127 |
| 7 | 3300025903 | Ga0207680_10647615 | Ga0207680_106476152 | 127 |
| 8 | 3300037471 | Ga0395905_0279440 | Ga0395905_0279440_136_582 | 127 |
| 9 | 3300037471 | Ga0395905_0351669 | Ga0395905_0351669_561_1007 | 127 |
| 10 | 3300050514 | nmdc:mga08x19_757309_c1 | nmdc:mga08x19_757309_c1_131_586 | 127 |
| 11 | 3300037471 | Ga0395905_0694012 | Ga0395905_0694012_299_745 | 129 |
| 12 | 3300005340 | Ga0070689_101442685 | Ga0070689_1014426851 | 130 |
| 13 | 3300005364 | Ga0070673_100248900 | Ga0070673_1002489002 | 130 |
| 14 | 3300005439 | Ga0070711_100091912 | Ga0070711_1000919123 | 130 |
| 15 | 3300013297 | Ga0157378_10317239 | Ga0157378_103172392 | 130 |
| 16 | 3300028786 | Ga0307517_10000710 | Ga0307517_1000071051 | 130 |
| 17 | 3300031456 | Ga0307513_10005771 | Ga0307513_100057717 | 130 |
| 18 | 3300047319 | Ga0495674_1372248 | Ga0495674_1372248_19_501 | 131 |
| 19 | 3300050515 | nmdc:mga0a205_398781_c1 | nmdc:mga0a205_398781_c1_371_787 | 131 |
| 20 | 3300009147 | Ga0114129_10049618 | Ga0114129_100496184 | 132 |
| 21 | 3300009176 | Ga0105242_10259066 | Ga0105242_102590662 | 132 |
| 22 | 3300013306 | Ga0163162_10175793 | Ga0163162_101757932 | 132 |
| 23 | 3300013308 | Ga0157375_10884706 | Ga0157375_108847062 | 132 |
| 24 | 3300014969 | Ga0157376_10111727 | Ga0157376_101117273 | 132 |
| 25 | 3300014969 | Ga0157376_10203401 | Ga0157376_102034012 | 132 |
| 26 | 3300025934 | Ga0207686_10028139 | Ga0207686_100281392 | 132 |
| 27 | 3300050507 | nmdc:mga05p37_148462_c1 | nmdc:mga05p37_148462_c1_592_999 | 132 |
| 28 | 3300050508 | nmdc:mga09592_133213_c1 | nmdc:mga09592_133213_c1_788_1195 | 132 |
| 29 | 3300050509 | nmdc:mga0qj67_209571_c1 | nmdc:mga0qj67_209571_c1_406_813 | 132 |
| 30 | 3300050510 | nmdc:mga06r32_18765_c1 | nmdc:mga06r32_18765_c1_5253_5660 | 132 |
| 31 | 3300035117 | Ga0373953_0255172 | Ga0373953_0255172_129_551 | 133 |
| 32 | 3300005353 | Ga0070669_100923365 | Ga0070669_1009233651 | 134 |
| 33 | 3300009094 | Ga0111539_10290031 | Ga0111539_102900311 | 134 |
| 34 | 3300025923 | Ga0207681_10760085 | Ga0207681_107600851 | 134 |
| 35 | 3300032004 | Ga0307414_11999603 | Ga0307414_119996032 | 134 |
| 36 | 3300046683 | Ga0495658_0780982 | Ga0495658_0780982_13_417 | 134 |
| 37 | 3300005295 | Ga0065707_10453227 | Ga0065707_104532271 | 135 |
| 38 | 3300005471 | Ga0070698_100702077 | Ga0070698_1007020772 | 135 |
| 39 | 3300005518 | Ga0070699_100653928 | Ga0070699_1006539281 | 135 |
| 40 | 3300006237 | Ga0097621_100654353 | Ga0097621_1006543532 | 135 |
| 41 | 3300006844 | Ga0075428_100014314 | Ga0075428_1000143146 | 135 |
| 42 | 3300006880 | Ga0075429_100008946 | Ga0075429_1000089462 | 135 |
| 43 | 3300009094 | Ga0111539_10042011 | Ga0111539_100420114 | 135 |
| 44 | 3300013297 | Ga0157378_10083232 | Ga0157378_100832322 | 135 |
| 45 | 3300014969 | Ga0157376_10094022 | Ga0157376_100940222 | 135 |
| 46 | 3300026118 | Ga0207675_100253460 | Ga0207675_1002534602 | 135 |
| 47 | 3300046539 | Ga0495621_0298397 | Ga0495621_0298397_244_651 | 135 |
| 48 | 3300047318 | Ga0495636_0147121 | Ga0495636_0147121_621_1028 | 135 |
| 49 | 3300050511 | nmdc:mga08y16_293933_c1 | nmdc:mga08y16_293933_c1_994_1401 | 135 |
| 50 | 3300050515 | nmdc:mga0a205_203620_c1 | nmdc:mga0a205_203620_c1_528_935 | 135 |
| 51 | 3300005444 | Ga0070694_100278129 | Ga0070694_1002781292 | 136 |
| 52 | 3300006844 | Ga0075428_100425989 | Ga0075428_1004259892 | 136 |
| 53 | 3300006871 | Ga0075434_100406677 | Ga0075434_1004066772 | 136 |
| 54 | 3300009094 | Ga0111539_10089858 | Ga0111539_100898582 | 136 |
| 55 | 3300009147 | Ga0114129_11107317 | Ga0114129_111073172 | 136 |
| 56 | 3300013308 | Ga0157375_12205589 | Ga0157375_122055892 | 136 |
| 57 | 3300025942 | Ga0207689_10390589 | Ga0207689_103905892 | 136 |
| 58 | 3300035092 | Ga0373952_0065705 | Ga0373952_0065705_223_633 | 136 |
| 59 | 3300050510 | nmdc:mga06r32_572440_c1 | nmdc:mga06r32_572440_c1_441_851 | 136 |
| 60 | 3300050511 | nmdc:mga08y16_568598_c1 | nmdc:mga08y16_568598_c1_691_1101 | 136 |
| 61 | 3300050512 | nmdc:mga0n895_388341_c1 | nmdc:mga0n895_388341_c1_128_538 | 136 |
| 62 | 3300006847 | Ga0075431_100060414 | Ga0075431_1000604143 | 137 |
| 63 | 3300006880 | Ga0075429_101146859 | Ga0075429_1011468592 | 137 |
| 64 | 3300009176 | Ga0105242_10973706 | Ga0105242_109737062 | 137 |
| 65 | 3300025934 | Ga0207686_10984277 | Ga0207686_109842772 | 137 |
| 66 | 3300026095 | Ga0207676_11204350 | Ga0207676_112043502 | 137 |
| 67 | 3300035084 | Ga0373928_0100023 | Ga0373928_0100023_80_496 | 137 |
| 68 | 3300035092 | Ga0373952_0126499 | Ga0373952_0126499_108_524 | 137 |
| 69 | 3300035115 | Ga0373941_0179720 | Ga0373941_0179720_128_544 | 137 |
| 70 | 3300035691 | Ga0373931_0041007 | Ga0373931_0041007_1824_2240 | 137 |
| 71 | 3300046683 | Ga0495658_0155737 | Ga0495658_0155737_742_1155 | 137 |
| 72 | 3300047318 | Ga0495636_0345979 | Ga0495636_0345979_58_471 | 137 |
| 73 | 3300048088 | Ga0495602_0285736 | Ga0495602_0285736_649_1161 | 137 |
| 74 | 3300048906 | Ga0496103_0290392 | Ga0496103_0290392_229_675 | 137 |
| 75 | 3300050510 | nmdc:mga06r32_161629_c1 | nmdc:mga06r32_161629_c1_977_1390 | 137 |
| 76 | 3300004803 | Ga0058862_11961652 | Ga0058862_119616521 | 138 |
| 77 | 3300005334 | Ga0068869_100504372 | Ga0068869_1005043721 | 138 |
| 78 | 3300005536 | Ga0070697_101455385 | Ga0070697_1014553851 | 138 |
| 79 | 3300006844 | Ga0075428_100153284 | Ga0075428_1001532842 | 138 |
| 80 | 3300006844 | Ga0075428_100223215 | Ga0075428_1002232152 | 138 |
| 81 | 3300006844 | Ga0075428_100256582 | Ga0075428_1002565821 | 138 |
| 82 | 3300006846 | Ga0075430_100302080 | Ga0075430_1003020802 | 138 |
| 83 | 3300006847 | Ga0075431_100449701 | Ga0075431_1004497012 | 138 |
| 84 | 3300006847 | Ga0075431_100897021 | Ga0075431_1008970211 | 138 |
| 85 | 3300006847 | Ga0075431_100976231 | Ga0075431_1009762312 | 138 |
| 86 | 3300006871 | Ga0075434_101219303 | Ga0075434_1012193031 | 138 |
| 87 | 3300006880 | Ga0075429_100044638 | Ga0075429_1000446381 | 138 |
| 88 | 3300006880 | Ga0075429_100067428 | Ga0075429_1000674282 | 138 |
| 89 | 3300007076 | Ga0075435_100076016 | Ga0075435_1000760164 | 138 |
| 90 | 3300009147 | Ga0114129_10273371 | Ga0114129_102733713 | 138 |
| 91 | 3300009147 | Ga0114129_10733555 | Ga0114129_107335552 | 138 |
| 92 | 3300009147 | Ga0114129_10880687 | Ga0114129_108806872 | 138 |
| 93 | 3300009147 | Ga0114129_11053941 | Ga0114129_110539412 | 138 |
| 94 | 3300014325 | Ga0163163_10338762 | Ga0163163_103387622 | 138 |
| 95 | 3300035691 | Ga0373931_0360079 | Ga0373931_0360079_324_740 | 138 |
| 96 | 3300048907 | Ga0496104_0083147 | Ga0496104_0083147_2456_2872 | 138 |
| 97 | 3300049570 | Ga0501033_0148039 | Ga0501033_0148039_111_551 | 138 |
| 98 | 3300049573 | Ga0501037_0271252 | Ga0501037_0271252_89_529 | 138 |
| 99 | 3300049579 | Ga0501043_0080006 | Ga0501043_0080006_598_1038 | 138 |
| 100 | 3300049581 | Ga0501047_0613063 | Ga0501047_0613063_364_804 | 138 |
| 101 | 3300049823 | Ga0501044_0022243 | Ga0501044_0022243_5953_6393 | 138 |
| 102 | 3300050507 | nmdc:mga05p37_1051956_c1 | nmdc:mga05p37_1051956_c1_32_448 | 138 |
| 103 | 3300050507 | nmdc:mga05p37_354438_c1 | nmdc:mga05p37_354438_c1_1177_1593 | 138 |
| 104 | 3300050508 | nmdc:mga09592_1111477_c1 | nmdc:mga09592_1111477_c1_107_523 | 138 |
| 105 | 3300050508 | nmdc:mga09592_31163_c1 | nmdc:mga09592_31163_c1_2042_2458 | 138 |
| 106 | 3300050510 | nmdc:mga06r32_1630927_c1 | nmdc:mga06r32_1630927_c1_96_512 | 138 |
| 107 | 3300050510 | nmdc:mga06r32_666284_c1 | nmdc:mga06r32_666284_c1_239_655 | 138 |
| 108 | 3300050512 | nmdc:mga0n895_557696_c1 | nmdc:mga0n895_557696_c1_596_1012 | 138 |
| 109 | 3300050513 | nmdc:mga0rr50_68637_c1 | nmdc:mga0rr50_68637_c1_261_677 | 138 |
| 110 | 3300009094 | Ga0111539_12008325 | Ga0111539_120083251 | 139 |
| 111 | 3300009545 | Ga0105237_10268788 | Ga0105237_102687882 | 139 |
| 112 | 3300009551 | Ga0105238_10031235 | Ga0105238_100312354 | 139 |
| 113 | 3300014968 | Ga0157379_10219114 | Ga0157379_102191144 | 139 |
| 114 | 3300025914 | Ga0207671_10182022 | Ga0207671_101820222 | 139 |
| 115 | 3300025924 | Ga0207694_10275280 | Ga0207694_102752802 | 139 |
| 116 | 3300035089 | Ga0373944_0059234 | Ga0373944_0059234_277_735 | 139 |
| 117 | 3300036401 | Ga0373937_0041649 | Ga0373937_0041649_2807_3265 | 139 |
| 118 | 3300037068 | Ga0373925_0462437 | Ga0373925_0462437_11_469 | 139 |
| 119 | 3300046454 | Ga0495592_0078906 | Ga0495592_0078906_828_1286 | 139 |
| 120 | 3300046462 | Ga0495651_0167347 | Ga0495651_0167347_977_1435 | 139 |
| 121 | 3300046511 | Ga0495608_0052764 | Ga0495608_0052764_1150_1608 | 139 |
| 122 | 3300046514 | Ga0495618_0063569 | Ga0495618_0063569_1865_2323 | 139 |
| 123 | 3300046516 | Ga0495628_0122701 | Ga0495628_0122701_334_792 | 139 |
| 124 | 3300046529 | Ga0495652_0511750 | Ga0495652_0511750_197_652 | 139 |
| 125 | 3300046678 | Ga0495599_0259026 | Ga0495599_0259026_392_850 | 139 |
| 126 | 3300046683 | Ga0495658_0223116 | Ga0495658_0223116_411_869 | 139 |
| 127 | 3300046689 | Ga0495613_0104987 | Ga0495613_0104987_1090_1548 | 139 |
| 128 | 3300046690 | Ga0495624_0110360 | Ga0495624_0110360_344_802 | 139 |
| 129 | 3300047315 | Ga0495581_0475330 | Ga0495581_0475330_95_553 | 139 |
| 130 | 3300047319 | Ga0495674_0026632 | Ga0495674_0026632_2243_2701 | 139 |
| 131 | 3300047471 | Ga0495684_0062479 | Ga0495684_0062479_1816_2274 | 139 |
| 132 | 3300053077 | Ga0495601_0193981 | Ga0495601_0193981_137_595 | 139 |
| 133 | 3300053084 | Ga0495595_0547815 | Ga0495595_0547815_88_546 | 139 |
| 134 | 3300053085 | Ga0495619_0159906 | Ga0495619_0159906_15_473 | 139 |
| 135 | 3300009177 | Ga0105248_10185346 | Ga0105248_101853462 | 140 |
| 136 | 3300028786 | Ga0307517_10048038 | Ga0307517_100480382 | 140 |
| 137 | 3300046492 | Ga0495585_0428570 | Ga0495585_0428570_126_578 | 140 |
| 138 | 3300046506 | Ga0495583_0045922 | Ga0495583_0045922_1103_1558 | 140 |
| 139 | 3300046648 | Ga0495611_0024082 | Ga0495611_0024082_660_1115 | 140 |
| 140 | 3300046684 | Ga0495669_0508079 | Ga0495669_0508079_98_553 | 140 |
| 141 | 3300047472 | Ga0495686_0136929 | Ga0495686_0136929_451_906 | 140 |
| 142 | 3300004799 | Ga0058863_11587917 | Ga0058863_115879171 | 142 |
| 143 | 3300004799 | Ga0058863_11789072 | Ga0058863_117890721 | 142 |
| 144 | 3300004800 | Ga0058861_10032529 | Ga0058861_100325291 | 142 |
| 145 | 3300005293 | Ga0065715_10614613 | Ga0065715_106146131 | 142 |
| 146 | 3300005327 | Ga0070658_10253446 | Ga0070658_102534461 | 142 |
| 147 | 3300005336 | Ga0070680_100080610 | Ga0070680_1000806101 | 142 |
| 148 | 3300005336 | Ga0070680_100421962 | Ga0070680_1004219622 | 142 |
| 149 | 3300005338 | Ga0068868_100498084 | Ga0068868_1004980842 | 142 |
| 150 | 3300005355 | Ga0070671_100135838 | Ga0070671_1001358382 | 142 |
| 151 | 3300005364 | Ga0070673_100061532 | Ga0070673_1000615324 | 142 |
| 152 | 3300005367 | Ga0070667_100383053 | Ga0070667_1003830531 | 142 |
| 153 | 3300005456 | Ga0070678_100282275 | Ga0070678_1002822752 | 142 |
| 154 | 3300005457 | Ga0070662_100030301 | Ga0070662_1000303012 | 142 |
| 155 | 3300005458 | Ga0070681_10056623 | Ga0070681_100566235 | 142 |
| 156 | 3300005530 | Ga0070679_100769598 | Ga0070679_1007695981 | 142 |
| 157 | 3300005535 | Ga0070684_100066925 | Ga0070684_1000669253 | 142 |
| 158 | 3300005539 | Ga0068853_100145505 | Ga0068853_1001455052 | 142 |
| 159 | 3300005563 | Ga0068855_100207636 | Ga0068855_1002076362 | 142 |
| 160 | 3300005563 | Ga0068855_100240428 | Ga0068855_1002404282 | 142 |
| 161 | 3300005578 | Ga0068854_101040363 | Ga0068854_1010403632 | 142 |
| 162 | 3300005616 | Ga0068852_100023421 | Ga0068852_1000234217 | 142 |
| 163 | 3300005616 | Ga0068852_100609305 | Ga0068852_1006093052 | 142 |
| 164 | 3300005618 | Ga0068864_100013399 | Ga0068864_1000133993 | 142 |
| 165 | 3300005841 | Ga0068863_100065854 | Ga0068863_1000658542 | 142 |
| 166 | 3300005841 | Ga0068863_100136385 | Ga0068863_1001363853 | 142 |
| 167 | 3300005843 | Ga0068860_101297118 | Ga0068860_1012971181 | 142 |
| 168 | 3300006881 | Ga0068865_100623401 | Ga0068865_1006234011 | 142 |
| 169 | 3300009093 | Ga0105240_10000463 | Ga0105240_1000046359 | 142 |
| 170 | 3300009093 | Ga0105240_10211699 | Ga0105240_102116992 | 142 |
| 171 | 3300009174 | Ga0105241_10038924 | Ga0105241_100389243 | 142 |
| 172 | 3300009176 | Ga0105242_10088239 | Ga0105242_100882392 | 142 |
| 173 | 3300009177 | Ga0105248_10354167 | Ga0105248_103541672 | 142 |
| 174 | 3300009545 | Ga0105237_10051854 | Ga0105237_100518543 | 142 |
| 175 | 3300009545 | Ga0105237_10167684 | Ga0105237_101676842 | 142 |
| 176 | 3300009551 | Ga0105238_10025004 | Ga0105238_100250046 | 142 |
| 177 | 3300009551 | Ga0105238_10334687 | Ga0105238_103346872 | 142 |
| 178 | 3300009551 | Ga0105238_10548353 | Ga0105238_105483532 | 142 |
| 179 | 3300009553 | Ga0105249_10542201 | Ga0105249_105422012 | 142 |
| 180 | 3300010375 | Ga0105239_10000225 | Ga0105239_1000022553 | 142 |
| 181 | 3300013105 | Ga0157369_10118825 | Ga0157369_101188252 | 142 |
| 182 | 3300013105 | Ga0157369_11238445 | Ga0157369_112384451 | 142 |
| 183 | 3300013297 | Ga0157378_10869234 | Ga0157378_108692342 | 142 |
| 184 | 3300013306 | Ga0163162_11853220 | Ga0163162_118532201 | 142 |
| 185 | 3300013307 | Ga0157372_10097860 | Ga0157372_100978602 | 142 |
| 186 | 3300014325 | Ga0163163_10742105 | Ga0163163_107421052 | 142 |
| 187 | 3300017792 | Ga0163161_10205875 | Ga0163161_102058751 | 142 |
| 188 | 3300025909 | Ga0207705_10332176 | Ga0207705_103321762 | 142 |
| 189 | 3300025911 | Ga0207654_10056089 | Ga0207654_100560892 | 142 |
| 190 | 3300025912 | Ga0207707_10323411 | Ga0207707_103234112 | 142 |
| 191 | 3300025913 | Ga0207695_10000868 | Ga0207695_1000086847 | 142 |
| 192 | 3300025913 | Ga0207695_10051232 | Ga0207695_100512324 | 142 |
| 193 | 3300025914 | Ga0207671_10092468 | Ga0207671_100924682 | 142 |
| 194 | 3300025917 | Ga0207660_10082332 | Ga0207660_100823323 | 142 |
| 195 | 3300025921 | Ga0207652_10071859 | Ga0207652_100718592 | 142 |
| 196 | 3300025921 | Ga0207652_10638905 | Ga0207652_106389052 | 142 |
| 197 | 3300025924 | Ga0207694_10112216 | Ga0207694_101122162 | 142 |
| 198 | 3300025924 | Ga0207694_10465622 | Ga0207694_104656221 | 142 |
| 199 | 3300025927 | Ga0207687_10164994 | Ga0207687_101649942 | 142 |
| 200 | 3300025933 | Ga0207706_10040036 | Ga0207706_100400362 | 142 |
| 201 | 3300025941 | Ga0207711_10144873 | Ga0207711_101448732 | 142 |
| 202 | 3300025942 | Ga0207689_10157454 | Ga0207689_101574542 | 142 |
| 203 | 3300025944 | Ga0207661_10879533 | Ga0207661_108795331 | 142 |
| 204 | 3300025945 | Ga0207679_10214855 | Ga0207679_102148552 | 142 |
| 205 | 3300025949 | Ga0207667_10299077 | Ga0207667_102990772 | 142 |
| 206 | 3300026035 | Ga0207703_10188935 | Ga0207703_101889352 | 142 |
| 207 | 3300026078 | Ga0207702_11561645 | Ga0207702_115616451 | 142 |
| 208 | 3300026088 | Ga0207641_10063329 | Ga0207641_100633294 | 142 |
| 209 | 3300026088 | Ga0207641_10112647 | Ga0207641_101126472 | 142 |
| 210 | 3300026095 | Ga0207676_10002050 | Ga0207676_1000205010 | 142 |
| 211 | 3300026095 | Ga0207676_10141764 | Ga0207676_101417642 | 142 |
| 212 | 3300026142 | Ga0207698_10421777 | Ga0207698_104217772 | 142 |
| 213 | 3300026142 | Ga0207698_10431804 | Ga0207698_104318042 | 142 |
| 214 | 3300028381 | Ga0268264_11765145 | Ga0268264_117651451 | 142 |
| 215 | 3300033180 | Ga0307510_10069053 | Ga0307510_100690535 | 142 |
| 216 | 3300037466 | Ga0395898_0353015 | Ga0395898_0353015_91_552 | 142 |
| 217 | 3300044694 | Ga0466963_0791461 | Ga0466963_0791461_46_501 | 142 |
| 218 | 3300046473 | Ga0495582_0620176 | Ga0495582_0620176_35_496 | 142 |
| 219 | 3300046474 | Ga0495605_0402711 | Ga0495605_0402711_78_533 | 142 |
| 220 | 3300046491 | Ga0495584_0541860 | Ga0495584_0541860_13_474 | 142 |
| 221 | 3300046525 | Ga0495663_0107645 | Ga0495663_0107645_251_712 | 142 |
| 222 | 3300046528 | Ga0495642_0145078 | Ga0495642_0145078_388_849 | 142 |
| 223 | 3300047318 | Ga0495636_0178276 | Ga0495636_0178276_101_562 | 142 |
| 224 | 3300047445 | Ga0495677_0089866 | Ga0495677_0089866_159_620 | 142 |
| 225 | 3300048904 | Ga0496101_0753289 | Ga0496101_0753289_216_677 | 142 |
| 226 | 3300048905 | Ga0496102_0021425 | Ga0496102_0021425_3771_4232 | 142 |
| 227 | 3300048911 | Ga0496108_0046668 | Ga0496108_0046668_1976_2437 | 142 |
| 228 | 3300048912 | Ga0496109_0001775 | Ga0496109_0001775_6373_6834 | 142 |
| 229 | 3300048915 | Ga0496112_0397280 | Ga0496112_0397280_48_509 | 142 |
| 230 | 3300048916 | Ga0496113_0444140 | Ga0496113_0444140_520_981 | 142 |
| 231 | 3300048918 | Ga0496115_0308557 | Ga0496115_0308557_210_707 | 142 |
| 232 | 3300059493 | Ga0587077_105654 | Ga0587077_105654_79_537 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fxd-assembly1.cif.gz_A | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.7999 | 43 | 76 |
| 4fxd-assembly2.cif.gz_B | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.798 | 43 | 76 |
| 8fok-assembly1.cif.gz_1 | cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex in the dna elongation state | 0.7929 | 44 | 76 |
| 8foc-assembly1.cif.gz_1 | cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i | 0.7719 | 42 | 76 |
| 8foe-assembly1.cif.gz_1 | cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna | 0.7685 | 42 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fxdA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.7999 | 43 | 76 | 2.40.50.730 |
| 4fxdB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.798 | 43 | 76 | 2.40.50.730 |
| af_Q9VKY7_200_296_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7871 | 46 | 80 | 2.30.29.30 |
| af_P87307_123_212_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7678 | 40 | 122 | 2.40.50.140 |
| af_Q95Y97_40_169_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7674 | 39 | 120 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y2K178-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.9639 | 22 | 130 |
|
| AF-A0A381VHI2-F1-model_v4 | Uncharacterized protein | 0.9572 | 39 | 131 |
|
| AF-A0A2V8LL89-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.9517 | 22 | 130 |
|
| AF-A0A383CUF3-F1-model_v4 | OB domain-containing protein | 0.951 | 35 | 128 |
|
| AF-A0A7Y4WDA8-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.9474 | 22 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar