F344880

General Info

Members Datasets Scaffolds Average Seq Length
232 172 222 189

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100551625|Ga0068863_1005516251
Length 200
Sequence MSASPALSESLPQVIMPKRLADGRGWFSETFSEQRLRDLGITCHFVQDNQSSSRRAGTLRGFHFQVPPGAQAKLISVLRGRILDVAIDVRSGSPTLGKHVAIELSAETGKQLYVPVGFAHGFVTLEDEVLVSYKVSDYYSPCHEGGIRWNDPEIACPWPFNDGDIIVSDKDRRLPFLNEFASPFMYDGFPLSPMAVLNVA

Samples

Sample ID Description Type Environment
1 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
2 2643221626 Ensifer sp. Root31 Isolate Unclassified
3 2643221659 Ensifer sp. Root127 Isolate Unclassified
4 2643221668 Ensifer sp. Root423 Isolate Unclassified
5 2643221723 Ensifer sp. Root278 Isolate Unclassified
6 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
7 2844163670 Ensifer sp. 1H6 Isolate Unclassified
8 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
144 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
145 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
146 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
147 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
148 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
151 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
152 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
157 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
158 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
164 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
165 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0
Endosphere 24.57
Nodule 0
Rhizoplane 3.45
Rhizosphere 58.19
Stem 0
Stem Tuber 0
Unclassified 12.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000461 3300001989 Bacteria 14302
2 JGI24735J21928_10001002 3300002067 Bacteria 10092
3 JGI24735J21928_10003910 3300002067 Bacteria 5039
4 JGI24735J21928_10021094 3300002067 Bacteria 1991
5 JGI24735J21928_10039587 3300002067 Bacteria 1378
6 JGI24034J26672_10006159 3300002239 Bacteria 1728
7 JGI25151J46595_10008133 3300003187 Bacteria 5073
8 JGI25165J46597_1000127 3300003214 Bacteria 130786
9 JGI25153J46596_10000055 3300003215 Bacteria 135518
10 rootL2_10247492 3300003322 Bacteria 2179
11 rootH1_10144411 3300003323 Bacteria 1012
12 Ga0055542_1018056 3300003762 Bacteria 1077
13 Ga0055526_1005081 3300003771 Bacteria 7680
14 Ga0055524_1018735 3300003775 Bacteria 2393
15 Ga0055530_10002834 3300003791 Bacteria 10613
16 Ga0055531_10000431 3300003794 Bacteria 39766
17 Ga0055531_10030802 3300003794 Bacteria 1791
18 Ga0070658_10000468 3300005327 Bacteria 34944
19 Ga0070658_10025890 3300005327 Bacteria 4705
20 Ga0070666_10225616 3300005335 Bacteria 1322
21 Ga0070660_100014290 3300005339 Bacteria 5717
22 Ga0070671_100382688 3300005355 Bacteria 1203
23 Ga0070659_100088271 3300005366 Bacteria 2483
24 Ga0070662_100006820 3300005457 Bacteria 7382
25 Ga0068855_100004868 3300005563 Bacteria 16395
26 Ga0070664_101035891 3300005564 Unclassified 772
27 Ga0068857_100217012 3300005577 Bacteria 1747
28 Ga0068854_100118344 3300005578 Bacteria 2007
29 Ga0068856_100237420 3300005614 Bacteria 1838
30 Ga0068852_100002843 3300005616 Bacteria 12009
31 Ga0068851_10097559 3300005834 Bacteria 1555
32 Ga0068863_100551625 3300005841 Unclassified 1138
33 Ga0081539_10032157 3300005985 Bacteria 3218
34 Ga0075362_10000173 3300006177 Bacteria 17794
35 Ga0075370_10009493 3300006353 Bacteria 5056
36 Ga0075370_10075413 3300006353 Bacteria 1933
37 Ga0075370_10090850 3300006353 Bacteria 1761
38 Ga0075370_10112301 3300006353 Bacteria 1583
39 Ga0105240_10402100 3300009093 Bacteria 1542
40 Ga0105238_10013768 3300009551 Bacteria 8175
41 Ga0105238_10233510 3300009551 Bacteria 1816
42 Ga0105239_10794716 3300010375 Bacteria 1084
43 Ga0157373_10060740 3300013100 Bacteria 2677
44 Ga0157373_10298048 3300013100 Bacteria 1144
45 Ga0157371_10000005 3300013102 Bacteria 416456
46 Ga0157369_10010626 3300013105 Bacteria 10478
47 Ga0163162_10771322 3300013306 Bacteria 1080
48 Ga0157372_10004774 3300013307 Bacteria 14398
49 Ga0157372_10585622 3300013307 Bacteria 1300
50 Ga0182008_10383576 3300014497 Unclassified 752
51 Ga0163161_10122681 3300017792 Bacteria 1954
52 Ga0207427_100843 3300025231 Bacteria 13701
53 Ga0207425_1000005 3300025245 Bacteria 900502
54 Ga0209026_1000701 3300025250 Bacteria 19900
55 Ga0209148_1000114 3300025254 Bacteria 192073
56 Ga0209148_1001207 3300025254 Bacteria 14693
57 Ga0209129_1000423 3300025258 Bacteria 32153
58 Ga0209233_1000120 3300025261 Bacteria 233311
59 Ga0209455_1001009 3300025272 Bacteria 14186
60 Ga0209455_1018040 3300025272 Bacteria 1461
61 Ga0209676_1001385 3300025292 Bacteria 23618
62 Ga0209676_1039952 3300025292 Bacteria 1326
63 Ga0209025_1000873 3300025294 Bacteria 47373
64 Ga0209564_1000929 3300025295 Bacteria 38046
65 Ga0209758_1000002 3300025297 Bacteria 1400310
66 Ga0209050_1000801 3300025298 Bacteria 44325
67 Ga0209050_1059596 3300025298 Bacteria 910
68 Ga0209256_1002847 3300025299 Bacteria 13193
69 Ga0209051_1014429 3300025303 Bacteria 3688
70 Ga0209051_1112990 3300025303 Bacteria 704
71 Ga0209257_1000558 3300025304 Bacteria 63862
72 Ga0209257_1003331 3300025304 Bacteria 13905
73 Ga0209257_1006866 3300025304 Bacteria 7147
74 Ga0209257_1012019 3300025304 Bacteria 4071
75 Ga0207688_10190293 3300025901 Bacteria 1227
76 Ga0207680_10038764 3300025903 Bacteria 2760
77 Ga0207647_10000068 3300025904 Bacteria 81240
78 Ga0207647_10002491 3300025904 Bacteria 13944
79 Ga0207647_10008585 3300025904 Bacteria 7311
80 Ga0207647_10056094 3300025904 Bacteria 2418
81 Ga0207647_10531699 3300025904 Bacteria 653
82 Ga0207645_10737175 3300025907 Bacteria 670
83 Ga0207705_10000066 3300025909 Bacteria 136520
84 Ga0207705_10005181 3300025909 Bacteria 9775
85 Ga0207657_10022364 3300025919 Bacteria 5918
86 Ga0207657_10548643 3300025919 Bacteria 904
87 Ga0207681_11007525 3300025923 Bacteria 699
88 Ga0207694_10404148 3300025924 Bacteria 1136
89 Ga0207644_10164907 3300025931 Bacteria 1725
90 Ga0207690_10030052 3300025932 Bacteria 3461
91 Ga0207706_10005052 3300025933 Bacteria 12318
92 Ga0207706_10024803 3300025933 Bacteria 5375
93 Ga0207668_10014039 3300025972 Bacteria 4952
94 Ga0207702_10022043 3300026078 Bacteria 5276
95 Ga0207674_10004922 3300026116 Bacteria 15970
96 Ga0207674_10035558 3300026116 Bacteria 5199
97 Ga0207698_10004564 3300026142 Bacteria 8451
98 Ga0207698_10060193 3300026142 Bacteria 2952
99 Ga0265326_10104986 3300028558 Bacteria 801
100 Ga0265318_10072116 3300028577 Unclassified 1280
101 Ga0265316_10067976 3300031344 Unclassified 2755
102 Ga0265314_10061870 3300031711 Bacteria 2547
103 Ga0307413_10443207 3300031824 Bacteria 1029
104 Ga0307411_10754059 3300032005 Bacteria 853
105 Ga0307415_100169244 3300032126 Bacteria 1702
106 Ga0395899_0003399 3300037312 Bacteria 12629
107 Ga0395900_0028101 3300037418 Bacteria 5760
108 Ga0395905_0086139 3300037471 Bacteria 2944
109 Ga0395901_0292624 3300038443 Bacteria 1690
110 Ga0395901_0627850 3300038443 Unclassified 1080
111 Ga0439448_0000990 3300042005 Bacteria 7066
112 Ga0439448_0003660 3300042005 Bacteria 4280
113 Ga0439448_0014023 3300042005 Bacteria 2414
114 Ga0439450_001512 3300042008 Bacteria 3418
115 Ga0439455_0001053 3300042012 Bacteria 4369
116 Ga0439455_0011480 3300042012 Bacteria 1969
117 Ga0439458_0001090 3300042157 Bacteria 6922
118 Ga0466972_0001048 3300044658 Bacteria 13268
119 Ga0466972_0130877 3300044658 Bacteria 1182
120 Ga0466965_0056099 3300044683 Bacteria 1961
121 Ga0466966_0015311 3300044684 Bacteria 5072
122 Ga0466961_0002902 3300044693 Bacteria 10636
123 Ga0466964_0008494 3300044706 Bacteria 3860
124 Ga0466971_0286567 3300044719 Bacteria 789
125 Ga0466968_0055206 3300044735 Bacteria 1704
126 Ga0466960_0018855 3300044901 Bacteria 3030
127 Ga0466959_0007122 3300045049 Bacteria 7825
128 Ga0466958_0006840 3300045836 Bacteria 6235
129 Ga0495638_0000175 3300046460 Bacteria 100036
130 Ga0495605_0036951 3300046474 Bacteria 2460
131 Ga0495583_0000033 3300046506 Bacteria 246882
132 Ga0495583_0109105 3300046506 Bacteria 1174
133 Ga0495606_0000506 3300046507 Bacteria 63276
134 Ga0495606_0020365 3300046507 Bacteria 4894
135 Ga0495632_0034990 3300046519 Bacteria 2567
136 Ga0495654_0089756 3300046530 Bacteria 1428
137 Ga0495633_0151629 3300046558 Bacteria 1070
138 Ga0495668_0021397 3300046616 Bacteria 3709
139 Ga0495611_0047568 3300046648 Bacteria 1926
140 Ga0495625_0018532 3300046660 Bacteria 5430
141 Ga0495661_0092418 3300046665 Bacteria 1719
142 Ga0495670_0250386 3300046691 Bacteria 944
143 Ga0495649_0082581 3300046694 Bacteria 1717
144 Ga0495636_0037043 3300047318 Bacteria 2014
145 Ga0495674_0339563 3300047319 Bacteria 1221
146 Ga0495687_012037 3300047443 Bacteria 4601
147 Ga0495673_0004795 3300047469 Bacteria 8367
148 Ga0495686_0000053 3300047472 Bacteria 259537
149 Ga0495686_0000430 3300047472 Bacteria 65300
150 Ga0495686_0003742 3300047472 Bacteria 12963
151 Ga0495686_0004383 3300047472 Bacteria 11637
152 Ga0496104_0338655 3300048907 Bacteria 1417
153 Ga0496106_0121928 3300048909 Bacteria 2038
154 Ga0496107_0286429 3300048910 Bacteria 1226
155 Ga0496110_1041299 3300048913 Unclassified 726
156 Ga0496111_0039198 3300048914 Bacteria 3396
157 Ga0496112_1152219 3300048915 Bacteria 693
158 Ga0496115_0015606 3300048918 Bacteria 5767
159 Ga0496116_0001869 3300048919 Bacteria 22748
160 Ga0496116_0191092 3300048919 Bacteria 1084
161 Ga0496117_0004321 3300048920 Bacteria 15804
162 Ga0496117_0130194 3300048920 Bacteria 1526
163 Ga0496117_0142169 3300048920 Bacteria 1435
164 Ga0496118_0081218 3300048921 Bacteria 2277
165 Ga0496119_0075417 3300048922 Bacteria 1960
166 Ga0496120_0035557 3300048923 Bacteria 2975
167 Ga0496120_0054333 3300048923 Bacteria 2270
168 Ga0496121_0009783 3300048924 Bacteria 10958
169 Ga0496122_0001884 3300048925 Bacteria 31769
170 Ga0496122_0006109 3300048925 Bacteria 14022
171 Ga0496122_0181848 3300048925 Bacteria 1253
172 Ga0496123_0004274 3300048926 Bacteria 15199
173 Ga0496123_0013438 3300048926 Bacteria 6875
174 Ga0496123_0057123 3300048926 Bacteria 2543
175 Ga0496123_0174958 3300048926 Bacteria 1128
176 Ga0496124_0000131 3300048927 Bacteria 156256
177 Ga0496124_0027804 3300048927 Bacteria 5067
178 Ga0496124_0074441 3300048927 Bacteria 2807
179 Ga0496125_0006998 3300048928 Bacteria 12071
180 Ga0496126_0000687 3300048929 Bacteria 61979
181 Ga0495678_021859 3300049459 Bacteria 2809
182 Ga0495682_0145810 3300049460 Bacteria 845
183 Ga0501290_000009 3300049513 Bacteria 34459
184 Ga0501300_000003 3300049523 Bacteria 46003
185 Ga0501301_000089 3300049524 Bacteria 4442
186 Ga0501206_000046 3300049653 Bacteria 11101
187 Ga0501222_000060 3300049662 Bacteria 34902
188 Ga0501222_000245 3300049662 Bacteria 9310
189 Ga0501223_000173 3300049663 Bacteria 16862
190 Ga0501223_006627 3300049663 Bacteria 2391
191 Ga0501224_001577 3300049664 Bacteria 3047
192 Ga0501227_000132 3300049665 Bacteria 13483
193 Ga0501228_000861 3300049666 Bacteria 2063
194 Ga0501233_002850 3300049668 Bacteria 3077
195 Ga0501235_002149 3300049669 Bacteria 4232
196 Ga0501225_0007513 3300049705 Bacteria 3157
197 Ga0501229_027439 3300049706 Bacteria 770
198 Ga0501280_000050 3300049776 Bacteria 34773
199 Ga0501280_001615 3300049776 Bacteria 4053
200 Ga0501282_000009 3300049778 Bacteria 33597
201 nmdc:mga07m45_4264_c1 3300050496 Bacteria 6994
202 nmdc:mga07m45_53073_c1 3300050496 Bacteria 2290
203 nmdc:mga07m45_7236_c1 3300050496 Bacteria 5661
204 nmdc:mga0sz30_237346_c1 3300050516 Unclassified 811
205 Ga0500610_0029517 3300053079 Bacteria 2772
206 Ga0500643_009473 3300053087 Bacteria 3719
207 Ga0500555_000515 3300053103 Bacteria 15513
208 Ga0500594_0093736 3300053118 Bacteria 915
209 Ga0500607_000001 3300053121 Bacteria 185408
210 Ga0500559_0000361 3300053136 Bacteria 33778
211 Ga0500559_0000971 3300053136 Bacteria 17934
212 Ga0500559_0004258 3300053136 Bacteria 6845
213 Ga0500568_0000448 3300053139 Bacteria 30974
214 Ga0500616_0000339 3300053153 Bacteria 66939
215 Ga0500616_0001524 3300053153 Bacteria 21828
216 Ga0500616_0002816 3300053153 Bacteria 13985
217 Ga0500616_0022486 3300053153 Bacteria 3519
218 Ga0500616_0040733 3300053153 Bacteria 2497
219 Ga0500622_0001922 3300053156 Bacteria 15663
220 Ga0500637_0011539 3300053178 Bacteria 4575
221 Ga0500645_000645 3300053730 Bacteria 22128
222 Ga0466962_0150902 3300061719 Bacteria 1127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028558 Ga0265326_10104986 Ga0265326_101049861 172
2 3300028577 Ga0265318_10072116 Ga0265318_100721161 172
3 3300031344 Ga0265316_10067976 Ga0265316_100679762 172
4 3300031711 Ga0265314_10061870 Ga0265314_100618702 172
5 3300005564 Ga0070664_101035891 Ga0070664_1010358911 175
6 3300025907 Ga0207645_10737175 Ga0207645_107371751 175
7 3300003187 JGI25151J46595_10008133 JGI25151J46595_100081332 180
8 3300003215 JGI25153J46596_10000055 JGI25153J46596_10000055101 180
9 3300003791 Ga0055530_10002834 Ga0055530_1000283412 180
10 3300003794 Ga0055531_10000431 Ga0055531_1000043129 180
11 3300010375 Ga0105239_10794716 Ga0105239_107947162 180
12 3300025245 Ga0207425_1000005 Ga0207425_1000005599 180
13 3300025258 Ga0209129_1000423 Ga0209129_100042317 180
14 3300025292 Ga0209676_1001385 Ga0209676_10013858 180
15 3300025294 Ga0209025_1000873 Ga0209025_100087329 180
16 3300025297 Ga0209758_1000002 Ga0209758_1000002745 180
17 3300025298 Ga0209050_1000801 Ga0209050_100080133 180
18 3300025303 Ga0209051_1014429 Ga0209051_10144293 180
19 3300025304 Ga0209257_1000558 Ga0209257_100055814 180
20 iso_pu_bacteria 2984555340 2984559166 182
21 iso_pu_bacteria 2993356040 2993359912 182
22 iso_pu_bacteria 2830075706 2830078083 183
23 3300049706 Ga0501229_027439 Ga0501229_027439_203_760 184
24 3300025972 Ga0207668_10014039 Ga0207668_100140392 185
25 3300053153 Ga0500616_0002816 Ga0500616_0002816_12105_12662 185
26 iso_pu_bacteria 2599185352 2600197809 185
27 iso_pu_bacteria 2643221626 2644144838 185
28 iso_pu_bacteria 2643221659 2644333535 185
29 iso_pu_bacteria 2643221668 2644375983 185
30 iso_pu_bacteria 2643221723 2644674411 185
31 iso_pu_bacteria 2844163670 2844165366 185
32 3300003323 rootH1_10144411 rootH1_101444111 186
33 3300005614 Ga0068856_100237420 Ga0068856_1002374202 186
34 3300005616 Ga0068852_100002843 Ga0068852_1000028437 186
35 3300005985 Ga0081539_10032157 Ga0081539_100321572 186
36 3300013306 Ga0163162_10771322 Ga0163162_107713222 186
37 3300014497 Ga0182008_10383576 Ga0182008_103835761 186
38 3300017792 Ga0163161_10122681 Ga0163161_101226812 186
39 3300025298 Ga0209050_1059596 Ga0209050_10595961 186
40 3300026078 Ga0207702_10022043 Ga0207702_100220432 186
41 3300026116 Ga0207674_10035558 Ga0207674_100355583 186
42 3300026142 Ga0207698_10004564 Ga0207698_100045642 186
43 3300037418 Ga0395900_0028101 Ga0395900_0028101_3680_4249 186
44 3300037471 Ga0395905_0086139 Ga0395905_0086139_922_1491 186
45 3300038443 Ga0395901_0627850 Ga0395901_0627850_269_838 186
46 3300044658 Ga0466972_0001048 Ga0466972_0001048_3179_3739 186
47 3300044683 Ga0466965_0056099 Ga0466965_0056099_333_893 186
48 3300044684 Ga0466966_0015311 Ga0466966_0015311_1567_2127 186
49 3300044693 Ga0466961_0002902 Ga0466961_0002902_1355_1915 186
50 3300044706 Ga0466964_0008494 Ga0466964_0008494_482_1042 186
51 3300044719 Ga0466971_0286567 Ga0466971_0286567_134_694 186
52 3300044735 Ga0466968_0055206 Ga0466968_0055206_421_981 186
53 3300044901 Ga0466960_0018855 Ga0466960_0018855_1588_2148 186
54 3300045049 Ga0466959_0007122 Ga0466959_0007122_5556_6116 186
55 3300045836 Ga0466958_0006840 Ga0466958_0006840_3418_3978 186
56 3300046460 Ga0495638_0000175 Ga0495638_0000175_93141_93710 186
57 3300046558 Ga0495633_0151629 Ga0495633_0151629_34_612 186
58 3300047472 Ga0495686_0000430 Ga0495686_0000430_34424_34990 186
59 3300047472 Ga0495686_0003742 Ga0495686_0003742_1221_1781 186
60 3300048909 Ga0496106_0121928 Ga0496106_0121928_569_1129 186
61 3300048910 Ga0496107_0286429 Ga0496107_0286429_172_732 186
62 3300048918 Ga0496115_0015606 Ga0496115_0015606_3410_3970 186
63 3300048925 Ga0496122_0181848 Ga0496122_0181848_263_835 186
64 3300048926 Ga0496123_0174958 Ga0496123_0174958_459_1037 186
65 3300049459 Ga0495678_021859 Ga0495678_021859_578_1177 186
66 3300049513 Ga0501290_000009 Ga0501290_000009_30790_31362 186
67 3300049523 Ga0501300_000003 Ga0501300_000003_3616_4188 186
68 3300049524 Ga0501301_000089 Ga0501301_000089_3389_3961 186
69 3300049653 Ga0501206_000046 Ga0501206_000046_3970_4542 186
70 3300049662 Ga0501222_000060 Ga0501222_000060_30790_31362 186
71 3300049662 Ga0501222_000245 Ga0501222_000245_7182_7754 186
72 3300049663 Ga0501223_000173 Ga0501223_000173_13193_13765 186
73 3300049663 Ga0501223_006627 Ga0501223_006627_808_1380 186
74 3300049664 Ga0501224_001577 Ga0501224_001577_390_962 186
75 3300049665 Ga0501227_000132 Ga0501227_000132_2774_3346 186
76 3300049666 Ga0501228_000861 Ga0501228_000861_653_1225 186
77 3300049668 Ga0501233_002850 Ga0501233_002850_2415_2987 186
78 3300049669 Ga0501235_002149 Ga0501235_002149_979_1551 186
79 3300049705 Ga0501225_0007513 Ga0501225_0007513_2449_3021 186
80 3300049776 Ga0501280_000050 Ga0501280_000050_30512_31084 186
81 3300049776 Ga0501280_001615 Ga0501280_001615_3344_3916 186
82 3300049778 Ga0501282_000009 Ga0501282_000009_3534_4106 186
83 3300053136 Ga0500559_0004258 Ga0500559_0004258_3664_4224 186
84 3300053156 Ga0500622_0001922 Ga0500622_0001922_4611_5177 186
85 3300061719 Ga0466962_0150902 Ga0466962_0150902_171_731 186
86 iso_pu_bacteria 2919138771 2919138870 186
87 3300001989 JGI24739J22299_10000461 JGI24739J22299_100004616 187
88 3300002067 JGI24735J21928_10001002 JGI24735J21928_100010022 187
89 3300002067 JGI24735J21928_10003910 JGI24735J21928_100039105 187
90 3300002067 JGI24735J21928_10021094 JGI24735J21928_100210942 187
91 3300002067 JGI24735J21928_10039587 JGI24735J21928_100395872 187
92 3300002239 JGI24034J26672_10006159 JGI24034J26672_100061592 187
93 3300003214 JGI25165J46597_1000127 JGI25165J46597_100012717 187
94 3300003322 rootL2_10247492 rootL2_102474922 187
95 3300003762 Ga0055542_1018056 Ga0055542_10180561 187
96 3300003771 Ga0055526_1005081 Ga0055526_10050814 187
97 3300003775 Ga0055524_1018735 Ga0055524_10187352 187
98 3300003794 Ga0055531_10030802 Ga0055531_100308022 187
99 3300005327 Ga0070658_10000468 Ga0070658_1000046811 187
100 3300005327 Ga0070658_10025890 Ga0070658_100258902 187
101 3300005335 Ga0070666_10225616 Ga0070666_102256162 187
102 3300005339 Ga0070660_100014290 Ga0070660_1000142906 187
103 3300005355 Ga0070671_100382688 Ga0070671_1003826882 187
104 3300005366 Ga0070659_100088271 Ga0070659_1000882712 187
105 3300005457 Ga0070662_100006820 Ga0070662_1000068202 187
106 3300005563 Ga0068855_100004868 Ga0068855_1000048687 187
107 3300005577 Ga0068857_100217012 Ga0068857_1002170122 187
108 3300005578 Ga0068854_100118344 Ga0068854_1001183442 187
109 3300005834 Ga0068851_10097559 Ga0068851_100975592 187
110 3300005841 Ga0068863_100551625 Ga0068863_1005516251 187
111 3300006177 Ga0075362_10000173 Ga0075362_100001737 187
112 3300006353 Ga0075370_10009493 Ga0075370_100094932 187
113 3300006353 Ga0075370_10075413 Ga0075370_100754133 187
114 3300006353 Ga0075370_10090850 Ga0075370_100908502 187
115 3300006353 Ga0075370_10112301 Ga0075370_101123012 187
116 3300009093 Ga0105240_10402100 Ga0105240_104021002 187
117 3300009551 Ga0105238_10013768 Ga0105238_100137688 187
118 3300009551 Ga0105238_10233510 Ga0105238_102335102 187
119 3300013100 Ga0157373_10060740 Ga0157373_100607402 187
120 3300013100 Ga0157373_10298048 Ga0157373_102980482 187
121 3300013102 Ga0157371_10000005 Ga0157371_1000000590 187
122 3300013105 Ga0157369_10010626 Ga0157369_100106265 187
123 3300013307 Ga0157372_10004774 Ga0157372_1000477410 187
124 3300013307 Ga0157372_10585622 Ga0157372_105856222 187
125 3300025231 Ga0207427_100843 Ga0207427_1008433 187
126 3300025250 Ga0209026_1000701 Ga0209026_10007018 187
127 3300025254 Ga0209148_1000114 Ga0209148_100011433 187
128 3300025254 Ga0209148_1001207 Ga0209148_100120710 187
129 3300025261 Ga0209233_1000120 Ga0209233_100012017 187
130 3300025272 Ga0209455_1001009 Ga0209455_10010098 187
131 3300025272 Ga0209455_1018040 Ga0209455_10180402 187
132 3300025292 Ga0209676_1039952 Ga0209676_10399522 187
133 3300025295 Ga0209564_1000929 Ga0209564_100092939 187
134 3300025299 Ga0209256_1002847 Ga0209256_100284710 187
135 3300025303 Ga0209051_1112990 Ga0209051_11129901 187
136 3300025304 Ga0209257_1003331 Ga0209257_10033313 187
137 3300025304 Ga0209257_1006866 Ga0209257_10068664 187
138 3300025304 Ga0209257_1012019 Ga0209257_10120195 187
139 3300025901 Ga0207688_10190293 Ga0207688_101902932 187
140 3300025903 Ga0207680_10038764 Ga0207680_100387642 187
141 3300025904 Ga0207647_10000068 Ga0207647_1000006848 187
142 3300025904 Ga0207647_10002491 Ga0207647_1000249113 187
143 3300025904 Ga0207647_10008585 Ga0207647_100085856 187
144 3300025904 Ga0207647_10056094 Ga0207647_100560942 187
145 3300025904 Ga0207647_10531699 Ga0207647_105316991 187
146 3300025909 Ga0207705_10000066 Ga0207705_10000066109 187
147 3300025909 Ga0207705_10005181 Ga0207705_100051816 187
148 3300025919 Ga0207657_10022364 Ga0207657_100223642 187
149 3300025919 Ga0207657_10548643 Ga0207657_105486431 187
150 3300025923 Ga0207681_11007525 Ga0207681_110075251 187
151 3300025924 Ga0207694_10404148 Ga0207694_104041482 187
152 3300025931 Ga0207644_10164907 Ga0207644_101649072 187
153 3300025932 Ga0207690_10030052 Ga0207690_100300524 187
154 3300025933 Ga0207706_10005052 Ga0207706_100050522 187
155 3300025933 Ga0207706_10024803 Ga0207706_100248032 187
156 3300026116 Ga0207674_10004922 Ga0207674_1000492214 187
157 3300026142 Ga0207698_10060193 Ga0207698_100601932 187
158 3300031824 Ga0307413_10443207 Ga0307413_104432072 187
159 3300032005 Ga0307411_10754059 Ga0307411_107540591 187
160 3300032126 Ga0307415_100169244 Ga0307415_1001692442 187
161 3300037312 Ga0395899_0003399 Ga0395899_0003399_6398_6961 187
162 3300038443 Ga0395901_0292624 Ga0395901_0292624_680_1243 187
163 3300042005 Ga0439448_0000990 Ga0439448_0000990_3325_3888 187
164 3300042005 Ga0439448_0003660 Ga0439448_0003660_2018_2581 187
165 3300042005 Ga0439448_0014023 Ga0439448_0014023_1438_2001 187
166 3300042008 Ga0439450_001512 Ga0439450_001512_1507_2070 187
167 3300042012 Ga0439455_0001053 Ga0439455_0001053_393_956 187
168 3300042012 Ga0439455_0011480 Ga0439455_0011480_1099_1662 187
169 3300042157 Ga0439458_0001090 Ga0439458_0001090_6319_6882 187
170 3300044658 Ga0466972_0130877 Ga0466972_0130877_13_576 187
171 3300046474 Ga0495605_0036951 Ga0495605_0036951_299_871 187
172 3300046506 Ga0495583_0000033 Ga0495583_0000033_42249_42812 187
173 3300046506 Ga0495583_0109105 Ga0495583_0109105_322_885 187
174 3300046507 Ga0495606_0000506 Ga0495606_0000506_28973_29536 187
175 3300046507 Ga0495606_0020365 Ga0495606_0020365_528_1091 187
176 3300046519 Ga0495632_0034990 Ga0495632_0034990_1911_2483 187
177 3300046530 Ga0495654_0089756 Ga0495654_0089756_360_932 187
178 3300046616 Ga0495668_0021397 Ga0495668_0021397_2147_2719 187
179 3300046648 Ga0495611_0047568 Ga0495611_0047568_1002_1574 187
180 3300046660 Ga0495625_0018532 Ga0495625_0018532_1440_2012 187
181 3300046665 Ga0495661_0092418 Ga0495661_0092418_968_1531 187
182 3300046691 Ga0495670_0250386 Ga0495670_0250386_337_909 187
183 3300046694 Ga0495649_0082581 Ga0495649_0082581_968_1531 187
184 3300047318 Ga0495636_0037043 Ga0495636_0037043_520_1092 187
185 3300047319 Ga0495674_0339563 Ga0495674_0339563_417_980 187
186 3300047443 Ga0495687_012037 Ga0495687_012037_2650_3213 187
187 3300047469 Ga0495673_0004795 Ga0495673_0004795_6826_7389 187
188 3300047472 Ga0495686_0000053 Ga0495686_0000053_45077_45640 187
189 3300047472 Ga0495686_0004383 Ga0495686_0004383_9538_10104 187
190 3300048907 Ga0496104_0338655 Ga0496104_0338655_704_1306 187
191 3300048913 Ga0496110_1041299 Ga0496110_1041299_62_664 187
192 3300048914 Ga0496111_0039198 Ga0496111_0039198_1980_2543 187
193 3300048915 Ga0496112_1152219 Ga0496112_1152219_69_647 187
194 3300048919 Ga0496116_0001869 Ga0496116_0001869_9833_10429 187
195 3300048919 Ga0496116_0191092 Ga0496116_0191092_145_708 187
196 3300048920 Ga0496117_0004321 Ga0496117_0004321_10086_10649 187
197 3300048920 Ga0496117_0130194 Ga0496117_0130194_779_1375 187
198 3300048920 Ga0496117_0142169 Ga0496117_0142169_469_1032 187
199 3300048921 Ga0496118_0081218 Ga0496118_0081218_379_942 187
200 3300048922 Ga0496119_0075417 Ga0496119_0075417_1349_1912 187
201 3300048923 Ga0496120_0035557 Ga0496120_0035557_1545_2108 187
202 3300048923 Ga0496120_0054333 Ga0496120_0054333_729_1292 187
203 3300048924 Ga0496121_0009783 Ga0496121_0009783_2653_3216 187
204 3300048925 Ga0496122_0001884 Ga0496122_0001884_254_817 187
205 3300048925 Ga0496122_0006109 Ga0496122_0006109_6053_6616 187
206 3300048926 Ga0496123_0004274 Ga0496123_0004274_5402_5965 187
207 3300048926 Ga0496123_0013438 Ga0496123_0013438_3910_4473 187
208 3300048926 Ga0496123_0057123 Ga0496123_0057123_1442_2005 187
209 3300048927 Ga0496124_0000131 Ga0496124_0000131_28954_29535 187
210 3300048927 Ga0496124_0027804 Ga0496124_0027804_236_799 187
211 3300048927 Ga0496124_0074441 Ga0496124_0074441_1334_1897 187
212 3300048928 Ga0496125_0006998 Ga0496125_0006998_6725_7288 187
213 3300048929 Ga0496126_0000687 Ga0496126_0000687_32402_32965 187
214 3300049460 Ga0495682_0145810 Ga0495682_0145810_234_797 187
215 3300050496 nmdc:mga07m45_4264_c1 nmdc:mga07m45_4264_c1_323_895 187
216 3300050496 nmdc:mga07m45_53073_c1 nmdc:mga07m45_53073_c1_795_1358 187
217 3300050496 nmdc:mga07m45_7236_c1 nmdc:mga07m45_7236_c1_43_615 187
218 3300050516 nmdc:mga0sz30_237346_c1 nmdc:mga0sz30_237346_c1_93_674 187
219 3300053079 Ga0500610_0029517 Ga0500610_0029517_1802_2374 187
220 3300053087 Ga0500643_009473 Ga0500643_009473_2039_2611 187
221 3300053103 Ga0500555_000515 Ga0500555_000515_6731_7294 187
222 3300053118 Ga0500594_0093736 Ga0500594_0093736_126_698 187
223 3300053121 Ga0500607_000001 Ga0500607_000001_43312_43884 187
224 3300053136 Ga0500559_0000361 Ga0500559_0000361_19878_20450 187
225 3300053136 Ga0500559_0000971 Ga0500559_0000971_6665_7237 187
226 3300053139 Ga0500568_0000448 Ga0500568_0000448_16808_17380 187
227 3300053153 Ga0500616_0000339 Ga0500616_0000339_45930_46502 187
228 3300053153 Ga0500616_0001524 Ga0500616_0001524_10131_10703 187
229 3300053153 Ga0500616_0022486 Ga0500616_0022486_1235_1798 187
230 3300053153 Ga0500616_0040733 Ga0500616_0040733_1161_1733 187
231 3300053178 Ga0500637_0011539 Ga0500637_0011539_3299_3871 187
232 3300053730 Ga0500645_000645 Ga0500645_000645_3493_4065 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

10

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9829 3 165
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9724 3 179
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9598 3 171
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9584 3 173
2b9u-assembly3.cif.gz_E crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from sulfolobus tokodaii 0.9558 3 176
ID Description Score Start End Superfamily
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9546 3 178 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9543 3 176 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9494 3 167 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9477 3 171 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9477 5 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0Q8QTM1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9902 1 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A520B964-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9889 3 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A285QLT1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9883 2 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2M9PCM0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9883 3 132 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A258JPJ1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9882 8 178 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
96.14 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map