F344843
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 158 | 464 | 447 |
Family's Representative Sequence
| Representative Sequence | 3300005543|Ga0070672_100065341|Ga0070672_1000653413 |
| Length | 473 |
| Sequence | MRRDWKVSAGHFPKVYCPQHQVDSELSVINTNSLLLTDLYMLTMLEGFYKQSLNGIASYEFFVRKLPESRGFLVAAGLEQALEYLEESRFTPQELEWLRHCGTFSREFVDHLAEWRFTGDVDAMPEGTVFFENEPILRVTAPISQAQFVESRLINLLNLQTMIASKAARCVLVADRRTLVDFGLRRAHGAEAGLLASRASYLAGFDGTATVLAGMMFAIPIYGTMAHAYIQAHDSERAAFETFARAQPGNVVLLIDTYDTEQGARVVADLAPRLRDSGITIKAVRLDSGDLAVHSRNVRKILDDAGLKQIGIFCSGNLDEYRLRDLVQGGAPINGFGVGTRLDTSEDAPSLECIYKLVEYDGQPRRKRSEGKATLPGRKQVFRQYRDDGEMETDVVTVWGDLQPGEPLLEPVVRQGRRVRAAEPLSTIRERWAAQRGRLPSHLRALETYPPYPIRIAPALEELAQRADESIVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 62 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 63 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 64 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 65 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 66 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 67 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 68 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 69 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 70 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 71 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 72 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 73 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 74 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 75 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 76 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 77 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 78 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 79 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 80 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 81 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 82 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 83 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 84 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 85 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 86 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 87 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 88 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 89 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 90 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 91 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 92 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 93 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 94 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 95 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 96 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 97 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 98 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 123 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 124 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 153 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 154 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 155 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 156 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 157 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 158 | 8054357960 | Idiomarina rhizosphaerae M1R2S28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.41 |
| Metatranscriptomes | 0 |
| Isolates | 2.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0.86 |
| Rhizoplane | 1.29 |
| Rhizosphere | 95.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070672_100065341 | 3300005543 | Unclassified | 2877 |
| 2 | rootH1_10084487 | 3300003316 | Bacteria | 2884 |
| 3 | rootL2_10171042 | 3300003322 | Bacteria | 2159 |
| 4 | Ga0065707_10158254 | 3300005295 | Bacteria | 1588 |
| 5 | Ga0070670_100006460 | 3300005331 | Bacteria | 9927 |
| 6 | Ga0068869_100015514 | 3300005334 | Bacteria | 5113 |
| 7 | Ga0070666_10067753 | 3300005335 | Bacteria | 2424 |
| 8 | Ga0070687_100049670 | 3300005343 | Bacteria | 2163 |
| 9 | Ga0070675_100000061 | 3300005354 | Bacteria | 66703 |
| 10 | Ga0070675_100002299 | 3300005354 | Bacteria | 14183 |
| 11 | Ga0070675_100002356 | 3300005354 | Bacteria | 14059 |
| 12 | Ga0070675_100149318 | 3300005354 | Bacteria | 2003 |
| 13 | Ga0070688_100021688 | 3300005365 | Bacteria | 3755 |
| 14 | Ga0070659_100051803 | 3300005366 | Bacteria | 3228 |
| 15 | Ga0070667_100015231 | 3300005367 | Bacteria | 6355 |
| 16 | Ga0070714_100080606 | 3300005435 | Bacteria | 2832 |
| 17 | Ga0070713_100049397 | 3300005436 | Bacteria | 3470 |
| 18 | Ga0070711_100017203 | 3300005439 | Bacteria | 4601 |
| 19 | Ga0070705_100064918 | 3300005440 | Bacteria | 2183 |
| 20 | Ga0070708_100239554 | 3300005445 | Bacteria | 1703 |
| 21 | Ga0068867_100102514 | 3300005459 | Bacteria | 2187 |
| 22 | Ga0070685_10015015 | 3300005466 | Unclassified | 4111 |
| 23 | Ga0070685_10111583 | 3300005466 | Bacteria | 1685 |
| 24 | Ga0070706_100050296 | 3300005467 | Bacteria | 3846 |
| 25 | Ga0070698_100003284 | 3300005471 | Bacteria | 17778 |
| 26 | Ga0070664_100037353 | 3300005564 | Unclassified | 4084 |
| 27 | Ga0068859_100000802 | 3300005617 | Bacteria | 31882 |
| 28 | Ga0068859_100004069 | 3300005617 | Bacteria | 14917 |
| 29 | Ga0068859_100090166 | 3300005617 | Bacteria | 3117 |
| 30 | Ga0068859_100203838 | 3300005617 | Bacteria | 2063 |
| 31 | Ga0068864_100189635 | 3300005618 | Unclassified | 1884 |
| 32 | Ga0068863_100000177 | 3300005841 | Bacteria | 67749 |
| 33 | Ga0068863_100045339 | 3300005841 | Bacteria | 4173 |
| 34 | Ga0068858_100006641 | 3300005842 | Bacteria | 11249 |
| 35 | Ga0068860_100003362 | 3300005843 | Bacteria | 16466 |
| 36 | Ga0081455_10010181 | 3300005937 | Bacteria | 9573 |
| 37 | Ga0081455_10135283 | 3300005937 | Bacteria | 1921 |
| 38 | Ga0081540_1000019 | 3300005983 | Bacteria | 163281 |
| 39 | Ga0081540_1008654 | 3300005983 | Bacteria | 7089 |
| 40 | Ga0070717_10005617 | 3300006028 | Bacteria | 9163 |
| 41 | Ga0070715_10011017 | 3300006163 | Bacteria | 3242 |
| 42 | Ga0070712_100013767 | 3300006175 | Bacteria | 5175 |
| 43 | Ga0097621_100021192 | 3300006237 | Bacteria | 5022 |
| 44 | Ga0068871_100069580 | 3300006358 | Unclassified | 2891 |
| 45 | Ga0068871_100070418 | 3300006358 | Bacteria | 2874 |
| 46 | Ga0097620_100000802 | 3300006931 | Bacteria | 31882 |
| 47 | Ga0097620_100004069 | 3300006931 | Bacteria | 14917 |
| 48 | Ga0097620_100090166 | 3300006931 | Bacteria | 3117 |
| 49 | Ga0097620_100203827 | 3300006931 | Bacteria | 2063 |
| 50 | Ga0111539_10082133 | 3300009094 | Bacteria | 3790 |
| 51 | Ga0111539_10091041 | 3300009094 | Bacteria | 3584 |
| 52 | Ga0105247_10039704 | 3300009101 | Unclassified | 2876 |
| 53 | Ga0105248_10004089 | 3300009177 | Bacteria | 16136 |
| 54 | Ga0105248_10092951 | 3300009177 | Bacteria | 3396 |
| 55 | Ga0157375_10005210 | 3300013308 | Bacteria | 11281 |
| 56 | Ga0157380_10057426 | 3300014326 | Bacteria | 3099 |
| 57 | Ga0209025_1001386 | 3300025294 | Bacteria | 32347 |
| 58 | Ga0207692_10001895 | 3300025898 | Bacteria | 7946 |
| 59 | Ga0207693_10015338 | 3300025915 | Bacteria | 6149 |
| 60 | Ga0207693_10058168 | 3300025915 | Bacteria | 3028 |
| 61 | Ga0207663_10010259 | 3300025916 | Bacteria | 4979 |
| 62 | Ga0207681_10056071 | 3300025923 | Bacteria | 2687 |
| 63 | Ga0207650_10008422 | 3300025925 | Bacteria | 7039 |
| 64 | Ga0207659_10000181 | 3300025926 | Bacteria | 37557 |
| 65 | Ga0207659_10001137 | 3300025926 | Bacteria | 15794 |
| 66 | Ga0207659_10049371 | 3300025926 | Unclassified | 2985 |
| 67 | Ga0207664_10096209 | 3300025929 | Unclassified | 2437 |
| 68 | Ga0207690_10045614 | 3300025932 | Bacteria | 2897 |
| 69 | Ga0207665_10004664 | 3300025939 | Bacteria | 9106 |
| 70 | Ga0207665_10020010 | 3300025939 | Bacteria | 4397 |
| 71 | Ga0207691_10032038 | 3300025940 | Bacteria | 4904 |
| 72 | Ga0207711_10011452 | 3300025941 | Bacteria | 7374 |
| 73 | Ga0207689_10000779 | 3300025942 | Bacteria | 30598 |
| 74 | Ga0207679_10002555 | 3300025945 | Bacteria | 11215 |
| 75 | Ga0207658_10007575 | 3300025986 | Bacteria | 7396 |
| 76 | Ga0207703_10011227 | 3300026035 | Bacteria | 6970 |
| 77 | Ga0207678_10144060 | 3300026067 | Bacteria | 2034 |
| 78 | Ga0207648_10050190 | 3300026089 | Bacteria | 3649 |
| 79 | Ga0207676_10072243 | 3300026095 | Bacteria | 2773 |
| 80 | Ga0268264_10005554 | 3300028381 | Bacteria | 10686 |
| 81 | Ga0268264_10143533 | 3300028381 | Bacteria | 2132 |
| 82 | Ga0265325_10000736 | 3300031241 | Bacteria | 23678 |
| 83 | Ga0265339_10005391 | 3300031249 | Bacteria | 8520 |
| 84 | Ga0265313_10000686 | 3300031595 | Bacteria | 34918 |
| 85 | Ga0316575_10023263 | 3300031665 | Bacteria | 2394 |
| 86 | Ga0316579_10000427 | 3300031691 | Bacteria | 13382 |
| 87 | Ga0316576_10003232 | 3300031727 | Bacteria | 9504 |
| 88 | Ga0316578_10025768 | 3300031728 | Bacteria | 3309 |
| 89 | Ga0316578_10031383 | 3300031728 | Bacteria | 3027 |
| 90 | Ga0316578_10036133 | 3300031728 | Bacteria | 2843 |
| 91 | Ga0316577_10018965 | 3300031733 | Bacteria | 3806 |
| 92 | Ga0307406_10135819 | 3300031901 | Bacteria | 1733 |
| 93 | Ga0316583_10000718 | 3300032133 | Bacteria | 10287 |
| 94 | Ga0316583_10002302 | 3300032133 | Bacteria | 6582 |
| 95 | Ga0316585_10031085 | 3300032137 | Bacteria | 1678 |
| 96 | Ga0373934_0000839 | 3300035086 | Bacteria | 11089 |
| 97 | Ga0373952_0002268 | 3300035092 | Bacteria | 3461 |
| 98 | Ga0373937_0010152 | 3300036401 | Bacteria | 8214 |
| 99 | Ga0316582_0003726 | 3300036647 | Bacteria | 7547 |
| 100 | Ga0316582_0014818 | 3300036647 | Bacteria | 4439 |
| 101 | Ga0316584_0006079 | 3300036712 | Bacteria | 8157 |
| 102 | Ga0316584_0009382 | 3300036712 | Bacteria | 6790 |
| 103 | Ga0316584_0078876 | 3300036712 | Bacteria | 2466 |
| 104 | Ga0395900_0115202 | 3300037418 | Bacteria | 2758 |
| 105 | Ga0395898_0012864 | 3300037466 | Bacteria | 8633 |
| 106 | Ga0395905_0025060 | 3300037471 | Bacteria | 5626 |
| 107 | Ga0395905_0033494 | 3300037471 | Bacteria | 4826 |
| 108 | Ga0395901_0005304 | 3300038443 | Bacteria | 13030 |
| 109 | Ga0436360_0592313 | 3300039438 | Bacteria | 1350 |
| 110 | Ga0436361_0050602 | 3300039447 | Bacteria | 2295 |
| 111 | Ga0436361_0335402 | 3300039447 | Bacteria | 4530 |
| 112 | Ga0436362_0045893 | 3300039453 | Bacteria | 2148 |
| 113 | Ga0439435_0001092 | 3300042436 | Bacteria | 4828 |
| 114 | Ga0439444_0000892 | 3300042437 | Bacteria | 3630 |
| 115 | Ga0439464_0024047 | 3300042439 | Bacteria | 1684 |
| 116 | Ga0451577_0005356 | 3300042876 | Bacteria | 13163 |
| 117 | Ga0466965_0010751 | 3300044683 | Bacteria | 4280 |
| 118 | Ga0466965_0024151 | 3300044683 | Bacteria | 2938 |
| 119 | Ga0466966_0064198 | 3300044684 | Bacteria | 2312 |
| 120 | Ga0466963_0001085 | 3300044694 | Bacteria | 14185 |
| 121 | Ga0466964_0038737 | 3300044706 | Bacteria | 1918 |
| 122 | Ga0453684_0056064 | 3300044712 | Bacteria | 5116 |
| 123 | Ga0466971_0002251 | 3300044719 | Bacteria | 8165 |
| 124 | Ga0466968_0020927 | 3300044735 | Bacteria | 2645 |
| 125 | Ga0466957_0003603 | 3300044842 | Bacteria | 8543 |
| 126 | Ga0466957_0015020 | 3300044842 | Bacteria | 4517 |
| 127 | Ga0466959_0002162 | 3300045049 | Bacteria | 12486 |
| 128 | Ga0451576_0052796 | 3300045051 | Bacteria | 4259 |
| 129 | Ga0495603_0013841 | 3300046455 | Bacteria | 4883 |
| 130 | Ga0495590_0000328 | 3300046457 | Bacteria | 24730 |
| 131 | Ga0495629_0130406 | 3300046459 | Bacteria | 1751 |
| 132 | Ga0495653_0048612 | 3300046463 | Bacteria | 3273 |
| 133 | Ga0495580_0010594 | 3300046472 | Bacteria | 7173 |
| 134 | Ga0495582_0003704 | 3300046473 | Bacteria | 8614 |
| 135 | Ga0495582_0015829 | 3300046473 | Bacteria | 4136 |
| 136 | Ga0495585_0008792 | 3300046492 | Bacteria | 6098 |
| 137 | Ga0495594_0000145 | 3300046499 | Bacteria | 33824 |
| 138 | Ga0495606_0086614 | 3300046507 | Bacteria | 1935 |
| 139 | Ga0495628_0094865 | 3300046516 | Bacteria | 2306 |
| 140 | Ga0495630_0021438 | 3300046517 | Bacteria | 4771 |
| 141 | Ga0495666_0012720 | 3300046526 | Bacteria | 4193 |
| 142 | Ga0495652_0003988 | 3300046529 | Bacteria | 14299 |
| 143 | Ga0495665_0001627 | 3300046531 | Bacteria | 12023 |
| 144 | Ga0495587_0018553 | 3300046536 | Bacteria | 4314 |
| 145 | Ga0495634_0006576 | 3300046642 | Bacteria | 8817 |
| 146 | Ga0495611_0008022 | 3300046648 | Bacteria | 4484 |
| 147 | Ga0495623_0006445 | 3300046679 | Bacteria | 7635 |
| 148 | Ga0495613_0064690 | 3300046689 | Bacteria | 2674 |
| 149 | Ga0495670_0010157 | 3300046691 | Bacteria | 4633 |
| 150 | Ga0495636_0001119 | 3300047318 | Bacteria | 10103 |
| 151 | Ga0495636_0043506 | 3300047318 | Bacteria | 1869 |
| 152 | Ga0495676_0043695 | 3300047321 | Bacteria | 3663 |
| 153 | Ga0495675_0003643 | 3300047444 | Bacteria | 9303 |
| 154 | Ga0495675_0009570 | 3300047444 | Bacteria | 6036 |
| 155 | Ga0495675_0078938 | 3300047444 | Bacteria | 2073 |
| 156 | Ga0496109_0187742 | 3300048912 | Bacteria | 1942 |
| 157 | Ga0496114_0063288 | 3300048917 | Bacteria | 3097 |
| 158 | Ga0496115_0020634 | 3300048918 | Bacteria | 5084 |
| 159 | Ga0501031_0028852 | 3300049568 | Bacteria | 3617 |
| 160 | Ga0501033_0000240 | 3300049570 | Bacteria | 52539 |
| 161 | Ga0501033_0117972 | 3300049570 | Bacteria | 1928 |
| 162 | Ga0501034_0112422 | 3300049571 | Bacteria | 2713 |
| 163 | Ga0501036_0014013 | 3300049572 | Bacteria | 6664 |
| 164 | Ga0501036_0130594 | 3300049572 | Bacteria | 2121 |
| 165 | Ga0501037_0079995 | 3300049573 | Bacteria | 2372 |
| 166 | Ga0501037_0118216 | 3300049573 | Bacteria | 1907 |
| 167 | Ga0501037_0124903 | 3300049573 | Bacteria | 1848 |
| 168 | Ga0501037_0178752 | 3300049573 | Bacteria | 1506 |
| 169 | Ga0501039_0024353 | 3300049575 | Bacteria | 4649 |
| 170 | Ga0501039_0036476 | 3300049575 | Bacteria | 3794 |
| 171 | Ga0501039_0095779 | 3300049575 | Bacteria | 2314 |
| 172 | Ga0501040_0018570 | 3300049576 | Bacteria | 4617 |
| 173 | Ga0501040_0050341 | 3300049576 | Bacteria | 2849 |
| 174 | Ga0501041_0143948 | 3300049577 | Bacteria | 1487 |
| 175 | Ga0501042_0015357 | 3300049578 | Bacteria | 5241 |
| 176 | Ga0501042_0026452 | 3300049578 | Bacteria | 4077 |
| 177 | Ga0501043_0058447 | 3300049579 | Bacteria | 3027 |
| 178 | Ga0501043_0094543 | 3300049579 | Bacteria | 2350 |
| 179 | Ga0501043_0129515 | 3300049579 | Bacteria | 1978 |
| 180 | Ga0501046_0032039 | 3300049580 | Bacteria | 4258 |
| 181 | Ga0501046_0073597 | 3300049580 | Bacteria | 2651 |
| 182 | Ga0501046_0078745 | 3300049580 | Bacteria | 2549 |
| 183 | Ga0501047_0012243 | 3300049581 | Bacteria | 8123 |
| 184 | Ga0501047_0224978 | 3300049581 | Bacteria | 1731 |
| 185 | Ga0501048_0037932 | 3300049582 | Bacteria | 3460 |
| 186 | Ga0501048_0048041 | 3300049582 | Bacteria | 3044 |
| 187 | Ga0501048_0117019 | 3300049582 | Bacteria | 1883 |
| 188 | Ga0501070_0113552 | 3300049586 | Bacteria | 2239 |
| 189 | Ga0501071_0021087 | 3300049587 | Bacteria | 4536 |
| 190 | Ga0501072_0011336 | 3300049588 | Bacteria | 6812 |
| 191 | Ga0501072_0037368 | 3300049588 | Bacteria | 3808 |
| 192 | Ga0501072_0061947 | 3300049588 | Bacteria | 2951 |
| 193 | Ga0501072_0117959 | 3300049588 | Bacteria | 2114 |
| 194 | Ga0501072_0168196 | 3300049588 | Bacteria | 1749 |
| 195 | Ga0501074_0024040 | 3300049590 | Bacteria | 4428 |
| 196 | Ga0501074_0055540 | 3300049590 | Bacteria | 2853 |
| 197 | Ga0501075_0004332 | 3300049591 | Bacteria | 9605 |
| 198 | Ga0501075_0019910 | 3300049591 | Bacteria | 4874 |
| 199 | Ga0501075_0127535 | 3300049591 | Bacteria | 1937 |
| 200 | Ga0501075_0158845 | 3300049591 | Bacteria | 1724 |
| 201 | Ga0501076_0001512 | 3300049592 | Bacteria | 15578 |
| 202 | Ga0501077_0001282 | 3300049593 | Bacteria | 15191 |
| 203 | Ga0501077_0112838 | 3300049593 | Bacteria | 1723 |
| 204 | Ga0501077_0131985 | 3300049593 | Bacteria | 1584 |
| 205 | Ga0501079_0001898 | 3300049741 | Bacteria | 14977 |
| 206 | Ga0501079_0035082 | 3300049741 | Bacteria | 3860 |
| 207 | Ga0501079_0199817 | 3300049741 | Bacteria | 1561 |
| 208 | Ga0501080_0041120 | 3300049742 | Bacteria | 4309 |
| 209 | Ga0501080_0063394 | 3300049742 | Bacteria | 3440 |
| 210 | Ga0501081_0001098 | 3300049743 | Bacteria | 16263 |
| 211 | Ga0501081_0003916 | 3300049743 | Bacteria | 9538 |
| 212 | Ga0501081_0072303 | 3300049743 | Bacteria | 2405 |
| 213 | Ga0501035_0000659 | 3300049822 | Bacteria | 38046 |
| 214 | Ga0501035_0199442 | 3300049822 | Bacteria | 1717 |
| 215 | Ga0501044_0002072 | 3300049823 | Bacteria | 23112 |
| 216 | Ga0501044_0024962 | 3300049823 | Bacteria | 6338 |
| 217 | Ga0501044_0170362 | 3300049823 | Bacteria | 2149 |
| 218 | Ga0501045_0031850 | 3300049824 | Bacteria | 3819 |
| 219 | Ga0501045_0058060 | 3300049824 | Bacteria | 2833 |
| 220 | Ga0501084_0022979 | 3300054114 | Bacteria | 5205 |
| 221 | Ga0501084_0209170 | 3300054114 | Bacteria | 1646 |
| 222 | Ga0501082_0047604 | 3300060353 | Bacteria | 3695 |
| 223 | Ga0501082_0049567 | 3300060353 | Bacteria | 3622 |
| 224 | Ga0530510_0002321 | 3300061734 | Bacteria | 13048 |
| 225 | Ga0530510_0003836 | 3300061734 | Bacteria | 10361 |
| 226 | Ga0530510_0209052 | 3300061734 | Bacteria | 1450 |
| 227 | 2513557674 | 2513237082 | Bacteria | 8640282 |
| 228 | 2513696681 | 2513237101 | Bacteria | 7952346 |
| 229 | 2729145116 | 2728369097 | Bacteria | 4333476 |
| 230 | 2889038677 | 2889033259 | Bacteria | 9099371 |
| 231 | 2891634850 | 2891633521 | Bacteria | 4602265 |
| 232 | 8054358253 | 8054357960 | Bacteria | 2867777 |
| 233 | Ga0070672_100065341 | |||
| 234 | rootH1_10084487 | |||
| 235 | rootL2_10171042 | |||
| 236 | Ga0065707_10158254 | |||
| 237 | Ga0070670_100006460 | |||
| 238 | Ga0068869_100015514 | |||
| 239 | Ga0070666_10067753 | |||
| 240 | Ga0070687_100049670 | |||
| 241 | Ga0070675_100000061 | |||
| 242 | Ga0070675_100002299 | |||
| 243 | Ga0070675_100002356 | |||
| 244 | Ga0070675_100149318 | |||
| 245 | Ga0070688_100021688 | |||
| 246 | Ga0070659_100051803 | |||
| 247 | Ga0070667_100015231 | |||
| 248 | Ga0070714_100080606 | |||
| 249 | Ga0070713_100049397 | |||
| 250 | Ga0070711_100017203 | |||
| 251 | Ga0070705_100064918 | |||
| 252 | Ga0070708_100239554 | |||
| 253 | Ga0068867_100102514 | |||
| 254 | Ga0070685_10015015 | |||
| 255 | Ga0070685_10111583 | |||
| 256 | Ga0070706_100050296 | |||
| 257 | Ga0070698_100003284 | |||
| 258 | Ga0070664_100037353 | |||
| 259 | Ga0068859_100000802 | |||
| 260 | Ga0068859_100004069 | |||
| 261 | Ga0068859_100090166 | |||
| 262 | Ga0068859_100203838 | |||
| 263 | Ga0068864_100189635 | |||
| 264 | Ga0068863_100000177 | |||
| 265 | Ga0068863_100045339 | |||
| 266 | Ga0068858_100006641 | |||
| 267 | Ga0068860_100003362 | |||
| 268 | Ga0081455_10010181 | |||
| 269 | Ga0081455_10135283 | |||
| 270 | Ga0081540_1000019 | |||
| 271 | Ga0081540_1008654 | |||
| 272 | Ga0070717_10005617 | |||
| 273 | Ga0070715_10011017 | |||
| 274 | Ga0070712_100013767 | |||
| 275 | Ga0097621_100021192 | |||
| 276 | Ga0068871_100069580 | |||
| 277 | Ga0068871_100070418 | |||
| 278 | Ga0097620_100000802 | |||
| 279 | Ga0097620_100004069 | |||
| 280 | Ga0097620_100090166 | |||
| 281 | Ga0097620_100203827 | |||
| 282 | Ga0111539_10082133 | |||
| 283 | Ga0111539_10091041 | |||
| 284 | Ga0105247_10039704 | |||
| 285 | Ga0105248_10004089 | |||
| 286 | Ga0105248_10092951 | |||
| 287 | Ga0157375_10005210 | |||
| 288 | Ga0157380_10057426 | |||
| 289 | Ga0209025_1001386 | |||
| 290 | Ga0207692_10001895 | |||
| 291 | Ga0207693_10015338 | |||
| 292 | Ga0207693_10058168 | |||
| 293 | Ga0207663_10010259 | |||
| 294 | Ga0207681_10056071 | |||
| 295 | Ga0207650_10008422 | |||
| 296 | Ga0207659_10000181 | |||
| 297 | Ga0207659_10001137 | |||
| 298 | Ga0207659_10049371 | |||
| 299 | Ga0207664_10096209 | |||
| 300 | Ga0207690_10045614 | |||
| 301 | Ga0207665_10004664 | |||
| 302 | Ga0207665_10020010 | |||
| 303 | Ga0207691_10032038 | |||
| 304 | Ga0207711_10011452 | |||
| 305 | Ga0207689_10000779 | |||
| 306 | Ga0207679_10002555 | |||
| 307 | Ga0207658_10007575 | |||
| 308 | Ga0207703_10011227 | |||
| 309 | Ga0207678_10144060 | |||
| 310 | Ga0207648_10050190 | |||
| 311 | Ga0207676_10072243 | |||
| 312 | Ga0268264_10005554 | |||
| 313 | Ga0268264_10143533 | |||
| 314 | Ga0265325_10000736 | |||
| 315 | Ga0265339_10005391 | |||
| 316 | Ga0265313_10000686 | |||
| 317 | Ga0316575_10023263 | |||
| 318 | Ga0316579_10000427 | |||
| 319 | Ga0316576_10003232 | |||
| 320 | Ga0316578_10025768 | |||
| 321 | Ga0316578_10031383 | |||
| 322 | Ga0316578_10036133 | |||
| 323 | Ga0316577_10018965 | |||
| 324 | Ga0307406_10135819 | |||
| 325 | Ga0316583_10000718 | |||
| 326 | Ga0316583_10002302 | |||
| 327 | Ga0316585_10031085 | |||
| 328 | Ga0373934_0000839 | |||
| 329 | Ga0373952_0002268 | |||
| 330 | Ga0373937_0010152 | |||
| 331 | Ga0316582_0003726 | |||
| 332 | Ga0316582_0014818 | |||
| 333 | Ga0316584_0006079 | |||
| 334 | Ga0316584_0009382 | |||
| 335 | Ga0316584_0078876 | |||
| 336 | Ga0395900_0115202 | |||
| 337 | Ga0395898_0012864 | |||
| 338 | Ga0395905_0025060 | |||
| 339 | Ga0395905_0033494 | |||
| 340 | Ga0395901_0005304 | |||
| 341 | Ga0436360_0592313 | |||
| 342 | Ga0436361_0050602 | |||
| 343 | Ga0436361_0335402 | |||
| 344 | Ga0436362_0045893 | |||
| 345 | Ga0439435_0001092 | |||
| 346 | Ga0439444_0000892 | |||
| 347 | Ga0439464_0024047 | |||
| 348 | Ga0451577_0005356 | |||
| 349 | Ga0466965_0010751 | |||
| 350 | Ga0466965_0024151 | |||
| 351 | Ga0466966_0064198 | |||
| 352 | Ga0466963_0001085 | |||
| 353 | Ga0466964_0038737 | |||
| 354 | Ga0453684_0056064 | |||
| 355 | Ga0466971_0002251 | |||
| 356 | Ga0466968_0020927 | |||
| 357 | Ga0466957_0003603 | |||
| 358 | Ga0466957_0015020 | |||
| 359 | Ga0466959_0002162 | |||
| 360 | Ga0451576_0052796 | |||
| 361 | Ga0495603_0013841 | |||
| 362 | Ga0495590_0000328 | |||
| 363 | Ga0495629_0130406 | |||
| 364 | Ga0495653_0048612 | |||
| 365 | Ga0495580_0010594 | |||
| 366 | Ga0495582_0003704 | |||
| 367 | Ga0495582_0015829 | |||
| 368 | Ga0495585_0008792 | |||
| 369 | Ga0495594_0000145 | |||
| 370 | Ga0495606_0086614 | |||
| 371 | Ga0495628_0094865 | |||
| 372 | Ga0495630_0021438 | |||
| 373 | Ga0495666_0012720 | |||
| 374 | Ga0495652_0003988 | |||
| 375 | Ga0495665_0001627 | |||
| 376 | Ga0495587_0018553 | |||
| 377 | Ga0495634_0006576 | |||
| 378 | Ga0495611_0008022 | |||
| 379 | Ga0495623_0006445 | |||
| 380 | Ga0495613_0064690 | |||
| 381 | Ga0495670_0010157 | |||
| 382 | Ga0495636_0001119 | |||
| 383 | Ga0495636_0043506 | |||
| 384 | Ga0495676_0043695 | |||
| 385 | Ga0495675_0003643 | |||
| 386 | Ga0495675_0009570 | |||
| 387 | Ga0495675_0078938 | |||
| 388 | Ga0496109_0187742 | |||
| 389 | Ga0496114_0063288 | |||
| 390 | Ga0496115_0020634 | |||
| 391 | Ga0501031_0028852 | |||
| 392 | Ga0501033_0000240 | |||
| 393 | Ga0501033_0117972 | |||
| 394 | Ga0501034_0112422 | |||
| 395 | Ga0501036_0014013 | |||
| 396 | Ga0501036_0130594 | |||
| 397 | Ga0501037_0079995 | |||
| 398 | Ga0501037_0118216 | |||
| 399 | Ga0501037_0124903 | |||
| 400 | Ga0501037_0178752 | |||
| 401 | Ga0501039_0024353 | |||
| 402 | Ga0501039_0036476 | |||
| 403 | Ga0501039_0095779 | |||
| 404 | Ga0501040_0018570 | |||
| 405 | Ga0501040_0050341 | |||
| 406 | Ga0501041_0143948 | |||
| 407 | Ga0501042_0015357 | |||
| 408 | Ga0501042_0026452 | |||
| 409 | Ga0501043_0058447 | |||
| 410 | Ga0501043_0094543 | |||
| 411 | Ga0501043_0129515 | |||
| 412 | Ga0501046_0032039 | |||
| 413 | Ga0501046_0073597 | |||
| 414 | Ga0501046_0078745 | |||
| 415 | Ga0501047_0012243 | |||
| 416 | Ga0501047_0224978 | |||
| 417 | Ga0501048_0037932 | |||
| 418 | Ga0501048_0048041 | |||
| 419 | Ga0501048_0117019 | |||
| 420 | Ga0501070_0113552 | |||
| 421 | Ga0501071_0021087 | |||
| 422 | Ga0501072_0011336 | |||
| 423 | Ga0501072_0037368 | |||
| 424 | Ga0501072_0061947 | |||
| 425 | Ga0501072_0117959 | |||
| 426 | Ga0501072_0168196 | |||
| 427 | Ga0501074_0024040 | |||
| 428 | Ga0501074_0055540 | |||
| 429 | Ga0501075_0004332 | |||
| 430 | Ga0501075_0019910 | |||
| 431 | Ga0501075_0127535 | |||
| 432 | Ga0501075_0158845 | |||
| 433 | Ga0501076_0001512 | |||
| 434 | Ga0501077_0001282 | |||
| 435 | Ga0501077_0112838 | |||
| 436 | Ga0501077_0131985 | |||
| 437 | Ga0501079_0001898 | |||
| 438 | Ga0501079_0035082 | |||
| 439 | Ga0501079_0199817 | |||
| 440 | Ga0501080_0041120 | |||
| 441 | Ga0501080_0063394 | |||
| 442 | Ga0501081_0001098 | |||
| 443 | Ga0501081_0003916 | |||
| 444 | Ga0501081_0072303 | |||
| 445 | Ga0501035_0000659 | |||
| 446 | Ga0501035_0199442 | |||
| 447 | Ga0501044_0002072 | |||
| 448 | Ga0501044_0024962 | |||
| 449 | Ga0501044_0170362 | |||
| 450 | Ga0501045_0031850 | |||
| 451 | Ga0501045_0058060 | |||
| 452 | Ga0501084_0022979 | |||
| 453 | Ga0501084_0209170 | |||
| 454 | Ga0501082_0047604 | |||
| 455 | Ga0501082_0049567 | |||
| 456 | Ga0530510_0002321 | |||
| 457 | Ga0530510_0003836 | |||
| 458 | Ga0530510_0209052 | |||
| 459 | 2513557674 | |||
| 460 | 2513696681 | |||
| 461 | 2729145116 | |||
| 462 | 2889038677 | |||
| 463 | 2891634850 | |||
| 464 | 8054358253 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mzy-assembly1.cif.gz_A | crystal structure of enterococcus faecalis nicotinate phosphoribosyltransferase with malonate and phosphate bound | 0.9057 | 11 | 457 |
| 4yub-assembly1.cif.gz_A | crystal structure of human nicotinic acid phosphoribosyltransferase | 0.8988 | 18 | 449 |
| 4yub-assembly1.cif.gz_B | crystal structure of human nicotinic acid phosphoribosyltransferase | 0.8847 | 18 | 450 |
| 2i14-assembly1.cif.gz_A | crystal structure of nicotinate-nucleotide pyrophosphorylase from pyrococcus furiosus | 0.8735 | 14 | 420 |
| 4mzy-assembly1.cif.gz_A | crystal structure of enterococcus faecalis nicotinate phosphoribosyltransferase with malonate and phosphate bound | 0.8559 | 11 | 457 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJI7_150_316_3.20.140.10 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9756 | 159 | 324 | 3.20.140.10 |
| af_Q851M0_172_232_3.20.140.10 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9742 | 156 | 215 | 3.20.140.10 |
| af_Q55G10_66_572_3.20.140.10 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.963 | 20 | 442 | 3.20.140.10 |
| af_C0PHJ7_17_175_3.90.1170.20 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain | 0.9557 | 11 | 151 | 3.90.1170.20 |
| af_P9WJI7_150_316_3.20.140.10 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9527 | 159 | 324 | 3.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K6H5Q0-F1-model_v4 | deleted | 0.9953 | 16 | 456 |
|
| AF-A0A533Z6R2-F1-model_v4 | Nicotinate phosphoribosyltransferase (EC 6.3.4.21) | 0.9949 | 97 | 452 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |
| AF-A0A0H3HN39-F1-model_v4 | Nicotinate phosphoribosyltransferase (EC 6.3.4.21) | 0.9948 | 9 | 457 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |
| AF-A0A523NQ76-F1-model_v4 | Nicotinate phosphoribosyltransferase (EC 6.3.4.21) | 0.9947 | 11 | 450 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |
| AF-A0A3N9UYJ9-F1-model_v4 | Nicotinate phosphoribosyltransferase | 0.9939 | 16 | 139 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |