F344843

General Info

Members Datasets Scaffolds Average Seq Length
232 158 464 447

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100065341|Ga0070672_1000653413
Length 473
Sequence MRRDWKVSAGHFPKVYCPQHQVDSELSVINTNSLLLTDLYMLTMLEGFYKQSLNGIASYEFFVRKLPESRGFLVAAGLEQALEYLEESRFTPQELEWLRHCGTFSREFVDHLAEWRFTGDVDAMPEGTVFFENEPILRVTAPISQAQFVESRLINLLNLQTMIASKAARCVLVADRRTLVDFGLRRAHGAEAGLLASRASYLAGFDGTATVLAGMMFAIPIYGTMAHAYIQAHDSERAAFETFARAQPGNVVLLIDTYDTEQGARVVADLAPRLRDSGITIKAVRLDSGDLAVHSRNVRKILDDAGLKQIGIFCSGNLDEYRLRDLVQGGAPINGFGVGTRLDTSEDAPSLECIYKLVEYDGQPRRKRSEGKATLPGRKQVFRQYRDDGEMETDVVTVWGDLQPGEPLLEPVVRQGRRVRAAEPLSTIRERWAAQRGRLPSHLRALETYPPYPIRIAPALEELAQRADESIVR

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
85 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
86 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
154 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
155 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
156 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
157 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
158 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0.86
Rhizoplane 1.29
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100065341 3300005543 Unclassified 2877
2 rootH1_10084487 3300003316 Bacteria 2884
3 rootL2_10171042 3300003322 Bacteria 2159
4 Ga0065707_10158254 3300005295 Bacteria 1588
5 Ga0070670_100006460 3300005331 Bacteria 9927
6 Ga0068869_100015514 3300005334 Bacteria 5113
7 Ga0070666_10067753 3300005335 Bacteria 2424
8 Ga0070687_100049670 3300005343 Bacteria 2163
9 Ga0070675_100000061 3300005354 Bacteria 66703
10 Ga0070675_100002299 3300005354 Bacteria 14183
11 Ga0070675_100002356 3300005354 Bacteria 14059
12 Ga0070675_100149318 3300005354 Bacteria 2003
13 Ga0070688_100021688 3300005365 Bacteria 3755
14 Ga0070659_100051803 3300005366 Bacteria 3228
15 Ga0070667_100015231 3300005367 Bacteria 6355
16 Ga0070714_100080606 3300005435 Bacteria 2832
17 Ga0070713_100049397 3300005436 Bacteria 3470
18 Ga0070711_100017203 3300005439 Bacteria 4601
19 Ga0070705_100064918 3300005440 Bacteria 2183
20 Ga0070708_100239554 3300005445 Bacteria 1703
21 Ga0068867_100102514 3300005459 Bacteria 2187
22 Ga0070685_10015015 3300005466 Unclassified 4111
23 Ga0070685_10111583 3300005466 Bacteria 1685
24 Ga0070706_100050296 3300005467 Bacteria 3846
25 Ga0070698_100003284 3300005471 Bacteria 17778
26 Ga0070664_100037353 3300005564 Unclassified 4084
27 Ga0068859_100000802 3300005617 Bacteria 31882
28 Ga0068859_100004069 3300005617 Bacteria 14917
29 Ga0068859_100090166 3300005617 Bacteria 3117
30 Ga0068859_100203838 3300005617 Bacteria 2063
31 Ga0068864_100189635 3300005618 Unclassified 1884
32 Ga0068863_100000177 3300005841 Bacteria 67749
33 Ga0068863_100045339 3300005841 Bacteria 4173
34 Ga0068858_100006641 3300005842 Bacteria 11249
35 Ga0068860_100003362 3300005843 Bacteria 16466
36 Ga0081455_10010181 3300005937 Bacteria 9573
37 Ga0081455_10135283 3300005937 Bacteria 1921
38 Ga0081540_1000019 3300005983 Bacteria 163281
39 Ga0081540_1008654 3300005983 Bacteria 7089
40 Ga0070717_10005617 3300006028 Bacteria 9163
41 Ga0070715_10011017 3300006163 Bacteria 3242
42 Ga0070712_100013767 3300006175 Bacteria 5175
43 Ga0097621_100021192 3300006237 Bacteria 5022
44 Ga0068871_100069580 3300006358 Unclassified 2891
45 Ga0068871_100070418 3300006358 Bacteria 2874
46 Ga0097620_100000802 3300006931 Bacteria 31882
47 Ga0097620_100004069 3300006931 Bacteria 14917
48 Ga0097620_100090166 3300006931 Bacteria 3117
49 Ga0097620_100203827 3300006931 Bacteria 2063
50 Ga0111539_10082133 3300009094 Bacteria 3790
51 Ga0111539_10091041 3300009094 Bacteria 3584
52 Ga0105247_10039704 3300009101 Unclassified 2876
53 Ga0105248_10004089 3300009177 Bacteria 16136
54 Ga0105248_10092951 3300009177 Bacteria 3396
55 Ga0157375_10005210 3300013308 Bacteria 11281
56 Ga0157380_10057426 3300014326 Bacteria 3099
57 Ga0209025_1001386 3300025294 Bacteria 32347
58 Ga0207692_10001895 3300025898 Bacteria 7946
59 Ga0207693_10015338 3300025915 Bacteria 6149
60 Ga0207693_10058168 3300025915 Bacteria 3028
61 Ga0207663_10010259 3300025916 Bacteria 4979
62 Ga0207681_10056071 3300025923 Bacteria 2687
63 Ga0207650_10008422 3300025925 Bacteria 7039
64 Ga0207659_10000181 3300025926 Bacteria 37557
65 Ga0207659_10001137 3300025926 Bacteria 15794
66 Ga0207659_10049371 3300025926 Unclassified 2985
67 Ga0207664_10096209 3300025929 Unclassified 2437
68 Ga0207690_10045614 3300025932 Bacteria 2897
69 Ga0207665_10004664 3300025939 Bacteria 9106
70 Ga0207665_10020010 3300025939 Bacteria 4397
71 Ga0207691_10032038 3300025940 Bacteria 4904
72 Ga0207711_10011452 3300025941 Bacteria 7374
73 Ga0207689_10000779 3300025942 Bacteria 30598
74 Ga0207679_10002555 3300025945 Bacteria 11215
75 Ga0207658_10007575 3300025986 Bacteria 7396
76 Ga0207703_10011227 3300026035 Bacteria 6970
77 Ga0207678_10144060 3300026067 Bacteria 2034
78 Ga0207648_10050190 3300026089 Bacteria 3649
79 Ga0207676_10072243 3300026095 Bacteria 2773
80 Ga0268264_10005554 3300028381 Bacteria 10686
81 Ga0268264_10143533 3300028381 Bacteria 2132
82 Ga0265325_10000736 3300031241 Bacteria 23678
83 Ga0265339_10005391 3300031249 Bacteria 8520
84 Ga0265313_10000686 3300031595 Bacteria 34918
85 Ga0316575_10023263 3300031665 Bacteria 2394
86 Ga0316579_10000427 3300031691 Bacteria 13382
87 Ga0316576_10003232 3300031727 Bacteria 9504
88 Ga0316578_10025768 3300031728 Bacteria 3309
89 Ga0316578_10031383 3300031728 Bacteria 3027
90 Ga0316578_10036133 3300031728 Bacteria 2843
91 Ga0316577_10018965 3300031733 Bacteria 3806
92 Ga0307406_10135819 3300031901 Bacteria 1733
93 Ga0316583_10000718 3300032133 Bacteria 10287
94 Ga0316583_10002302 3300032133 Bacteria 6582
95 Ga0316585_10031085 3300032137 Bacteria 1678
96 Ga0373934_0000839 3300035086 Bacteria 11089
97 Ga0373952_0002268 3300035092 Bacteria 3461
98 Ga0373937_0010152 3300036401 Bacteria 8214
99 Ga0316582_0003726 3300036647 Bacteria 7547
100 Ga0316582_0014818 3300036647 Bacteria 4439
101 Ga0316584_0006079 3300036712 Bacteria 8157
102 Ga0316584_0009382 3300036712 Bacteria 6790
103 Ga0316584_0078876 3300036712 Bacteria 2466
104 Ga0395900_0115202 3300037418 Bacteria 2758
105 Ga0395898_0012864 3300037466 Bacteria 8633
106 Ga0395905_0025060 3300037471 Bacteria 5626
107 Ga0395905_0033494 3300037471 Bacteria 4826
108 Ga0395901_0005304 3300038443 Bacteria 13030
109 Ga0436360_0592313 3300039438 Bacteria 1350
110 Ga0436361_0050602 3300039447 Bacteria 2295
111 Ga0436361_0335402 3300039447 Bacteria 4530
112 Ga0436362_0045893 3300039453 Bacteria 2148
113 Ga0439435_0001092 3300042436 Bacteria 4828
114 Ga0439444_0000892 3300042437 Bacteria 3630
115 Ga0439464_0024047 3300042439 Bacteria 1684
116 Ga0451577_0005356 3300042876 Bacteria 13163
117 Ga0466965_0010751 3300044683 Bacteria 4280
118 Ga0466965_0024151 3300044683 Bacteria 2938
119 Ga0466966_0064198 3300044684 Bacteria 2312
120 Ga0466963_0001085 3300044694 Bacteria 14185
121 Ga0466964_0038737 3300044706 Bacteria 1918
122 Ga0453684_0056064 3300044712 Bacteria 5116
123 Ga0466971_0002251 3300044719 Bacteria 8165
124 Ga0466968_0020927 3300044735 Bacteria 2645
125 Ga0466957_0003603 3300044842 Bacteria 8543
126 Ga0466957_0015020 3300044842 Bacteria 4517
127 Ga0466959_0002162 3300045049 Bacteria 12486
128 Ga0451576_0052796 3300045051 Bacteria 4259
129 Ga0495603_0013841 3300046455 Bacteria 4883
130 Ga0495590_0000328 3300046457 Bacteria 24730
131 Ga0495629_0130406 3300046459 Bacteria 1751
132 Ga0495653_0048612 3300046463 Bacteria 3273
133 Ga0495580_0010594 3300046472 Bacteria 7173
134 Ga0495582_0003704 3300046473 Bacteria 8614
135 Ga0495582_0015829 3300046473 Bacteria 4136
136 Ga0495585_0008792 3300046492 Bacteria 6098
137 Ga0495594_0000145 3300046499 Bacteria 33824
138 Ga0495606_0086614 3300046507 Bacteria 1935
139 Ga0495628_0094865 3300046516 Bacteria 2306
140 Ga0495630_0021438 3300046517 Bacteria 4771
141 Ga0495666_0012720 3300046526 Bacteria 4193
142 Ga0495652_0003988 3300046529 Bacteria 14299
143 Ga0495665_0001627 3300046531 Bacteria 12023
144 Ga0495587_0018553 3300046536 Bacteria 4314
145 Ga0495634_0006576 3300046642 Bacteria 8817
146 Ga0495611_0008022 3300046648 Bacteria 4484
147 Ga0495623_0006445 3300046679 Bacteria 7635
148 Ga0495613_0064690 3300046689 Bacteria 2674
149 Ga0495670_0010157 3300046691 Bacteria 4633
150 Ga0495636_0001119 3300047318 Bacteria 10103
151 Ga0495636_0043506 3300047318 Bacteria 1869
152 Ga0495676_0043695 3300047321 Bacteria 3663
153 Ga0495675_0003643 3300047444 Bacteria 9303
154 Ga0495675_0009570 3300047444 Bacteria 6036
155 Ga0495675_0078938 3300047444 Bacteria 2073
156 Ga0496109_0187742 3300048912 Bacteria 1942
157 Ga0496114_0063288 3300048917 Bacteria 3097
158 Ga0496115_0020634 3300048918 Bacteria 5084
159 Ga0501031_0028852 3300049568 Bacteria 3617
160 Ga0501033_0000240 3300049570 Bacteria 52539
161 Ga0501033_0117972 3300049570 Bacteria 1928
162 Ga0501034_0112422 3300049571 Bacteria 2713
163 Ga0501036_0014013 3300049572 Bacteria 6664
164 Ga0501036_0130594 3300049572 Bacteria 2121
165 Ga0501037_0079995 3300049573 Bacteria 2372
166 Ga0501037_0118216 3300049573 Bacteria 1907
167 Ga0501037_0124903 3300049573 Bacteria 1848
168 Ga0501037_0178752 3300049573 Bacteria 1506
169 Ga0501039_0024353 3300049575 Bacteria 4649
170 Ga0501039_0036476 3300049575 Bacteria 3794
171 Ga0501039_0095779 3300049575 Bacteria 2314
172 Ga0501040_0018570 3300049576 Bacteria 4617
173 Ga0501040_0050341 3300049576 Bacteria 2849
174 Ga0501041_0143948 3300049577 Bacteria 1487
175 Ga0501042_0015357 3300049578 Bacteria 5241
176 Ga0501042_0026452 3300049578 Bacteria 4077
177 Ga0501043_0058447 3300049579 Bacteria 3027
178 Ga0501043_0094543 3300049579 Bacteria 2350
179 Ga0501043_0129515 3300049579 Bacteria 1978
180 Ga0501046_0032039 3300049580 Bacteria 4258
181 Ga0501046_0073597 3300049580 Bacteria 2651
182 Ga0501046_0078745 3300049580 Bacteria 2549
183 Ga0501047_0012243 3300049581 Bacteria 8123
184 Ga0501047_0224978 3300049581 Bacteria 1731
185 Ga0501048_0037932 3300049582 Bacteria 3460
186 Ga0501048_0048041 3300049582 Bacteria 3044
187 Ga0501048_0117019 3300049582 Bacteria 1883
188 Ga0501070_0113552 3300049586 Bacteria 2239
189 Ga0501071_0021087 3300049587 Bacteria 4536
190 Ga0501072_0011336 3300049588 Bacteria 6812
191 Ga0501072_0037368 3300049588 Bacteria 3808
192 Ga0501072_0061947 3300049588 Bacteria 2951
193 Ga0501072_0117959 3300049588 Bacteria 2114
194 Ga0501072_0168196 3300049588 Bacteria 1749
195 Ga0501074_0024040 3300049590 Bacteria 4428
196 Ga0501074_0055540 3300049590 Bacteria 2853
197 Ga0501075_0004332 3300049591 Bacteria 9605
198 Ga0501075_0019910 3300049591 Bacteria 4874
199 Ga0501075_0127535 3300049591 Bacteria 1937
200 Ga0501075_0158845 3300049591 Bacteria 1724
201 Ga0501076_0001512 3300049592 Bacteria 15578
202 Ga0501077_0001282 3300049593 Bacteria 15191
203 Ga0501077_0112838 3300049593 Bacteria 1723
204 Ga0501077_0131985 3300049593 Bacteria 1584
205 Ga0501079_0001898 3300049741 Bacteria 14977
206 Ga0501079_0035082 3300049741 Bacteria 3860
207 Ga0501079_0199817 3300049741 Bacteria 1561
208 Ga0501080_0041120 3300049742 Bacteria 4309
209 Ga0501080_0063394 3300049742 Bacteria 3440
210 Ga0501081_0001098 3300049743 Bacteria 16263
211 Ga0501081_0003916 3300049743 Bacteria 9538
212 Ga0501081_0072303 3300049743 Bacteria 2405
213 Ga0501035_0000659 3300049822 Bacteria 38046
214 Ga0501035_0199442 3300049822 Bacteria 1717
215 Ga0501044_0002072 3300049823 Bacteria 23112
216 Ga0501044_0024962 3300049823 Bacteria 6338
217 Ga0501044_0170362 3300049823 Bacteria 2149
218 Ga0501045_0031850 3300049824 Bacteria 3819
219 Ga0501045_0058060 3300049824 Bacteria 2833
220 Ga0501084_0022979 3300054114 Bacteria 5205
221 Ga0501084_0209170 3300054114 Bacteria 1646
222 Ga0501082_0047604 3300060353 Bacteria 3695
223 Ga0501082_0049567 3300060353 Bacteria 3622
224 Ga0530510_0002321 3300061734 Bacteria 13048
225 Ga0530510_0003836 3300061734 Bacteria 10361
226 Ga0530510_0209052 3300061734 Bacteria 1450
227 2513557674 2513237082 Bacteria 8640282
228 2513696681 2513237101 Bacteria 7952346
229 2729145116 2728369097 Bacteria 4333476
230 2889038677 2889033259 Bacteria 9099371
231 2891634850 2891633521 Bacteria 4602265
232 8054358253 8054357960 Bacteria 2867777
233 Ga0070672_100065341
234 rootH1_10084487
235 rootL2_10171042
236 Ga0065707_10158254
237 Ga0070670_100006460
238 Ga0068869_100015514
239 Ga0070666_10067753
240 Ga0070687_100049670
241 Ga0070675_100000061
242 Ga0070675_100002299
243 Ga0070675_100002356
244 Ga0070675_100149318
245 Ga0070688_100021688
246 Ga0070659_100051803
247 Ga0070667_100015231
248 Ga0070714_100080606
249 Ga0070713_100049397
250 Ga0070711_100017203
251 Ga0070705_100064918
252 Ga0070708_100239554
253 Ga0068867_100102514
254 Ga0070685_10015015
255 Ga0070685_10111583
256 Ga0070706_100050296
257 Ga0070698_100003284
258 Ga0070664_100037353
259 Ga0068859_100000802
260 Ga0068859_100004069
261 Ga0068859_100090166
262 Ga0068859_100203838
263 Ga0068864_100189635
264 Ga0068863_100000177
265 Ga0068863_100045339
266 Ga0068858_100006641
267 Ga0068860_100003362
268 Ga0081455_10010181
269 Ga0081455_10135283
270 Ga0081540_1000019
271 Ga0081540_1008654
272 Ga0070717_10005617
273 Ga0070715_10011017
274 Ga0070712_100013767
275 Ga0097621_100021192
276 Ga0068871_100069580
277 Ga0068871_100070418
278 Ga0097620_100000802
279 Ga0097620_100004069
280 Ga0097620_100090166
281 Ga0097620_100203827
282 Ga0111539_10082133
283 Ga0111539_10091041
284 Ga0105247_10039704
285 Ga0105248_10004089
286 Ga0105248_10092951
287 Ga0157375_10005210
288 Ga0157380_10057426
289 Ga0209025_1001386
290 Ga0207692_10001895
291 Ga0207693_10015338
292 Ga0207693_10058168
293 Ga0207663_10010259
294 Ga0207681_10056071
295 Ga0207650_10008422
296 Ga0207659_10000181
297 Ga0207659_10001137
298 Ga0207659_10049371
299 Ga0207664_10096209
300 Ga0207690_10045614
301 Ga0207665_10004664
302 Ga0207665_10020010
303 Ga0207691_10032038
304 Ga0207711_10011452
305 Ga0207689_10000779
306 Ga0207679_10002555
307 Ga0207658_10007575
308 Ga0207703_10011227
309 Ga0207678_10144060
310 Ga0207648_10050190
311 Ga0207676_10072243
312 Ga0268264_10005554
313 Ga0268264_10143533
314 Ga0265325_10000736
315 Ga0265339_10005391
316 Ga0265313_10000686
317 Ga0316575_10023263
318 Ga0316579_10000427
319 Ga0316576_10003232
320 Ga0316578_10025768
321 Ga0316578_10031383
322 Ga0316578_10036133
323 Ga0316577_10018965
324 Ga0307406_10135819
325 Ga0316583_10000718
326 Ga0316583_10002302
327 Ga0316585_10031085
328 Ga0373934_0000839
329 Ga0373952_0002268
330 Ga0373937_0010152
331 Ga0316582_0003726
332 Ga0316582_0014818
333 Ga0316584_0006079
334 Ga0316584_0009382
335 Ga0316584_0078876
336 Ga0395900_0115202
337 Ga0395898_0012864
338 Ga0395905_0025060
339 Ga0395905_0033494
340 Ga0395901_0005304
341 Ga0436360_0592313
342 Ga0436361_0050602
343 Ga0436361_0335402
344 Ga0436362_0045893
345 Ga0439435_0001092
346 Ga0439444_0000892
347 Ga0439464_0024047
348 Ga0451577_0005356
349 Ga0466965_0010751
350 Ga0466965_0024151
351 Ga0466966_0064198
352 Ga0466963_0001085
353 Ga0466964_0038737
354 Ga0453684_0056064
355 Ga0466971_0002251
356 Ga0466968_0020927
357 Ga0466957_0003603
358 Ga0466957_0015020
359 Ga0466959_0002162
360 Ga0451576_0052796
361 Ga0495603_0013841
362 Ga0495590_0000328
363 Ga0495629_0130406
364 Ga0495653_0048612
365 Ga0495580_0010594
366 Ga0495582_0003704
367 Ga0495582_0015829
368 Ga0495585_0008792
369 Ga0495594_0000145
370 Ga0495606_0086614
371 Ga0495628_0094865
372 Ga0495630_0021438
373 Ga0495666_0012720
374 Ga0495652_0003988
375 Ga0495665_0001627
376 Ga0495587_0018553
377 Ga0495634_0006576
378 Ga0495611_0008022
379 Ga0495623_0006445
380 Ga0495613_0064690
381 Ga0495670_0010157
382 Ga0495636_0001119
383 Ga0495636_0043506
384 Ga0495676_0043695
385 Ga0495675_0003643
386 Ga0495675_0009570
387 Ga0495675_0078938
388 Ga0496109_0187742
389 Ga0496114_0063288
390 Ga0496115_0020634
391 Ga0501031_0028852
392 Ga0501033_0000240
393 Ga0501033_0117972
394 Ga0501034_0112422
395 Ga0501036_0014013
396 Ga0501036_0130594
397 Ga0501037_0079995
398 Ga0501037_0118216
399 Ga0501037_0124903
400 Ga0501037_0178752
401 Ga0501039_0024353
402 Ga0501039_0036476
403 Ga0501039_0095779
404 Ga0501040_0018570
405 Ga0501040_0050341
406 Ga0501041_0143948
407 Ga0501042_0015357
408 Ga0501042_0026452
409 Ga0501043_0058447
410 Ga0501043_0094543
411 Ga0501043_0129515
412 Ga0501046_0032039
413 Ga0501046_0073597
414 Ga0501046_0078745
415 Ga0501047_0012243
416 Ga0501047_0224978
417 Ga0501048_0037932
418 Ga0501048_0048041
419 Ga0501048_0117019
420 Ga0501070_0113552
421 Ga0501071_0021087
422 Ga0501072_0011336
423 Ga0501072_0037368
424 Ga0501072_0061947
425 Ga0501072_0117959
426 Ga0501072_0168196
427 Ga0501074_0024040
428 Ga0501074_0055540
429 Ga0501075_0004332
430 Ga0501075_0019910
431 Ga0501075_0127535
432 Ga0501075_0158845
433 Ga0501076_0001512
434 Ga0501077_0001282
435 Ga0501077_0112838
436 Ga0501077_0131985
437 Ga0501079_0001898
438 Ga0501079_0035082
439 Ga0501079_0199817
440 Ga0501080_0041120
441 Ga0501080_0063394
442 Ga0501081_0001098
443 Ga0501081_0003916
444 Ga0501081_0072303
445 Ga0501035_0000659
446 Ga0501035_0199442
447 Ga0501044_0002072
448 Ga0501044_0024962
449 Ga0501044_0170362
450 Ga0501045_0031850
451 Ga0501045_0058060
452 Ga0501084_0022979
453 Ga0501084_0209170
454 Ga0501082_0047604
455 Ga0501082_0049567
456 Ga0530510_0002321
457 Ga0530510_0003836
458 Ga0530510_0209052
459 2513557674
460 2513696681
461 2729145116
462 2889038677
463 2891634850
464 8054358253

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17767

NAPRTase_N

Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain

35

158

0.99

PF04095

NAPRTase

Nicotinate phosphoribosyltransferase (NAPRTase) family

177

371

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mzy-assembly1.cif.gz_A crystal structure of enterococcus faecalis nicotinate phosphoribosyltransferase with malonate and phosphate bound 0.9057 11 457
4yub-assembly1.cif.gz_A crystal structure of human nicotinic acid phosphoribosyltransferase 0.8988 18 449
4yub-assembly1.cif.gz_B crystal structure of human nicotinic acid phosphoribosyltransferase 0.8847 18 450
2i14-assembly1.cif.gz_A crystal structure of nicotinate-nucleotide pyrophosphorylase from pyrococcus furiosus 0.8735 14 420
4mzy-assembly1.cif.gz_A crystal structure of enterococcus faecalis nicotinate phosphoribosyltransferase with malonate and phosphate bound 0.8559 11 457
ID Description Score Start End Superfamily
af_P9WJI7_150_316_3.20.140.10 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9756 159 324 3.20.140.10
af_Q851M0_172_232_3.20.140.10 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9742 156 215 3.20.140.10
af_Q55G10_66_572_3.20.140.10 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.963 20 442 3.20.140.10
af_C0PHJ7_17_175_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9557 11 151 3.90.1170.20
af_P9WJI7_150_316_3.20.140.10 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9527 159 324 3.20.140.10
ID Description Score Start End GO Terms
AF-A0A0K6H5Q0-F1-model_v4 deleted 0.9953 16 456
AF-A0A533Z6R2-F1-model_v4 Nicotinate phosphoribosyltransferase (EC 6.3.4.21) 0.9949 97 452 GO:0004516
GO:0005829
GO:0016757
GO:0034355
AF-A0A0H3HN39-F1-model_v4 Nicotinate phosphoribosyltransferase (EC 6.3.4.21) 0.9948 9 457 GO:0004516
GO:0005829
GO:0016757
GO:0034355
AF-A0A523NQ76-F1-model_v4 Nicotinate phosphoribosyltransferase (EC 6.3.4.21) 0.9947 11 450 GO:0004516
GO:0005829
GO:0016757
GO:0034355
AF-A0A3N9UYJ9-F1-model_v4 Nicotinate phosphoribosyltransferase 0.9939 16 139 GO:0004516
GO:0005829
GO:0016757
GO:0034355

Map