F344829

General Info

Members Datasets Scaffolds Average Seq Length
232 149 232 406

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100107338|Ga0070699_1001073382
Length 454
Sequence MRYRTQAGWLIRAAKIILCILGIPGVCALAQGAGHHRTAQLRFSSQASASPNAKAKRIVIACSKVLDGKGQVLHDALIVIEGSKIVALDLKAGKAGANAGPVDYDLRGLTVLPGWIDAHVHITWSFGKDGKNAGAGETTQEAAYQAASNAWLTLMAGFTTVQSVGSPTDVPLRDTIAKGKLPGPRILTAVEPLFGRGNETGTPDQIRAFVRKQKEAGADLIKIFAANSVRRNAMTLSQEQLNAACDEAKKQGLRTLVHAYKDAVRAAALAGCTQVEHGTLATDDDLKLMAQKGTWLDPQAGLVWENYLLNKEKFLGTPGFPEGSFAMIEGIISIYHDFMKQAVKIPGLKIVFGSDALAGAHGRNAEEFIDRVRDGGVDPMAAMVSANSLGAEALGMADQIGSIVPGQQADIIALDGDPLKDITAVRRVVFVMKGGIVYKNATRGAISVSASAHP

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.02
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000019 3300002459 Bacteria 107056
2 JGI25406J46586_10000615 3300003203 Bacteria 16710
3 Ga0065704_10145269 3300005289 Bacteria 1478
4 Ga0065712_10000140 3300005290 Bacteria 58055
5 Ga0065712_10070693 3300005290 Bacteria 5786
6 Ga0065712_10070913 3300005290 Bacteria 5604
7 Ga0065715_10006017 3300005293 Bacteria 6516
8 Ga0065715_10093482 3300005293 Bacteria 4664
9 Ga0065707_10106503 3300005295 Bacteria 2593
10 Ga0065707_10120619 3300005295 Unclassified 2130
11 Ga0070676_10042593 3300005328 Bacteria 2637
12 Ga0070676_10084205 3300005328 Bacteria 1936
13 Ga0070683_100259168 3300005329 Unclassified 1654
14 Ga0070690_100059874 3300005330 Unclassified 2449
15 Ga0070670_100000346 3300005331 Bacteria 38929
16 Ga0070670_100172640 3300005331 Unclassified 1875
17 Ga0070680_100001271 3300005336 Bacteria 18232
18 Ga0070680_100049073 3300005336 Bacteria 3441
19 Ga0070682_100025967 3300005337 Bacteria 3500
20 Ga0068868_100200400 3300005338 Unclassified 1664
21 Ga0070689_100000044 3300005340 Bacteria 76920
22 Ga0070689_100025574 3300005340 Unclassified 4436
23 Ga0070692_10030971 3300005345 Unclassified 2679
24 Ga0070692_10068660 3300005345 Bacteria 1884
25 Ga0070668_100032622 3300005347 Bacteria 3964
26 Ga0070669_100020290 3300005353 Plasmid 4746
27 Ga0070669_100233557 3300005353 Bacteria 1458
28 Ga0070675_100195902 3300005354 Unclassified 1752
29 Ga0070674_100015511 3300005356 Unclassified 4757
30 Ga0070673_100065867 3300005364 Bacteria 2892
31 Ga0070667_100138079 3300005367 Unclassified 2132
32 Ga0070711_100000035 3300005439 Bacteria 88475
33 Ga0070705_100027413 3300005440 Bacteria 3110
34 Ga0070700_100025087 3300005441 Bacteria 3508
35 Ga0070694_100001280 3300005444 Bacteria 14593
36 Ga0070694_100198126 3300005444 Bacteria 1495
37 Ga0070708_100056532 3300005445 Unclassified 3491
38 Ga0070708_100090694 3300005445 Bacteria 2782
39 Ga0070678_100152919 3300005456 Unclassified 1861
40 Ga0070681_10004797 3300005458 Bacteria 12960
41 Ga0068867_100026574 3300005459 Unclassified 4157
42 Ga0070706_100001280 3300005467 Bacteria 26834
43 Ga0070706_100035555 3300005467 Unclassified 4600
44 Ga0070707_100064220 3300005468 Bacteria 3525
45 Ga0070707_100183835 3300005468 Bacteria 2038
46 Ga0070698_100300091 3300005471 Bacteria 1537
47 Ga0070699_100019414 3300005518 Bacteria 5851
48 Ga0070699_100107338 3300005518 Bacteria 2449
49 Ga0070699_100174757 3300005518 Unclassified 1904
50 Ga0070679_100000307 3300005530 Bacteria 41692
51 Ga0070697_100000156 3300005536 Bacteria 55361
52 Ga0070697_100000943 3300005536 Bacteria 21867
53 Ga0070697_100001646 3300005536 Bacteria 17009
54 Ga0070697_100034749 3300005536 Unclassified 4065
55 Ga0068853_100037189 3300005539 Bacteria 4141
56 Ga0068853_100135391 3300005539 Bacteria 2208
57 Ga0070672_100044454 3300005543 Bacteria 3430
58 Ga0070693_100004201 3300005547 Bacteria 6802
59 Ga0070693_100015226 3300005547 Bacteria 3957
60 Ga0070693_100196990 3300005547 Bacteria 1306
61 Ga0070704_100049831 3300005549 Unclassified 2940
62 Ga0070664_100014043 3300005564 Bacteria 6532
63 Ga0070664_100020441 3300005564 Bacteria 5450
64 Ga0068857_100162204 3300005577 Bacteria 2029
65 Ga0070702_100009329 3300005615 Bacteria 4799
66 Ga0068859_100023604 3300005617 Bacteria 6172
67 Ga0068859_100036374 3300005617 Bacteria 4943
68 Ga0068859_100036887 3300005617 Bacteria 4907
69 Ga0068859_100064255 3300005617 Bacteria 3703
70 Ga0068859_100080476 3300005617 Unclassified 3298
71 Ga0068864_100082864 3300005618 Bacteria 2815
72 Ga0068864_100130781 3300005618 Unclassified 2254
73 Ga0068866_10003358 3300005718 Bacteria 6573
74 Ga0068861_100165677 3300005719 Bacteria 1827
75 Ga0068851_10035117 3300005834 Unclassified 2505
76 Ga0068870_10031829 3300005840 Bacteria 2675
77 Ga0068863_100008575 3300005841 Bacteria 9990
78 Ga0068863_100161662 3300005841 Unclassified 2146
79 Ga0068863_100207119 3300005841 Unclassified 1888
80 Ga0068862_100097177 3300005844 Bacteria 2571
81 Ga0081539_10000631 3300005985 Bacteria 71279
82 Ga0081539_10001725 3300005985 Bacteria 34954
83 Ga0081539_10032740 3300005985 Bacteria 3179
84 Ga0070717_10037063 3300006028 Bacteria 3958
85 Ga0070717_10059350 3300006028 Unclassified 3165
86 Ga0070716_100021373 3300006173 Bacteria 3409
87 Ga0070716_100035502 3300006173 Unclassified 2742
88 Ga0097621_100009441 3300006237 Bacteria 7080
89 Ga0068871_100008898 3300006358 Bacteria 7243
90 Ga0075428_100131412 3300006844 Unclassified 2723
91 Ga0075433_10093901 3300006852 Bacteria 2654
92 Ga0075433_10138393 3300006852 Unclassified 2164
93 Ga0075433_10148687 3300006852 Unclassified 2083
94 Ga0075434_100072776 3300006871 Unclassified 3429
95 Ga0075434_100223286 3300006871 Bacteria 1904
96 Ga0075436_100001578 3300006914 Bacteria 15562
97 Ga0075436_100032837 3300006914 Bacteria 3577
98 Ga0097620_100023604 3300006931 Bacteria 6172
99 Ga0097620_100036372 3300006931 Bacteria 4943
100 Ga0097620_100036888 3300006931 Bacteria 4907
101 Ga0097620_100064257 3300006931 Bacteria 3703
102 Ga0097620_100080470 3300006931 Unclassified 3298
103 Ga0075435_100011694 3300007076 Bacteria 6471
104 Ga0099794_10023872 3300007265 Unclassified 2801
105 Ga0105251_10108889 3300009011 Unclassified 1263
106 Ga0111539_10126776 3300009094 Bacteria 2990
107 Ga0111539_10194841 3300009094 Unclassified 2364
108 Ga0111539_10296591 3300009094 Bacteria 1881
109 Ga0111539_10314644 3300009094 Unclassified 1822
110 Ga0105245_10091219 3300009098 Unclassified 2804
111 Ga0105245_10342615 3300009098 Unclassified 1479
112 Ga0105247_10012659 3300009101 Bacteria 5063
113 Ga0114129_10010205 3300009147 Bacteria 13391
114 Ga0114129_10010560 3300009147 Bacteria 13168
115 Ga0114129_10066247 3300009147 Bacteria 5038
116 Ga0105243_10002037 3300009148 Bacteria 17142
117 Ga0105241_10027386 3300009174 Unclassified 4244
118 Ga0105241_10271478 3300009174 Bacteria 1445
119 Ga0105248_10229617 3300009177 Bacteria 2089
120 Ga0105248_10267885 3300009177 Unclassified 1923
121 Ga0105237_10007519 3300009545 Bacteria 11913
122 Ga0105237_10056337 3300009545 Bacteria 3935
123 Ga0105249_10014335 3300009553 Bacteria 7010
124 Ga0105249_10037982 3300009553 Unclassified 4370
125 Ga0105246_10016759 3300011119 Unclassified 4646
126 Ga0105246_10122387 3300011119 Bacteria 1930
127 Ga0157373_10014962 3300013100 Bacteria 5679
128 Ga0163162_10117066 3300013306 Bacteria 2766
129 Ga0157375_10170335 3300013308 Bacteria 2325
130 Ga0163163_10000214 3300014325 Bacteria 60034
131 Ga0163163_10042785 3300014325 Bacteria 4437
132 Ga0157380_10018304 3300014326 Bacteria 5199
133 Ga0157379_10018306 3300014968 Bacteria 6173
134 Ga0157379_10175567 3300014968 Unclassified 1934
135 Ga0207697_10003560 3300025315 Bacteria 7660
136 Ga0207656_10005286 3300025321 Bacteria 4554
137 Ga0207642_10013408 3300025899 Unclassified 2990
138 Ga0207710_10007269 3300025900 Bacteria 4693
139 Ga0207688_10006242 3300025901 Bacteria 6484
140 Ga0207647_10000659 3300025904 Bacteria 26975
141 Ga0207699_10000001 3300025906 Bacteria 695560
142 Ga0207645_10047186 3300025907 Bacteria 2750
143 Ga0207643_10043597 3300025908 Viruses 2532
144 Ga0207643_10110755 3300025908 Unclassified 1617
145 Ga0207684_10006642 3300025910 Bacteria 10514
146 Ga0207654_10041845 3300025911 Unclassified 2590
147 Ga0207707_10000006 3300025912 Bacteria 374131
148 Ga0207707_10127820 3300025912 Bacteria 2222
149 Ga0207695_10180274 3300025913 Bacteria 2033
150 Ga0207671_10000522 3300025914 Bacteria 51848
151 Ga0207693_10192057 3300025915 Bacteria 1607
152 Ga0207660_10002367 3300025917 Bacteria 12406
153 Ga0207660_10030880 3300025917 Bacteria 3685
154 Ga0207652_10001375 3300025921 Bacteria 21648
155 Ga0207646_10000042 3300025922 Bacteria 186121
156 Ga0207646_10159281 3300025922 Unclassified 2036
157 Ga0207681_10038466 3300025923 Plasmid 3170
158 Ga0207681_10105295 3300025923 Bacteria 2042
159 Ga0207694_10008849 3300025924 Bacteria 7593
160 Ga0207650_10000007 3300025925 Bacteria 530810
161 Ga0207650_10207773 3300025925 Bacteria 1571
162 Ga0207687_10047870 3300025927 Unclassified 2965
163 Ga0207700_10063687 3300025928 Unclassified 2806
164 Ga0207709_10003731 3300025935 Bacteria 8968
165 Ga0207670_10065829 3300025936 Bacteria 2488
166 Ga0207669_10194386 3300025937 Unclassified 1466
167 Ga0207665_10040359 3300025939 Unclassified 3114
168 Ga0207691_10008494 3300025940 Bacteria 9862
169 Ga0207711_10027100 3300025941 Bacteria 4811
170 Ga0207689_10124534 3300025942 Unclassified 2120
171 Ga0207679_10078985 3300025945 Bacteria 2508
172 Ga0207679_10089936 3300025945 Bacteria 2371
173 Ga0207712_10013261 3300025961 Bacteria 5282
174 Ga0207712_10018760 3300025961 Bacteria 4510
175 Ga0207668_10019576 3300025972 Bacteria 4282
176 Ga0207640_10093428 3300025981 Unclassified 2090
177 Ga0207708_10041314 3300026075 Bacteria 3516
178 Ga0207708_10234558 3300026075 Bacteria 1474
179 Ga0207641_10022370 3300026088 Bacteria 5204
180 Ga0207641_10049810 3300026088 Bacteria 3541
181 Ga0207641_10068966 3300026088 Bacteria 3034
182 Ga0207641_10273884 3300026088 Unclassified 1585
183 Ga0207648_10011205 3300026089 Bacteria 8453
184 Ga0207676_10053770 3300026095 Bacteria 3152
185 Ga0207676_10092056 3300026095 Unclassified 2492
186 Ga0207674_10049583 3300026116 Bacteria 4294
187 Ga0207674_10124084 3300026116 Bacteria 2548
188 Ga0207683_10002296 3300026121 Bacteria 16768
189 Ga0207428_10073781 3300027907 Bacteria 2676
190 Ga0268264_10102624 3300028381 Bacteria 2489
191 Ga0268264_10206051 3300028381 Bacteria 1802
192 Ga0265339_10061157 3300031249 Unclassified 2028
193 Ga0307405_10249401 3300031731 Bacteria 1320
194 Ga0307414_10026394 3300032004 Bacteria 3738
195 Ga0373951_0001564 3300035091 Bacteria 5986
196 Ga0373942_0000609 3300035207 Bacteria 10041
197 Ga0373931_0154532 3300035691 Unclassified 1340
198 Ga0373937_0056628 3300036401 Unclassified 3601
199 Ga0242420_001747 3300038996 Bacteria 2976
200 Ga0496102_0000436 3300048905 Bacteria 47697
201 Ga0496102_0027449 3300048905 Bacteria 5084
202 Ga0496103_0003177 3300048906 Bacteria 10099
203 Ga0496107_0014226 3300048910 Bacteria 5572
204 Ga0496112_0128758 3300048915 Bacteria 2502
205 Ga0496112_0140867 3300048915 Bacteria 2381
206 Ga0496112_0322552 3300048915 Unclassified 1489
207 Ga0501068_0064326 3300049584 Bacteria 2232
208 Ga0501069_0016417 3300049585 Bacteria 3978
209 Ga0501070_0000003 3300049586 Bacteria 339135
210 Ga0501073_0017049 3300049589 Bacteria 5262
211 Ga0501208_003522 3300049655 Bacteria 1763
212 Ga0501080_0020815 3300049742 Bacteria 6072
213 Ga0501080_0035483 3300049742 Bacteria 4653
214 Ga0501081_0049058 3300049743 Bacteria 2906
215 Ga0501083_0011222 3300049744 Bacteria 6287
216 Ga0501273_002323 3300049770 Bacteria 1922
217 nmdc:mga05p37_21722_c1 3300050507 Bacteria 7775
218 nmdc:mga05p37_45175_c1 3300050507 Bacteria 5419
219 nmdc:mga08y16_101829_c1 3300050511 Bacteria 2990
220 nmdc:mga08y16_19166_c1 3300050511 Bacteria 7210
221 nmdc:mga08y16_239951_c1 3300050511 Bacteria 1874
222 nmdc:mga0n895_11658_c1 3300050512 Bacteria 7852
223 nmdc:mga0n895_285258_c1 3300050512 Bacteria 1674
224 nmdc:mga0rr50_8253_c1 3300050513 Bacteria 6472
225 nmdc:mga08x19_24163_c1 3300050514 Bacteria 3773
226 nmdc:mga0a205_119300_c1 3300050515 Unclassified 2537
227 nmdc:mga0a205_13521_c1 3300050515 Bacteria 7602
228 nmdc:mga0a205_54045_c1 3300050515 Bacteria 3877
229 nmdc:mga0a205_72297_c1 3300050515 Bacteria 3332
230 Ga0501082_0073825 3300060353 Bacteria 2937
231 Ga0501082_0103138 3300060353 Bacteria 2467
232 Ga0501082_0179947 3300060353 Unclassified 1839

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025981 Ga0207640_10093428 Ga0207640_100934283 335
2 3300005329 Ga0070683_100259168 Ga0070683_1002591681 360
3 3300049585 Ga0501069_0016417 Ga0501069_0016417_772_2001 360
4 3300049586 Ga0501070_0000003 Ga0501070_0000003_49892_51121 360
5 3300049589 Ga0501073_0017049 Ga0501073_0017049_2115_3344 360
6 3300049742 Ga0501080_0035483 Ga0501080_0035483_1441_2670 360
7 3300049743 Ga0501081_0049058 Ga0501081_0049058_278_1507 360
8 3300049744 Ga0501083_0011222 Ga0501083_0011222_4622_5851 360
9 3300060353 Ga0501082_0103138 Ga0501082_0103138_719_1948 360
10 3300006173 Ga0070716_100035502 Ga0070716_1000355022 367
11 3300025939 Ga0207665_10040359 Ga0207665_100403592 367
12 3300005617 Ga0068859_100080476 Ga0068859_1000804765 369
13 3300006931 Ga0097620_100080470 Ga0097620_1000804705 369
14 3300006914 Ga0075436_100032837 Ga0075436_1000328372 372
15 3300050514 nmdc:mga08x19_24163_c1 nmdc:mga08x19_24163_c1_715_1842 372
16 3300025922 Ga0207646_10000042 Ga0207646_1000004233 376
17 3300014326 Ga0157380_10018304 Ga0157380_100183043 377
18 3300027907 Ga0207428_10073781 Ga0207428_100737812 377
19 3300031731 Ga0307405_10249401 Ga0307405_102494011 377
20 3300035691 Ga0373931_0154532 Ga0373931_0154532_111_1328 377
21 3300005564 Ga0070664_100014043 Ga0070664_1000140432 381
22 3300009177 Ga0105248_10267885 Ga0105248_102678851 381
23 3300009174 Ga0105241_10271478 Ga0105241_102714781 383
24 3300009545 Ga0105237_10056337 Ga0105237_100563372 383
25 3300048905 Ga0496102_0027449 Ga0496102_0027449_1208_2419 383
26 3300005468 Ga0070707_100183835 Ga0070707_1001838352 387
27 3300006871 Ga0075434_100072776 Ga0075434_1000727764 387
28 3300007076 Ga0075435_100011694 Ga0075435_1000116947 387
29 3300007265 Ga0099794_10023872 Ga0099794_100238722 387
30 3300050512 nmdc:mga0n895_11658_c1 nmdc:mga0n895_11658_c1_1247_2458 387
31 3300050513 nmdc:mga0rr50_8253_c1 nmdc:mga0rr50_8253_c1_2896_4107 387
32 3300009098 Ga0105245_10091219 Ga0105245_100912191 388
33 3300009174 Ga0105241_10027386 Ga0105241_100273862 388
34 3300014968 Ga0157379_10018306 Ga0157379_100183063 388
35 3300025904 Ga0207647_10000659 Ga0207647_1000065920 388
36 3300025911 Ga0207654_10041845 Ga0207654_100418451 388
37 3300025927 Ga0207687_10047870 Ga0207687_100478702 388
38 3300048905 Ga0496102_0000436 Ga0496102_0000436_25451_26698 388
39 3300048906 Ga0496103_0003177 Ga0496103_0003177_258_1505 388
40 3300048910 Ga0496107_0014226 Ga0496107_0014226_2760_4010 388
41 3300005539 Ga0068853_100037189 Ga0068853_1000371894 389
42 3300005615 Ga0070702_100009329 Ga0070702_1000093296 389
43 3300013308 Ga0157375_10170335 Ga0157375_101703352 389
44 3300009147 Ga0114129_10010560 Ga0114129_100105607 390
45 3300006852 Ga0075433_10148687 Ga0075433_101486871 391
46 3300009147 Ga0114129_10010205 Ga0114129_100102051 391
47 3300025925 Ga0207650_10207773 Ga0207650_102077731 391
48 3300031249 Ga0265339_10061157 Ga0265339_100611572 391
49 3300050507 nmdc:mga05p37_45175_c1 nmdc:mga05p37_45175_c1_2706_3920 391
50 3300050515 nmdc:mga0a205_13521_c1 nmdc:mga0a205_13521_c1_3674_4888 391
51 3300005618 Ga0068864_100082864 Ga0068864_1000828644 392
52 3300005841 Ga0068863_100161662 Ga0068863_1001616622 392
53 3300006852 Ga0075433_10138393 Ga0075433_101383932 392
54 3300014325 Ga0163163_10042785 Ga0163163_100427852 392
55 3300026088 Ga0207641_10273884 Ga0207641_102738842 392
56 3300026095 Ga0207676_10053770 Ga0207676_100537704 392
57 3300050515 nmdc:mga0a205_72297_c1 nmdc:mga0a205_72297_c1_266_1504 392
58 3300006852 Ga0075433_10093901 Ga0075433_100939011 394
59 3300050512 nmdc:mga0n895_285258_c1 nmdc:mga0n895_285258_c1_423_1643 394
60 3300050515 nmdc:mga0a205_54045_c1 nmdc:mga0a205_54045_c1_1303_2523 394
61 3300005617 Ga0068859_100023604 Ga0068859_1000236043 395
62 3300006931 Ga0097620_100023604 Ga0097620_1000236043 395
63 3300049584 Ga0501068_0064326 Ga0501068_0064326_907_2127 395
64 3300049742 Ga0501080_0020815 Ga0501080_0020815_4730_5950 395
65 3300060353 Ga0501082_0073825 Ga0501082_0073825_91_1311 395
66 3300032004 Ga0307414_10026394 Ga0307414_100263943 398
67 3300049655 Ga0501208_003522 Ga0501208_003522_503_1732 398
68 3300049770 Ga0501273_002323 Ga0501273_002323_681_1910 398
69 3300005471 Ga0070698_100300091 Ga0070698_1003000911 399
70 3300006028 Ga0070717_10037063 Ga0070717_100370633 399
71 3300005354 Ga0070675_100195902 Ga0070675_1001959022 400
72 3300006844 Ga0075428_100131412 Ga0075428_1001314122 400
73 3300005290 Ga0065712_10000140 Ga0065712_100001404 401
74 3300005293 Ga0065715_10093482 Ga0065715_100934824 401
75 3300005336 Ga0070680_100001271 Ga0070680_1000012714 401
76 3300005337 Ga0070682_100025967 Ga0070682_1000259672 401
77 3300005345 Ga0070692_10068660 Ga0070692_100686601 401
78 3300005440 Ga0070705_100027413 Ga0070705_1000274132 401
79 3300005444 Ga0070694_100001280 Ga0070694_1000012803 401
80 3300005444 Ga0070694_100198126 Ga0070694_1001981261 401
81 3300005458 Ga0070681_10004797 Ga0070681_100047975 401
82 3300005530 Ga0070679_100000307 Ga0070679_1000003074 401
83 3300005547 Ga0070693_100015226 Ga0070693_1000152262 401
84 3300005834 Ga0068851_10035117 Ga0068851_100351171 401
85 3300005985 Ga0081539_10032740 Ga0081539_100327404 401
86 3300006871 Ga0075434_100223286 Ga0075434_1002232862 401
87 3300009094 Ga0111539_10194841 Ga0111539_101948412 401
88 3300009098 Ga0105245_10342615 Ga0105245_103426151 401
89 3300009545 Ga0105237_10007519 Ga0105237_1000751913 401
90 3300025321 Ga0207656_10005286 Ga0207656_100052862 401
91 3300025912 Ga0207707_10000006 Ga0207707_10000006204 401
92 3300025913 Ga0207695_10180274 Ga0207695_101802742 401
93 3300025914 Ga0207671_10000522 Ga0207671_100005229 401
94 3300025917 Ga0207660_10002367 Ga0207660_100023675 401
95 3300025921 Ga0207652_10001375 Ga0207652_100013753 401
96 3300025961 Ga0207712_10018760 Ga0207712_100187602 401
97 3300026088 Ga0207641_10068966 Ga0207641_100689662 401
98 3300050511 nmdc:mga08y16_239951_c1 nmdc:mga08y16_239951_c1_596_1819 401
99 3300005295 Ga0065707_10106503 Ga0065707_101065033 402
100 3300005468 Ga0070707_100064220 Ga0070707_1000642203 402
101 3300005518 Ga0070699_100019414 Ga0070699_1000194143 402
102 3300005536 Ga0070697_100034749 Ga0070697_1000347493 402
103 3300005549 Ga0070704_100049831 Ga0070704_1000498312 402
104 3300006237 Ga0097621_100009441 Ga0097621_1000094417 402
105 3300006358 Ga0068871_100008898 Ga0068871_1000088983 402
106 3300009094 Ga0111539_10296591 Ga0111539_102965911 402
107 3300026088 Ga0207641_10049810 Ga0207641_100498103 402
108 3300048915 Ga0496112_0322552 Ga0496112_0322552_226_1470 402
109 3300050511 nmdc:mga08y16_19166_c1 nmdc:mga08y16_19166_c1_1586_2794 402
110 3300005295 Ga0065707_10120619 Ga0065707_101206191 403
111 3300005328 Ga0070676_10042593 Ga0070676_100425932 403
112 3300005336 Ga0070680_100049073 Ga0070680_1000490733 403
113 3300005353 Ga0070669_100020290 Ga0070669_1000202903 403
114 3300005441 Ga0070700_100025087 Ga0070700_1000250872 403
115 3300005459 Ga0068867_100026574 Ga0068867_1000265744 403
116 3300005577 Ga0068857_100162204 Ga0068857_1001622042 403
117 3300005719 Ga0068861_100165677 Ga0068861_1001656772 403
118 3300009011 Ga0105251_10108889 Ga0105251_101088891 403
119 3300009148 Ga0105243_10002037 Ga0105243_1000203710 403
120 3300009553 Ga0105249_10014335 Ga0105249_100143353 403
121 3300011119 Ga0105246_10122387 Ga0105246_101223872 403
122 3300025907 Ga0207645_10047186 Ga0207645_100471862 403
123 3300025917 Ga0207660_10030880 Ga0207660_100308803 403
124 3300025922 Ga0207646_10159281 Ga0207646_101592813 403
125 3300025923 Ga0207681_10038466 Ga0207681_100384664 403
126 3300025935 Ga0207709_10003731 Ga0207709_100037316 403
127 3300026075 Ga0207708_10041314 Ga0207708_100413142 403
128 3300026075 Ga0207708_10234558 Ga0207708_102345581 403
129 3300026095 Ga0207676_10092056 Ga0207676_100920562 403
130 3300005289 Ga0065704_10145269 Ga0065704_101452691 404
131 3300005290 Ga0065712_10070693 Ga0065712_100706932 404
132 3300005330 Ga0070690_100059874 Ga0070690_1000598742 404
133 3300005564 Ga0070664_100020441 Ga0070664_1000204413 404
134 3300005718 Ga0068866_10003358 Ga0068866_100033585 404
135 3300009094 Ga0111539_10126776 Ga0111539_101267762 404
136 3300009094 Ga0111539_10314644 Ga0111539_103146442 404
137 3300009147 Ga0114129_10066247 Ga0114129_100662472 404
138 3300009553 Ga0105249_10037982 Ga0105249_100379824 404
139 3300014968 Ga0157379_10175567 Ga0157379_101755672 404
140 3300025899 Ga0207642_10013408 Ga0207642_100134082 404
141 3300025945 Ga0207679_10089936 Ga0207679_100899363 404
142 3300025961 Ga0207712_10013261 Ga0207712_100132615 404
143 3300050507 nmdc:mga05p37_21722_c1 nmdc:mga05p37_21722_c1_3590_4825 404
144 3300050511 nmdc:mga08y16_101829_c1 nmdc:mga08y16_101829_c1_754_1998 404
145 3300060353 Ga0501082_0179947 Ga0501082_0179947_348_1577 405
146 3300003203 JGI25406J46586_10000615 JGI25406J46586_100006159 406
147 3300005841 Ga0068863_100207119 Ga0068863_1002071192 406
148 3300005844 Ga0068862_100097177 Ga0068862_1000971772 406
149 3300005985 Ga0081539_10000631 Ga0081539_1000063157 406
150 3300025908 Ga0207643_10110755 Ga0207643_101107551 406
151 3300025942 Ga0207689_10124534 Ga0207689_101245343 406
152 3300026116 Ga0207674_10124084 Ga0207674_101240841 406
153 3300050515 nmdc:mga0a205_119300_c1 nmdc:mga0a205_119300_c1_243_1469 406
154 3300005290 Ga0065712_10070913 Ga0065712_100709138 407
155 3300005293 Ga0065715_10006017 Ga0065715_100060172 407
156 3300005328 Ga0070676_10084205 Ga0070676_100842052 407
157 3300005340 Ga0070689_100000044 Ga0070689_10000004410 407
158 3300005539 Ga0068853_100135391 Ga0068853_1001353911 407
159 3300005547 Ga0070693_100196990 Ga0070693_1001969901 407
160 3300005617 Ga0068859_100036374 Ga0068859_1000363748 407
161 3300005618 Ga0068864_100130781 Ga0068864_1001307813 407
162 3300005841 Ga0068863_100008575 Ga0068863_1000085758 407
163 3300006173 Ga0070716_100021373 Ga0070716_1000213733 407
164 3300006931 Ga0097620_100036372 Ga0097620_1000363728 407
165 3300009101 Ga0105247_10012659 Ga0105247_100126593 407
166 3300025900 Ga0207710_10007269 Ga0207710_100072693 407
167 3300025906 Ga0207699_10000001 Ga0207699_1000000171 407
168 3300025908 Ga0207643_10043597 Ga0207643_100435972 407
169 3300025936 Ga0207670_10065829 Ga0207670_100658293 407
170 3300026088 Ga0207641_10022370 Ga0207641_100223706 407
171 3300028381 Ga0268264_10102624 Ga0268264_101026242 407
172 3300028381 Ga0268264_10206051 Ga0268264_102060512 407
173 3300005345 Ga0070692_10030971 Ga0070692_100309713 408
174 3300005439 Ga0070711_100000035 Ga0070711_10000003582 408
175 3300005445 Ga0070708_100090694 Ga0070708_1000906942 408
176 3300005840 Ga0068870_10031829 Ga0068870_100318293 408
177 3300006914 Ga0075436_100001578 Ga0075436_1000015784 408
178 3300011119 Ga0105246_10016759 Ga0105246_100167594 408
179 3300013100 Ga0157373_10014962 Ga0157373_100149624 408
180 3300013306 Ga0163162_10117066 Ga0163162_101170663 408
181 3300025924 Ga0207694_10008849 Ga0207694_100088498 408
182 3300035207 Ga0373942_0000609 Ga0373942_0000609_7048_8277 408
183 3300048915 Ga0496112_0128758 Ga0496112_0128758_869_2098 408
184 3300002459 JGI24751J29686_10000019 JGI24751J29686_1000001960 409
185 3300005331 Ga0070670_100000346 Ga0070670_10000034630 409
186 3300005331 Ga0070670_100172640 Ga0070670_1001726402 409
187 3300005338 Ga0068868_100200400 Ga0068868_1002004001 409
188 3300005340 Ga0070689_100025574 Ga0070689_1000255741 409
189 3300005347 Ga0070668_100032622 Ga0070668_1000326226 409
190 3300005353 Ga0070669_100233557 Ga0070669_1002335571 409
191 3300005356 Ga0070674_100015511 Ga0070674_1000155113 409
192 3300005364 Ga0070673_100065867 Ga0070673_1000658672 409
193 3300005367 Ga0070667_100138079 Ga0070667_1001380792 409
194 3300005445 Ga0070708_100056532 Ga0070708_1000565322 409
195 3300005456 Ga0070678_100152919 Ga0070678_1001529192 409
196 3300005467 Ga0070706_100001280 Ga0070706_10000128016 409
197 3300005467 Ga0070706_100035555 Ga0070706_1000355554 409
198 3300005518 Ga0070699_100107338 Ga0070699_1001073382 409
199 3300005518 Ga0070699_100174757 Ga0070699_1001747571 409
200 3300005536 Ga0070697_100000156 Ga0070697_10000015623 409
201 3300005536 Ga0070697_100000943 Ga0070697_10000094322 409
202 3300005536 Ga0070697_100001646 Ga0070697_10000164611 409
203 3300005543 Ga0070672_100044454 Ga0070672_1000444543 409
204 3300005547 Ga0070693_100004201 Ga0070693_1000042014 409
205 3300005617 Ga0068859_100036887 Ga0068859_1000368873 409
206 3300005617 Ga0068859_100064255 Ga0068859_1000642552 409
207 3300005985 Ga0081539_10001725 Ga0081539_100017254 409
208 3300006028 Ga0070717_10059350 Ga0070717_100593501 409
209 3300006931 Ga0097620_100036888 Ga0097620_1000368883 409
210 3300006931 Ga0097620_100064257 Ga0097620_1000642574 409
211 3300009177 Ga0105248_10229617 Ga0105248_102296172 409
212 3300014325 Ga0163163_10000214 Ga0163163_100002149 409
213 3300025315 Ga0207697_10003560 Ga0207697_100035605 409
214 3300025901 Ga0207688_10006242 Ga0207688_100062426 409
215 3300025910 Ga0207684_10006642 Ga0207684_100066423 409
216 3300025912 Ga0207707_10127820 Ga0207707_101278203 409
217 3300025915 Ga0207693_10192057 Ga0207693_101920571 409
218 3300025923 Ga0207681_10105295 Ga0207681_101052952 409
219 3300025925 Ga0207650_10000007 Ga0207650_10000007145 409
220 3300025928 Ga0207700_10063687 Ga0207700_100636872 409
221 3300025937 Ga0207669_10194386 Ga0207669_101943861 409
222 3300025940 Ga0207691_10008494 Ga0207691_100084943 409
223 3300025941 Ga0207711_10027100 Ga0207711_100271007 409
224 3300025945 Ga0207679_10078985 Ga0207679_100789852 409
225 3300025972 Ga0207668_10019576 Ga0207668_100195761 409
226 3300026089 Ga0207648_10011205 Ga0207648_100112056 409
227 3300026116 Ga0207674_10049583 Ga0207674_100495833 409
228 3300026121 Ga0207683_10002296 Ga0207683_100022961 409
229 3300035091 Ga0373951_0001564 Ga0373951_0001564_892_2127 409
230 3300036401 Ga0373937_0056628 Ga0373937_0056628_428_1699 409
231 3300038996 Ga0242420_001747 Ga0242420_001747_1655_2899 409
232 3300048915 Ga0496112_0140867 Ga0496112_0140867_622_1896 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

110

437

0.8

PF07969

Amidohydro_3

Amidohydrolase family

170

438

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mtw-assembly1.cif.gz_A crystal structure of l-lysine, l-arginine carboxypeptidase cc2672 from caulobacter crescentus cb15 complexed with n-methyl phosphonate derivative of l-arginine 0.9016 30 407
2qs8-assembly1.cif.gz_A crystal structure of a xaa-pro dipeptidase with bound methionine in the active site 0.8919 30 406
8ihq-assembly1.cif.gz_D cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 0.8804 32 407
8j85-assembly1.cif.gz_A cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 mutant s88e in complex with ochratoxin a 0.8801 32 407
3feq-assembly2.cif.gz_J crystal structure of uncharacterized protein eah89906 0.8757 30 408
ID Description Score Start End Superfamily
3be7A01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9533 368 409 2.30.40.10
2p9bA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9439 370 405 2.30.40.10
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8816 364 407 2.30.40.10
2p9bA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Amidohydrolase 0.8508 168 256 3.40.50.10910
af_P40896_13_285_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8461 116 363 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7Y5QPC8-F1-model_v4 Amidohydrolase family protein 0.9766 214 409 GO:0016810
AF-A0A2V7M297-F1-model_v4 Amidohydrolase 0.9732 249 407 GO:0016810
AF-A0A2V9G2D5-F1-model_v4 Amidohydrolase 0.9678 22 361 GO:0016810
AF-A0A1Q7TM24-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9637 56 406 GO:0016810
AF-A0A7Y5PC35-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9632 32 407 GO:0006508
GO:0008236
GO:0016810

Feature Viewer

pLDDT pTM Quality
92.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map