F344829
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 149 | 232 | 406 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100107338|Ga0070699_1001073382 |
| Length | 454 |
| Sequence | MRYRTQAGWLIRAAKIILCILGIPGVCALAQGAGHHRTAQLRFSSQASASPNAKAKRIVIACSKVLDGKGQVLHDALIVIEGSKIVALDLKAGKAGANAGPVDYDLRGLTVLPGWIDAHVHITWSFGKDGKNAGAGETTQEAAYQAASNAWLTLMAGFTTVQSVGSPTDVPLRDTIAKGKLPGPRILTAVEPLFGRGNETGTPDQIRAFVRKQKEAGADLIKIFAANSVRRNAMTLSQEQLNAACDEAKKQGLRTLVHAYKDAVRAAALAGCTQVEHGTLATDDDLKLMAQKGTWLDPQAGLVWENYLLNKEKFLGTPGFPEGSFAMIEGIISIYHDFMKQAVKIPGLKIVFGSDALAGAHGRNAEEFIDRVRDGGVDPMAAMVSANSLGAEALGMADQIGSIVPGQQADIIALDGDPLKDITAVRRVVFVMKGGIVYKNATRGAISVSASAHP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 139 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 143 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.02 |
| Rhizosphere | 96.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000019 | 3300002459 | Bacteria | 107056 |
| 2 | JGI25406J46586_10000615 | 3300003203 | Bacteria | 16710 |
| 3 | Ga0065704_10145269 | 3300005289 | Bacteria | 1478 |
| 4 | Ga0065712_10000140 | 3300005290 | Bacteria | 58055 |
| 5 | Ga0065712_10070693 | 3300005290 | Bacteria | 5786 |
| 6 | Ga0065712_10070913 | 3300005290 | Bacteria | 5604 |
| 7 | Ga0065715_10006017 | 3300005293 | Bacteria | 6516 |
| 8 | Ga0065715_10093482 | 3300005293 | Bacteria | 4664 |
| 9 | Ga0065707_10106503 | 3300005295 | Bacteria | 2593 |
| 10 | Ga0065707_10120619 | 3300005295 | Unclassified | 2130 |
| 11 | Ga0070676_10042593 | 3300005328 | Bacteria | 2637 |
| 12 | Ga0070676_10084205 | 3300005328 | Bacteria | 1936 |
| 13 | Ga0070683_100259168 | 3300005329 | Unclassified | 1654 |
| 14 | Ga0070690_100059874 | 3300005330 | Unclassified | 2449 |
| 15 | Ga0070670_100000346 | 3300005331 | Bacteria | 38929 |
| 16 | Ga0070670_100172640 | 3300005331 | Unclassified | 1875 |
| 17 | Ga0070680_100001271 | 3300005336 | Bacteria | 18232 |
| 18 | Ga0070680_100049073 | 3300005336 | Bacteria | 3441 |
| 19 | Ga0070682_100025967 | 3300005337 | Bacteria | 3500 |
| 20 | Ga0068868_100200400 | 3300005338 | Unclassified | 1664 |
| 21 | Ga0070689_100000044 | 3300005340 | Bacteria | 76920 |
| 22 | Ga0070689_100025574 | 3300005340 | Unclassified | 4436 |
| 23 | Ga0070692_10030971 | 3300005345 | Unclassified | 2679 |
| 24 | Ga0070692_10068660 | 3300005345 | Bacteria | 1884 |
| 25 | Ga0070668_100032622 | 3300005347 | Bacteria | 3964 |
| 26 | Ga0070669_100020290 | 3300005353 | Plasmid | 4746 |
| 27 | Ga0070669_100233557 | 3300005353 | Bacteria | 1458 |
| 28 | Ga0070675_100195902 | 3300005354 | Unclassified | 1752 |
| 29 | Ga0070674_100015511 | 3300005356 | Unclassified | 4757 |
| 30 | Ga0070673_100065867 | 3300005364 | Bacteria | 2892 |
| 31 | Ga0070667_100138079 | 3300005367 | Unclassified | 2132 |
| 32 | Ga0070711_100000035 | 3300005439 | Bacteria | 88475 |
| 33 | Ga0070705_100027413 | 3300005440 | Bacteria | 3110 |
| 34 | Ga0070700_100025087 | 3300005441 | Bacteria | 3508 |
| 35 | Ga0070694_100001280 | 3300005444 | Bacteria | 14593 |
| 36 | Ga0070694_100198126 | 3300005444 | Bacteria | 1495 |
| 37 | Ga0070708_100056532 | 3300005445 | Unclassified | 3491 |
| 38 | Ga0070708_100090694 | 3300005445 | Bacteria | 2782 |
| 39 | Ga0070678_100152919 | 3300005456 | Unclassified | 1861 |
| 40 | Ga0070681_10004797 | 3300005458 | Bacteria | 12960 |
| 41 | Ga0068867_100026574 | 3300005459 | Unclassified | 4157 |
| 42 | Ga0070706_100001280 | 3300005467 | Bacteria | 26834 |
| 43 | Ga0070706_100035555 | 3300005467 | Unclassified | 4600 |
| 44 | Ga0070707_100064220 | 3300005468 | Bacteria | 3525 |
| 45 | Ga0070707_100183835 | 3300005468 | Bacteria | 2038 |
| 46 | Ga0070698_100300091 | 3300005471 | Bacteria | 1537 |
| 47 | Ga0070699_100019414 | 3300005518 | Bacteria | 5851 |
| 48 | Ga0070699_100107338 | 3300005518 | Bacteria | 2449 |
| 49 | Ga0070699_100174757 | 3300005518 | Unclassified | 1904 |
| 50 | Ga0070679_100000307 | 3300005530 | Bacteria | 41692 |
| 51 | Ga0070697_100000156 | 3300005536 | Bacteria | 55361 |
| 52 | Ga0070697_100000943 | 3300005536 | Bacteria | 21867 |
| 53 | Ga0070697_100001646 | 3300005536 | Bacteria | 17009 |
| 54 | Ga0070697_100034749 | 3300005536 | Unclassified | 4065 |
| 55 | Ga0068853_100037189 | 3300005539 | Bacteria | 4141 |
| 56 | Ga0068853_100135391 | 3300005539 | Bacteria | 2208 |
| 57 | Ga0070672_100044454 | 3300005543 | Bacteria | 3430 |
| 58 | Ga0070693_100004201 | 3300005547 | Bacteria | 6802 |
| 59 | Ga0070693_100015226 | 3300005547 | Bacteria | 3957 |
| 60 | Ga0070693_100196990 | 3300005547 | Bacteria | 1306 |
| 61 | Ga0070704_100049831 | 3300005549 | Unclassified | 2940 |
| 62 | Ga0070664_100014043 | 3300005564 | Bacteria | 6532 |
| 63 | Ga0070664_100020441 | 3300005564 | Bacteria | 5450 |
| 64 | Ga0068857_100162204 | 3300005577 | Bacteria | 2029 |
| 65 | Ga0070702_100009329 | 3300005615 | Bacteria | 4799 |
| 66 | Ga0068859_100023604 | 3300005617 | Bacteria | 6172 |
| 67 | Ga0068859_100036374 | 3300005617 | Bacteria | 4943 |
| 68 | Ga0068859_100036887 | 3300005617 | Bacteria | 4907 |
| 69 | Ga0068859_100064255 | 3300005617 | Bacteria | 3703 |
| 70 | Ga0068859_100080476 | 3300005617 | Unclassified | 3298 |
| 71 | Ga0068864_100082864 | 3300005618 | Bacteria | 2815 |
| 72 | Ga0068864_100130781 | 3300005618 | Unclassified | 2254 |
| 73 | Ga0068866_10003358 | 3300005718 | Bacteria | 6573 |
| 74 | Ga0068861_100165677 | 3300005719 | Bacteria | 1827 |
| 75 | Ga0068851_10035117 | 3300005834 | Unclassified | 2505 |
| 76 | Ga0068870_10031829 | 3300005840 | Bacteria | 2675 |
| 77 | Ga0068863_100008575 | 3300005841 | Bacteria | 9990 |
| 78 | Ga0068863_100161662 | 3300005841 | Unclassified | 2146 |
| 79 | Ga0068863_100207119 | 3300005841 | Unclassified | 1888 |
| 80 | Ga0068862_100097177 | 3300005844 | Bacteria | 2571 |
| 81 | Ga0081539_10000631 | 3300005985 | Bacteria | 71279 |
| 82 | Ga0081539_10001725 | 3300005985 | Bacteria | 34954 |
| 83 | Ga0081539_10032740 | 3300005985 | Bacteria | 3179 |
| 84 | Ga0070717_10037063 | 3300006028 | Bacteria | 3958 |
| 85 | Ga0070717_10059350 | 3300006028 | Unclassified | 3165 |
| 86 | Ga0070716_100021373 | 3300006173 | Bacteria | 3409 |
| 87 | Ga0070716_100035502 | 3300006173 | Unclassified | 2742 |
| 88 | Ga0097621_100009441 | 3300006237 | Bacteria | 7080 |
| 89 | Ga0068871_100008898 | 3300006358 | Bacteria | 7243 |
| 90 | Ga0075428_100131412 | 3300006844 | Unclassified | 2723 |
| 91 | Ga0075433_10093901 | 3300006852 | Bacteria | 2654 |
| 92 | Ga0075433_10138393 | 3300006852 | Unclassified | 2164 |
| 93 | Ga0075433_10148687 | 3300006852 | Unclassified | 2083 |
| 94 | Ga0075434_100072776 | 3300006871 | Unclassified | 3429 |
| 95 | Ga0075434_100223286 | 3300006871 | Bacteria | 1904 |
| 96 | Ga0075436_100001578 | 3300006914 | Bacteria | 15562 |
| 97 | Ga0075436_100032837 | 3300006914 | Bacteria | 3577 |
| 98 | Ga0097620_100023604 | 3300006931 | Bacteria | 6172 |
| 99 | Ga0097620_100036372 | 3300006931 | Bacteria | 4943 |
| 100 | Ga0097620_100036888 | 3300006931 | Bacteria | 4907 |
| 101 | Ga0097620_100064257 | 3300006931 | Bacteria | 3703 |
| 102 | Ga0097620_100080470 | 3300006931 | Unclassified | 3298 |
| 103 | Ga0075435_100011694 | 3300007076 | Bacteria | 6471 |
| 104 | Ga0099794_10023872 | 3300007265 | Unclassified | 2801 |
| 105 | Ga0105251_10108889 | 3300009011 | Unclassified | 1263 |
| 106 | Ga0111539_10126776 | 3300009094 | Bacteria | 2990 |
| 107 | Ga0111539_10194841 | 3300009094 | Unclassified | 2364 |
| 108 | Ga0111539_10296591 | 3300009094 | Bacteria | 1881 |
| 109 | Ga0111539_10314644 | 3300009094 | Unclassified | 1822 |
| 110 | Ga0105245_10091219 | 3300009098 | Unclassified | 2804 |
| 111 | Ga0105245_10342615 | 3300009098 | Unclassified | 1479 |
| 112 | Ga0105247_10012659 | 3300009101 | Bacteria | 5063 |
| 113 | Ga0114129_10010205 | 3300009147 | Bacteria | 13391 |
| 114 | Ga0114129_10010560 | 3300009147 | Bacteria | 13168 |
| 115 | Ga0114129_10066247 | 3300009147 | Bacteria | 5038 |
| 116 | Ga0105243_10002037 | 3300009148 | Bacteria | 17142 |
| 117 | Ga0105241_10027386 | 3300009174 | Unclassified | 4244 |
| 118 | Ga0105241_10271478 | 3300009174 | Bacteria | 1445 |
| 119 | Ga0105248_10229617 | 3300009177 | Bacteria | 2089 |
| 120 | Ga0105248_10267885 | 3300009177 | Unclassified | 1923 |
| 121 | Ga0105237_10007519 | 3300009545 | Bacteria | 11913 |
| 122 | Ga0105237_10056337 | 3300009545 | Bacteria | 3935 |
| 123 | Ga0105249_10014335 | 3300009553 | Bacteria | 7010 |
| 124 | Ga0105249_10037982 | 3300009553 | Unclassified | 4370 |
| 125 | Ga0105246_10016759 | 3300011119 | Unclassified | 4646 |
| 126 | Ga0105246_10122387 | 3300011119 | Bacteria | 1930 |
| 127 | Ga0157373_10014962 | 3300013100 | Bacteria | 5679 |
| 128 | Ga0163162_10117066 | 3300013306 | Bacteria | 2766 |
| 129 | Ga0157375_10170335 | 3300013308 | Bacteria | 2325 |
| 130 | Ga0163163_10000214 | 3300014325 | Bacteria | 60034 |
| 131 | Ga0163163_10042785 | 3300014325 | Bacteria | 4437 |
| 132 | Ga0157380_10018304 | 3300014326 | Bacteria | 5199 |
| 133 | Ga0157379_10018306 | 3300014968 | Bacteria | 6173 |
| 134 | Ga0157379_10175567 | 3300014968 | Unclassified | 1934 |
| 135 | Ga0207697_10003560 | 3300025315 | Bacteria | 7660 |
| 136 | Ga0207656_10005286 | 3300025321 | Bacteria | 4554 |
| 137 | Ga0207642_10013408 | 3300025899 | Unclassified | 2990 |
| 138 | Ga0207710_10007269 | 3300025900 | Bacteria | 4693 |
| 139 | Ga0207688_10006242 | 3300025901 | Bacteria | 6484 |
| 140 | Ga0207647_10000659 | 3300025904 | Bacteria | 26975 |
| 141 | Ga0207699_10000001 | 3300025906 | Bacteria | 695560 |
| 142 | Ga0207645_10047186 | 3300025907 | Bacteria | 2750 |
| 143 | Ga0207643_10043597 | 3300025908 | Viruses | 2532 |
| 144 | Ga0207643_10110755 | 3300025908 | Unclassified | 1617 |
| 145 | Ga0207684_10006642 | 3300025910 | Bacteria | 10514 |
| 146 | Ga0207654_10041845 | 3300025911 | Unclassified | 2590 |
| 147 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 148 | Ga0207707_10127820 | 3300025912 | Bacteria | 2222 |
| 149 | Ga0207695_10180274 | 3300025913 | Bacteria | 2033 |
| 150 | Ga0207671_10000522 | 3300025914 | Bacteria | 51848 |
| 151 | Ga0207693_10192057 | 3300025915 | Bacteria | 1607 |
| 152 | Ga0207660_10002367 | 3300025917 | Bacteria | 12406 |
| 153 | Ga0207660_10030880 | 3300025917 | Bacteria | 3685 |
| 154 | Ga0207652_10001375 | 3300025921 | Bacteria | 21648 |
| 155 | Ga0207646_10000042 | 3300025922 | Bacteria | 186121 |
| 156 | Ga0207646_10159281 | 3300025922 | Unclassified | 2036 |
| 157 | Ga0207681_10038466 | 3300025923 | Plasmid | 3170 |
| 158 | Ga0207681_10105295 | 3300025923 | Bacteria | 2042 |
| 159 | Ga0207694_10008849 | 3300025924 | Bacteria | 7593 |
| 160 | Ga0207650_10000007 | 3300025925 | Bacteria | 530810 |
| 161 | Ga0207650_10207773 | 3300025925 | Bacteria | 1571 |
| 162 | Ga0207687_10047870 | 3300025927 | Unclassified | 2965 |
| 163 | Ga0207700_10063687 | 3300025928 | Unclassified | 2806 |
| 164 | Ga0207709_10003731 | 3300025935 | Bacteria | 8968 |
| 165 | Ga0207670_10065829 | 3300025936 | Bacteria | 2488 |
| 166 | Ga0207669_10194386 | 3300025937 | Unclassified | 1466 |
| 167 | Ga0207665_10040359 | 3300025939 | Unclassified | 3114 |
| 168 | Ga0207691_10008494 | 3300025940 | Bacteria | 9862 |
| 169 | Ga0207711_10027100 | 3300025941 | Bacteria | 4811 |
| 170 | Ga0207689_10124534 | 3300025942 | Unclassified | 2120 |
| 171 | Ga0207679_10078985 | 3300025945 | Bacteria | 2508 |
| 172 | Ga0207679_10089936 | 3300025945 | Bacteria | 2371 |
| 173 | Ga0207712_10013261 | 3300025961 | Bacteria | 5282 |
| 174 | Ga0207712_10018760 | 3300025961 | Bacteria | 4510 |
| 175 | Ga0207668_10019576 | 3300025972 | Bacteria | 4282 |
| 176 | Ga0207640_10093428 | 3300025981 | Unclassified | 2090 |
| 177 | Ga0207708_10041314 | 3300026075 | Bacteria | 3516 |
| 178 | Ga0207708_10234558 | 3300026075 | Bacteria | 1474 |
| 179 | Ga0207641_10022370 | 3300026088 | Bacteria | 5204 |
| 180 | Ga0207641_10049810 | 3300026088 | Bacteria | 3541 |
| 181 | Ga0207641_10068966 | 3300026088 | Bacteria | 3034 |
| 182 | Ga0207641_10273884 | 3300026088 | Unclassified | 1585 |
| 183 | Ga0207648_10011205 | 3300026089 | Bacteria | 8453 |
| 184 | Ga0207676_10053770 | 3300026095 | Bacteria | 3152 |
| 185 | Ga0207676_10092056 | 3300026095 | Unclassified | 2492 |
| 186 | Ga0207674_10049583 | 3300026116 | Bacteria | 4294 |
| 187 | Ga0207674_10124084 | 3300026116 | Bacteria | 2548 |
| 188 | Ga0207683_10002296 | 3300026121 | Bacteria | 16768 |
| 189 | Ga0207428_10073781 | 3300027907 | Bacteria | 2676 |
| 190 | Ga0268264_10102624 | 3300028381 | Bacteria | 2489 |
| 191 | Ga0268264_10206051 | 3300028381 | Bacteria | 1802 |
| 192 | Ga0265339_10061157 | 3300031249 | Unclassified | 2028 |
| 193 | Ga0307405_10249401 | 3300031731 | Bacteria | 1320 |
| 194 | Ga0307414_10026394 | 3300032004 | Bacteria | 3738 |
| 195 | Ga0373951_0001564 | 3300035091 | Bacteria | 5986 |
| 196 | Ga0373942_0000609 | 3300035207 | Bacteria | 10041 |
| 197 | Ga0373931_0154532 | 3300035691 | Unclassified | 1340 |
| 198 | Ga0373937_0056628 | 3300036401 | Unclassified | 3601 |
| 199 | Ga0242420_001747 | 3300038996 | Bacteria | 2976 |
| 200 | Ga0496102_0000436 | 3300048905 | Bacteria | 47697 |
| 201 | Ga0496102_0027449 | 3300048905 | Bacteria | 5084 |
| 202 | Ga0496103_0003177 | 3300048906 | Bacteria | 10099 |
| 203 | Ga0496107_0014226 | 3300048910 | Bacteria | 5572 |
| 204 | Ga0496112_0128758 | 3300048915 | Bacteria | 2502 |
| 205 | Ga0496112_0140867 | 3300048915 | Bacteria | 2381 |
| 206 | Ga0496112_0322552 | 3300048915 | Unclassified | 1489 |
| 207 | Ga0501068_0064326 | 3300049584 | Bacteria | 2232 |
| 208 | Ga0501069_0016417 | 3300049585 | Bacteria | 3978 |
| 209 | Ga0501070_0000003 | 3300049586 | Bacteria | 339135 |
| 210 | Ga0501073_0017049 | 3300049589 | Bacteria | 5262 |
| 211 | Ga0501208_003522 | 3300049655 | Bacteria | 1763 |
| 212 | Ga0501080_0020815 | 3300049742 | Bacteria | 6072 |
| 213 | Ga0501080_0035483 | 3300049742 | Bacteria | 4653 |
| 214 | Ga0501081_0049058 | 3300049743 | Bacteria | 2906 |
| 215 | Ga0501083_0011222 | 3300049744 | Bacteria | 6287 |
| 216 | Ga0501273_002323 | 3300049770 | Bacteria | 1922 |
| 217 | nmdc:mga05p37_21722_c1 | 3300050507 | Bacteria | 7775 |
| 218 | nmdc:mga05p37_45175_c1 | 3300050507 | Bacteria | 5419 |
| 219 | nmdc:mga08y16_101829_c1 | 3300050511 | Bacteria | 2990 |
| 220 | nmdc:mga08y16_19166_c1 | 3300050511 | Bacteria | 7210 |
| 221 | nmdc:mga08y16_239951_c1 | 3300050511 | Bacteria | 1874 |
| 222 | nmdc:mga0n895_11658_c1 | 3300050512 | Bacteria | 7852 |
| 223 | nmdc:mga0n895_285258_c1 | 3300050512 | Bacteria | 1674 |
| 224 | nmdc:mga0rr50_8253_c1 | 3300050513 | Bacteria | 6472 |
| 225 | nmdc:mga08x19_24163_c1 | 3300050514 | Bacteria | 3773 |
| 226 | nmdc:mga0a205_119300_c1 | 3300050515 | Unclassified | 2537 |
| 227 | nmdc:mga0a205_13521_c1 | 3300050515 | Bacteria | 7602 |
| 228 | nmdc:mga0a205_54045_c1 | 3300050515 | Bacteria | 3877 |
| 229 | nmdc:mga0a205_72297_c1 | 3300050515 | Bacteria | 3332 |
| 230 | Ga0501082_0073825 | 3300060353 | Bacteria | 2937 |
| 231 | Ga0501082_0103138 | 3300060353 | Bacteria | 2467 |
| 232 | Ga0501082_0179947 | 3300060353 | Unclassified | 1839 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025981 | Ga0207640_10093428 | Ga0207640_100934283 | 335 |
| 2 | 3300005329 | Ga0070683_100259168 | Ga0070683_1002591681 | 360 |
| 3 | 3300049585 | Ga0501069_0016417 | Ga0501069_0016417_772_2001 | 360 |
| 4 | 3300049586 | Ga0501070_0000003 | Ga0501070_0000003_49892_51121 | 360 |
| 5 | 3300049589 | Ga0501073_0017049 | Ga0501073_0017049_2115_3344 | 360 |
| 6 | 3300049742 | Ga0501080_0035483 | Ga0501080_0035483_1441_2670 | 360 |
| 7 | 3300049743 | Ga0501081_0049058 | Ga0501081_0049058_278_1507 | 360 |
| 8 | 3300049744 | Ga0501083_0011222 | Ga0501083_0011222_4622_5851 | 360 |
| 9 | 3300060353 | Ga0501082_0103138 | Ga0501082_0103138_719_1948 | 360 |
| 10 | 3300006173 | Ga0070716_100035502 | Ga0070716_1000355022 | 367 |
| 11 | 3300025939 | Ga0207665_10040359 | Ga0207665_100403592 | 367 |
| 12 | 3300005617 | Ga0068859_100080476 | Ga0068859_1000804765 | 369 |
| 13 | 3300006931 | Ga0097620_100080470 | Ga0097620_1000804705 | 369 |
| 14 | 3300006914 | Ga0075436_100032837 | Ga0075436_1000328372 | 372 |
| 15 | 3300050514 | nmdc:mga08x19_24163_c1 | nmdc:mga08x19_24163_c1_715_1842 | 372 |
| 16 | 3300025922 | Ga0207646_10000042 | Ga0207646_1000004233 | 376 |
| 17 | 3300014326 | Ga0157380_10018304 | Ga0157380_100183043 | 377 |
| 18 | 3300027907 | Ga0207428_10073781 | Ga0207428_100737812 | 377 |
| 19 | 3300031731 | Ga0307405_10249401 | Ga0307405_102494011 | 377 |
| 20 | 3300035691 | Ga0373931_0154532 | Ga0373931_0154532_111_1328 | 377 |
| 21 | 3300005564 | Ga0070664_100014043 | Ga0070664_1000140432 | 381 |
| 22 | 3300009177 | Ga0105248_10267885 | Ga0105248_102678851 | 381 |
| 23 | 3300009174 | Ga0105241_10271478 | Ga0105241_102714781 | 383 |
| 24 | 3300009545 | Ga0105237_10056337 | Ga0105237_100563372 | 383 |
| 25 | 3300048905 | Ga0496102_0027449 | Ga0496102_0027449_1208_2419 | 383 |
| 26 | 3300005468 | Ga0070707_100183835 | Ga0070707_1001838352 | 387 |
| 27 | 3300006871 | Ga0075434_100072776 | Ga0075434_1000727764 | 387 |
| 28 | 3300007076 | Ga0075435_100011694 | Ga0075435_1000116947 | 387 |
| 29 | 3300007265 | Ga0099794_10023872 | Ga0099794_100238722 | 387 |
| 30 | 3300050512 | nmdc:mga0n895_11658_c1 | nmdc:mga0n895_11658_c1_1247_2458 | 387 |
| 31 | 3300050513 | nmdc:mga0rr50_8253_c1 | nmdc:mga0rr50_8253_c1_2896_4107 | 387 |
| 32 | 3300009098 | Ga0105245_10091219 | Ga0105245_100912191 | 388 |
| 33 | 3300009174 | Ga0105241_10027386 | Ga0105241_100273862 | 388 |
| 34 | 3300014968 | Ga0157379_10018306 | Ga0157379_100183063 | 388 |
| 35 | 3300025904 | Ga0207647_10000659 | Ga0207647_1000065920 | 388 |
| 36 | 3300025911 | Ga0207654_10041845 | Ga0207654_100418451 | 388 |
| 37 | 3300025927 | Ga0207687_10047870 | Ga0207687_100478702 | 388 |
| 38 | 3300048905 | Ga0496102_0000436 | Ga0496102_0000436_25451_26698 | 388 |
| 39 | 3300048906 | Ga0496103_0003177 | Ga0496103_0003177_258_1505 | 388 |
| 40 | 3300048910 | Ga0496107_0014226 | Ga0496107_0014226_2760_4010 | 388 |
| 41 | 3300005539 | Ga0068853_100037189 | Ga0068853_1000371894 | 389 |
| 42 | 3300005615 | Ga0070702_100009329 | Ga0070702_1000093296 | 389 |
| 43 | 3300013308 | Ga0157375_10170335 | Ga0157375_101703352 | 389 |
| 44 | 3300009147 | Ga0114129_10010560 | Ga0114129_100105607 | 390 |
| 45 | 3300006852 | Ga0075433_10148687 | Ga0075433_101486871 | 391 |
| 46 | 3300009147 | Ga0114129_10010205 | Ga0114129_100102051 | 391 |
| 47 | 3300025925 | Ga0207650_10207773 | Ga0207650_102077731 | 391 |
| 48 | 3300031249 | Ga0265339_10061157 | Ga0265339_100611572 | 391 |
| 49 | 3300050507 | nmdc:mga05p37_45175_c1 | nmdc:mga05p37_45175_c1_2706_3920 | 391 |
| 50 | 3300050515 | nmdc:mga0a205_13521_c1 | nmdc:mga0a205_13521_c1_3674_4888 | 391 |
| 51 | 3300005618 | Ga0068864_100082864 | Ga0068864_1000828644 | 392 |
| 52 | 3300005841 | Ga0068863_100161662 | Ga0068863_1001616622 | 392 |
| 53 | 3300006852 | Ga0075433_10138393 | Ga0075433_101383932 | 392 |
| 54 | 3300014325 | Ga0163163_10042785 | Ga0163163_100427852 | 392 |
| 55 | 3300026088 | Ga0207641_10273884 | Ga0207641_102738842 | 392 |
| 56 | 3300026095 | Ga0207676_10053770 | Ga0207676_100537704 | 392 |
| 57 | 3300050515 | nmdc:mga0a205_72297_c1 | nmdc:mga0a205_72297_c1_266_1504 | 392 |
| 58 | 3300006852 | Ga0075433_10093901 | Ga0075433_100939011 | 394 |
| 59 | 3300050512 | nmdc:mga0n895_285258_c1 | nmdc:mga0n895_285258_c1_423_1643 | 394 |
| 60 | 3300050515 | nmdc:mga0a205_54045_c1 | nmdc:mga0a205_54045_c1_1303_2523 | 394 |
| 61 | 3300005617 | Ga0068859_100023604 | Ga0068859_1000236043 | 395 |
| 62 | 3300006931 | Ga0097620_100023604 | Ga0097620_1000236043 | 395 |
| 63 | 3300049584 | Ga0501068_0064326 | Ga0501068_0064326_907_2127 | 395 |
| 64 | 3300049742 | Ga0501080_0020815 | Ga0501080_0020815_4730_5950 | 395 |
| 65 | 3300060353 | Ga0501082_0073825 | Ga0501082_0073825_91_1311 | 395 |
| 66 | 3300032004 | Ga0307414_10026394 | Ga0307414_100263943 | 398 |
| 67 | 3300049655 | Ga0501208_003522 | Ga0501208_003522_503_1732 | 398 |
| 68 | 3300049770 | Ga0501273_002323 | Ga0501273_002323_681_1910 | 398 |
| 69 | 3300005471 | Ga0070698_100300091 | Ga0070698_1003000911 | 399 |
| 70 | 3300006028 | Ga0070717_10037063 | Ga0070717_100370633 | 399 |
| 71 | 3300005354 | Ga0070675_100195902 | Ga0070675_1001959022 | 400 |
| 72 | 3300006844 | Ga0075428_100131412 | Ga0075428_1001314122 | 400 |
| 73 | 3300005290 | Ga0065712_10000140 | Ga0065712_100001404 | 401 |
| 74 | 3300005293 | Ga0065715_10093482 | Ga0065715_100934824 | 401 |
| 75 | 3300005336 | Ga0070680_100001271 | Ga0070680_1000012714 | 401 |
| 76 | 3300005337 | Ga0070682_100025967 | Ga0070682_1000259672 | 401 |
| 77 | 3300005345 | Ga0070692_10068660 | Ga0070692_100686601 | 401 |
| 78 | 3300005440 | Ga0070705_100027413 | Ga0070705_1000274132 | 401 |
| 79 | 3300005444 | Ga0070694_100001280 | Ga0070694_1000012803 | 401 |
| 80 | 3300005444 | Ga0070694_100198126 | Ga0070694_1001981261 | 401 |
| 81 | 3300005458 | Ga0070681_10004797 | Ga0070681_100047975 | 401 |
| 82 | 3300005530 | Ga0070679_100000307 | Ga0070679_1000003074 | 401 |
| 83 | 3300005547 | Ga0070693_100015226 | Ga0070693_1000152262 | 401 |
| 84 | 3300005834 | Ga0068851_10035117 | Ga0068851_100351171 | 401 |
| 85 | 3300005985 | Ga0081539_10032740 | Ga0081539_100327404 | 401 |
| 86 | 3300006871 | Ga0075434_100223286 | Ga0075434_1002232862 | 401 |
| 87 | 3300009094 | Ga0111539_10194841 | Ga0111539_101948412 | 401 |
| 88 | 3300009098 | Ga0105245_10342615 | Ga0105245_103426151 | 401 |
| 89 | 3300009545 | Ga0105237_10007519 | Ga0105237_1000751913 | 401 |
| 90 | 3300025321 | Ga0207656_10005286 | Ga0207656_100052862 | 401 |
| 91 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006204 | 401 |
| 92 | 3300025913 | Ga0207695_10180274 | Ga0207695_101802742 | 401 |
| 93 | 3300025914 | Ga0207671_10000522 | Ga0207671_100005229 | 401 |
| 94 | 3300025917 | Ga0207660_10002367 | Ga0207660_100023675 | 401 |
| 95 | 3300025921 | Ga0207652_10001375 | Ga0207652_100013753 | 401 |
| 96 | 3300025961 | Ga0207712_10018760 | Ga0207712_100187602 | 401 |
| 97 | 3300026088 | Ga0207641_10068966 | Ga0207641_100689662 | 401 |
| 98 | 3300050511 | nmdc:mga08y16_239951_c1 | nmdc:mga08y16_239951_c1_596_1819 | 401 |
| 99 | 3300005295 | Ga0065707_10106503 | Ga0065707_101065033 | 402 |
| 100 | 3300005468 | Ga0070707_100064220 | Ga0070707_1000642203 | 402 |
| 101 | 3300005518 | Ga0070699_100019414 | Ga0070699_1000194143 | 402 |
| 102 | 3300005536 | Ga0070697_100034749 | Ga0070697_1000347493 | 402 |
| 103 | 3300005549 | Ga0070704_100049831 | Ga0070704_1000498312 | 402 |
| 104 | 3300006237 | Ga0097621_100009441 | Ga0097621_1000094417 | 402 |
| 105 | 3300006358 | Ga0068871_100008898 | Ga0068871_1000088983 | 402 |
| 106 | 3300009094 | Ga0111539_10296591 | Ga0111539_102965911 | 402 |
| 107 | 3300026088 | Ga0207641_10049810 | Ga0207641_100498103 | 402 |
| 108 | 3300048915 | Ga0496112_0322552 | Ga0496112_0322552_226_1470 | 402 |
| 109 | 3300050511 | nmdc:mga08y16_19166_c1 | nmdc:mga08y16_19166_c1_1586_2794 | 402 |
| 110 | 3300005295 | Ga0065707_10120619 | Ga0065707_101206191 | 403 |
| 111 | 3300005328 | Ga0070676_10042593 | Ga0070676_100425932 | 403 |
| 112 | 3300005336 | Ga0070680_100049073 | Ga0070680_1000490733 | 403 |
| 113 | 3300005353 | Ga0070669_100020290 | Ga0070669_1000202903 | 403 |
| 114 | 3300005441 | Ga0070700_100025087 | Ga0070700_1000250872 | 403 |
| 115 | 3300005459 | Ga0068867_100026574 | Ga0068867_1000265744 | 403 |
| 116 | 3300005577 | Ga0068857_100162204 | Ga0068857_1001622042 | 403 |
| 117 | 3300005719 | Ga0068861_100165677 | Ga0068861_1001656772 | 403 |
| 118 | 3300009011 | Ga0105251_10108889 | Ga0105251_101088891 | 403 |
| 119 | 3300009148 | Ga0105243_10002037 | Ga0105243_1000203710 | 403 |
| 120 | 3300009553 | Ga0105249_10014335 | Ga0105249_100143353 | 403 |
| 121 | 3300011119 | Ga0105246_10122387 | Ga0105246_101223872 | 403 |
| 122 | 3300025907 | Ga0207645_10047186 | Ga0207645_100471862 | 403 |
| 123 | 3300025917 | Ga0207660_10030880 | Ga0207660_100308803 | 403 |
| 124 | 3300025922 | Ga0207646_10159281 | Ga0207646_101592813 | 403 |
| 125 | 3300025923 | Ga0207681_10038466 | Ga0207681_100384664 | 403 |
| 126 | 3300025935 | Ga0207709_10003731 | Ga0207709_100037316 | 403 |
| 127 | 3300026075 | Ga0207708_10041314 | Ga0207708_100413142 | 403 |
| 128 | 3300026075 | Ga0207708_10234558 | Ga0207708_102345581 | 403 |
| 129 | 3300026095 | Ga0207676_10092056 | Ga0207676_100920562 | 403 |
| 130 | 3300005289 | Ga0065704_10145269 | Ga0065704_101452691 | 404 |
| 131 | 3300005290 | Ga0065712_10070693 | Ga0065712_100706932 | 404 |
| 132 | 3300005330 | Ga0070690_100059874 | Ga0070690_1000598742 | 404 |
| 133 | 3300005564 | Ga0070664_100020441 | Ga0070664_1000204413 | 404 |
| 134 | 3300005718 | Ga0068866_10003358 | Ga0068866_100033585 | 404 |
| 135 | 3300009094 | Ga0111539_10126776 | Ga0111539_101267762 | 404 |
| 136 | 3300009094 | Ga0111539_10314644 | Ga0111539_103146442 | 404 |
| 137 | 3300009147 | Ga0114129_10066247 | Ga0114129_100662472 | 404 |
| 138 | 3300009553 | Ga0105249_10037982 | Ga0105249_100379824 | 404 |
| 139 | 3300014968 | Ga0157379_10175567 | Ga0157379_101755672 | 404 |
| 140 | 3300025899 | Ga0207642_10013408 | Ga0207642_100134082 | 404 |
| 141 | 3300025945 | Ga0207679_10089936 | Ga0207679_100899363 | 404 |
| 142 | 3300025961 | Ga0207712_10013261 | Ga0207712_100132615 | 404 |
| 143 | 3300050507 | nmdc:mga05p37_21722_c1 | nmdc:mga05p37_21722_c1_3590_4825 | 404 |
| 144 | 3300050511 | nmdc:mga08y16_101829_c1 | nmdc:mga08y16_101829_c1_754_1998 | 404 |
| 145 | 3300060353 | Ga0501082_0179947 | Ga0501082_0179947_348_1577 | 405 |
| 146 | 3300003203 | JGI25406J46586_10000615 | JGI25406J46586_100006159 | 406 |
| 147 | 3300005841 | Ga0068863_100207119 | Ga0068863_1002071192 | 406 |
| 148 | 3300005844 | Ga0068862_100097177 | Ga0068862_1000971772 | 406 |
| 149 | 3300005985 | Ga0081539_10000631 | Ga0081539_1000063157 | 406 |
| 150 | 3300025908 | Ga0207643_10110755 | Ga0207643_101107551 | 406 |
| 151 | 3300025942 | Ga0207689_10124534 | Ga0207689_101245343 | 406 |
| 152 | 3300026116 | Ga0207674_10124084 | Ga0207674_101240841 | 406 |
| 153 | 3300050515 | nmdc:mga0a205_119300_c1 | nmdc:mga0a205_119300_c1_243_1469 | 406 |
| 154 | 3300005290 | Ga0065712_10070913 | Ga0065712_100709138 | 407 |
| 155 | 3300005293 | Ga0065715_10006017 | Ga0065715_100060172 | 407 |
| 156 | 3300005328 | Ga0070676_10084205 | Ga0070676_100842052 | 407 |
| 157 | 3300005340 | Ga0070689_100000044 | Ga0070689_10000004410 | 407 |
| 158 | 3300005539 | Ga0068853_100135391 | Ga0068853_1001353911 | 407 |
| 159 | 3300005547 | Ga0070693_100196990 | Ga0070693_1001969901 | 407 |
| 160 | 3300005617 | Ga0068859_100036374 | Ga0068859_1000363748 | 407 |
| 161 | 3300005618 | Ga0068864_100130781 | Ga0068864_1001307813 | 407 |
| 162 | 3300005841 | Ga0068863_100008575 | Ga0068863_1000085758 | 407 |
| 163 | 3300006173 | Ga0070716_100021373 | Ga0070716_1000213733 | 407 |
| 164 | 3300006931 | Ga0097620_100036372 | Ga0097620_1000363728 | 407 |
| 165 | 3300009101 | Ga0105247_10012659 | Ga0105247_100126593 | 407 |
| 166 | 3300025900 | Ga0207710_10007269 | Ga0207710_100072693 | 407 |
| 167 | 3300025906 | Ga0207699_10000001 | Ga0207699_1000000171 | 407 |
| 168 | 3300025908 | Ga0207643_10043597 | Ga0207643_100435972 | 407 |
| 169 | 3300025936 | Ga0207670_10065829 | Ga0207670_100658293 | 407 |
| 170 | 3300026088 | Ga0207641_10022370 | Ga0207641_100223706 | 407 |
| 171 | 3300028381 | Ga0268264_10102624 | Ga0268264_101026242 | 407 |
| 172 | 3300028381 | Ga0268264_10206051 | Ga0268264_102060512 | 407 |
| 173 | 3300005345 | Ga0070692_10030971 | Ga0070692_100309713 | 408 |
| 174 | 3300005439 | Ga0070711_100000035 | Ga0070711_10000003582 | 408 |
| 175 | 3300005445 | Ga0070708_100090694 | Ga0070708_1000906942 | 408 |
| 176 | 3300005840 | Ga0068870_10031829 | Ga0068870_100318293 | 408 |
| 177 | 3300006914 | Ga0075436_100001578 | Ga0075436_1000015784 | 408 |
| 178 | 3300011119 | Ga0105246_10016759 | Ga0105246_100167594 | 408 |
| 179 | 3300013100 | Ga0157373_10014962 | Ga0157373_100149624 | 408 |
| 180 | 3300013306 | Ga0163162_10117066 | Ga0163162_101170663 | 408 |
| 181 | 3300025924 | Ga0207694_10008849 | Ga0207694_100088498 | 408 |
| 182 | 3300035207 | Ga0373942_0000609 | Ga0373942_0000609_7048_8277 | 408 |
| 183 | 3300048915 | Ga0496112_0128758 | Ga0496112_0128758_869_2098 | 408 |
| 184 | 3300002459 | JGI24751J29686_10000019 | JGI24751J29686_1000001960 | 409 |
| 185 | 3300005331 | Ga0070670_100000346 | Ga0070670_10000034630 | 409 |
| 186 | 3300005331 | Ga0070670_100172640 | Ga0070670_1001726402 | 409 |
| 187 | 3300005338 | Ga0068868_100200400 | Ga0068868_1002004001 | 409 |
| 188 | 3300005340 | Ga0070689_100025574 | Ga0070689_1000255741 | 409 |
| 189 | 3300005347 | Ga0070668_100032622 | Ga0070668_1000326226 | 409 |
| 190 | 3300005353 | Ga0070669_100233557 | Ga0070669_1002335571 | 409 |
| 191 | 3300005356 | Ga0070674_100015511 | Ga0070674_1000155113 | 409 |
| 192 | 3300005364 | Ga0070673_100065867 | Ga0070673_1000658672 | 409 |
| 193 | 3300005367 | Ga0070667_100138079 | Ga0070667_1001380792 | 409 |
| 194 | 3300005445 | Ga0070708_100056532 | Ga0070708_1000565322 | 409 |
| 195 | 3300005456 | Ga0070678_100152919 | Ga0070678_1001529192 | 409 |
| 196 | 3300005467 | Ga0070706_100001280 | Ga0070706_10000128016 | 409 |
| 197 | 3300005467 | Ga0070706_100035555 | Ga0070706_1000355554 | 409 |
| 198 | 3300005518 | Ga0070699_100107338 | Ga0070699_1001073382 | 409 |
| 199 | 3300005518 | Ga0070699_100174757 | Ga0070699_1001747571 | 409 |
| 200 | 3300005536 | Ga0070697_100000156 | Ga0070697_10000015623 | 409 |
| 201 | 3300005536 | Ga0070697_100000943 | Ga0070697_10000094322 | 409 |
| 202 | 3300005536 | Ga0070697_100001646 | Ga0070697_10000164611 | 409 |
| 203 | 3300005543 | Ga0070672_100044454 | Ga0070672_1000444543 | 409 |
| 204 | 3300005547 | Ga0070693_100004201 | Ga0070693_1000042014 | 409 |
| 205 | 3300005617 | Ga0068859_100036887 | Ga0068859_1000368873 | 409 |
| 206 | 3300005617 | Ga0068859_100064255 | Ga0068859_1000642552 | 409 |
| 207 | 3300005985 | Ga0081539_10001725 | Ga0081539_100017254 | 409 |
| 208 | 3300006028 | Ga0070717_10059350 | Ga0070717_100593501 | 409 |
| 209 | 3300006931 | Ga0097620_100036888 | Ga0097620_1000368883 | 409 |
| 210 | 3300006931 | Ga0097620_100064257 | Ga0097620_1000642574 | 409 |
| 211 | 3300009177 | Ga0105248_10229617 | Ga0105248_102296172 | 409 |
| 212 | 3300014325 | Ga0163163_10000214 | Ga0163163_100002149 | 409 |
| 213 | 3300025315 | Ga0207697_10003560 | Ga0207697_100035605 | 409 |
| 214 | 3300025901 | Ga0207688_10006242 | Ga0207688_100062426 | 409 |
| 215 | 3300025910 | Ga0207684_10006642 | Ga0207684_100066423 | 409 |
| 216 | 3300025912 | Ga0207707_10127820 | Ga0207707_101278203 | 409 |
| 217 | 3300025915 | Ga0207693_10192057 | Ga0207693_101920571 | 409 |
| 218 | 3300025923 | Ga0207681_10105295 | Ga0207681_101052952 | 409 |
| 219 | 3300025925 | Ga0207650_10000007 | Ga0207650_10000007145 | 409 |
| 220 | 3300025928 | Ga0207700_10063687 | Ga0207700_100636872 | 409 |
| 221 | 3300025937 | Ga0207669_10194386 | Ga0207669_101943861 | 409 |
| 222 | 3300025940 | Ga0207691_10008494 | Ga0207691_100084943 | 409 |
| 223 | 3300025941 | Ga0207711_10027100 | Ga0207711_100271007 | 409 |
| 224 | 3300025945 | Ga0207679_10078985 | Ga0207679_100789852 | 409 |
| 225 | 3300025972 | Ga0207668_10019576 | Ga0207668_100195761 | 409 |
| 226 | 3300026089 | Ga0207648_10011205 | Ga0207648_100112056 | 409 |
| 227 | 3300026116 | Ga0207674_10049583 | Ga0207674_100495833 | 409 |
| 228 | 3300026121 | Ga0207683_10002296 | Ga0207683_100022961 | 409 |
| 229 | 3300035091 | Ga0373951_0001564 | Ga0373951_0001564_892_2127 | 409 |
| 230 | 3300036401 | Ga0373937_0056628 | Ga0373937_0056628_428_1699 | 409 |
| 231 | 3300038996 | Ga0242420_001747 | Ga0242420_001747_1655_2899 | 409 |
| 232 | 3300048915 | Ga0496112_0140867 | Ga0496112_0140867_622_1896 | 409 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mtw-assembly1.cif.gz_A | crystal structure of l-lysine, l-arginine carboxypeptidase cc2672 from caulobacter crescentus cb15 complexed with n-methyl phosphonate derivative of l-arginine | 0.9016 | 30 | 407 |
| 2qs8-assembly1.cif.gz_A | crystal structure of a xaa-pro dipeptidase with bound methionine in the active site | 0.8919 | 30 | 406 |
| 8ihq-assembly1.cif.gz_D | cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 | 0.8804 | 32 | 407 |
| 8j85-assembly1.cif.gz_A | cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 mutant s88e in complex with ochratoxin a | 0.8801 | 32 | 407 |
| 3feq-assembly2.cif.gz_J | crystal structure of uncharacterized protein eah89906 | 0.8757 | 30 | 408 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3be7A01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9533 | 368 | 409 | 2.30.40.10 |
| 2p9bA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9439 | 370 | 405 | 2.30.40.10 |
| 2r8cA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.8816 | 364 | 407 | 2.30.40.10 |
| 2p9bA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Amidohydrolase | 0.8508 | 168 | 256 | 3.40.50.10910 |
| af_P40896_13_285_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8461 | 116 | 363 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5QPC8-F1-model_v4 | Amidohydrolase family protein | 0.9766 | 214 | 409 |
GO:0016810
|
| AF-A0A2V7M297-F1-model_v4 | Amidohydrolase | 0.9732 | 249 | 407 |
GO:0016810
|
| AF-A0A2V9G2D5-F1-model_v4 | Amidohydrolase | 0.9678 | 22 | 361 |
GO:0016810
|
| AF-A0A1Q7TM24-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.9637 | 56 | 406 |
GO:0016810
|
| AF-A0A7Y5PC35-F1-model_v4 | Prolyl oligopeptidase family serine peptidase | 0.9632 | 32 | 407 |
GO:0006508
GO:0008236 GO:0016810 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar