F344800

General Info

Members Datasets Scaffolds Average Seq Length
232 94 464 182

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100048701|Ga0070708_1000487013
Length 203
Sequence VAKAKQAPKKEQAPKAPGTRSEAPPRLLQSYRETVTHQLTKEFDYGNAMQVPRVDKIVVNIGIGEAKDNDKALDAAVGDVQTITGQKPQLVKAKKSVAAFKLRAGQTVGIKTTLRGRRMWYFLDKLLNVALPRIRDFRGVSPDAFDGRGNYSLGLREQVIFPEIDYDKIDKLRGLEVSIITTAKTDDEARSLLTRLGMPFRKR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
37 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
38 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
45 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
46 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
51 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
52 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
53 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
54 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
59 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
60 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
61 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
93 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.52
Metatranscriptomes 9.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100048701 3300005445 Bacteria 3747
2 SwRhRL2b_contig_488749 2162886007 Unclassified 2257
3 Ga0065704_10070890 3300005289 Bacteria 14917
4 Ga0065707_10082110 3300005295 Bacteria 21594
5 Ga0065707_10083718 3300005295 Bacteria 8386
6 Ga0065707_10100665 3300005295 Bacteria 2914
7 Ga0070689_100095292 3300005340 Bacteria 2351
8 Ga0070687_100141685 3300005343 Bacteria 1401
9 Ga0070701_10189955 3300005438 Bacteria 1208
10 Ga0070705_100321324 3300005440 Bacteria 1117
11 Ga0070700_100027695 3300005441 Bacteria 3363
12 Ga0070708_101115115 3300005445 Bacteria 739
13 Ga0070698_100089307 3300005471 Bacteria 3066
14 Ga0070698_100877264 3300005471 Bacteria 842
15 Ga0070698_100877265 3300005471 Bacteria 842
16 Ga0070699_100044111 3300005518 Bacteria 3860
17 Ga0070699_100194235 3300005518 Bacteria 1804
18 Ga0070699_100359912 3300005518 Bacteria 1312
19 Ga0070697_100001474 3300005536 Bacteria 17878
20 Ga0070697_100054636 3300005536 Bacteria 3246
21 Ga0070693_100375640 3300005547 Bacteria 979
22 Ga0070704_100049841 3300005549 Bacteria 2940
23 Ga0068859_100032785 3300005617 Bacteria 5218
24 Ga0068870_10419065 3300005840 Bacteria 876
25 Ga0068862_100112938 3300005844 Bacteria 2386
26 Ga0075433_10294848 3300006852 Bacteria 1436
27 Ga0075434_100752121 3300006871 Bacteria 992
28 Ga0097620_100032783 3300006931 Bacteria 5218
29 Ga0105240_10571193 3300009093 Bacteria 1249
30 Ga0105245_10211921 3300009098 Bacteria 1865
31 Ga0114129_10037280 3300009147 Bacteria 6865
32 Ga0114129_11602639 3300009147 Bacteria 797
33 Ga0105237_10038527 3300009545 Bacteria 4827
34 Ga0105249_11078007 3300009553 Bacteria 873
35 Ga0163163_11337123 3300014325 Bacteria 778
36 Ga0207653_10049242 3300025885 Bacteria 1398
37 Ga0207646_10089820 3300025922 Bacteria 2750
38 Ga0207670_10087241 3300025936 Bacteria 2198
39 Ga0207670_10188804 3300025936 Bacteria 1558
40 Ga0207665_10103913 3300025939 Bacteria 1988
41 Ga0207712_10362904 3300025961 Bacteria 1207
42 Ga0207708_10044745 3300026075 Bacteria 3373
43 Ga0207676_10400692 3300026095 Bacteria 1282
44 Ga0207674_10242717 3300026116 Bacteria 1748
45 Ga0268265_10022353 3300028380 Bacteria 4442
46 Ga0268265_11783686 3300028380 Bacteria 622
47 Ga0265323_10013566 3300028653 Bacteria 3247
48 Ga0265329_10190691 3300031242 Bacteria 672
49 Ga0316575_10002161 3300031665 Bacteria 6561
50 Ga0316575_10004898 3300031665 Bacteria 4730
51 Ga0316579_10000803 3300031691 Bacteria 10837
52 Ga0316579_10000962 3300031691 Bacteria 10086
53 Ga0316579_10005773 3300031691 Bacteria 5016
54 Ga0316579_10007326 3300031691 Bacteria 4552
55 Ga0316579_10011187 3300031691 Bacteria 3808
56 Ga0316579_10094550 3300031691 Bacteria 1428
57 Ga0316579_10098643 3300031691 Bacteria 1398
58 Ga0316579_10145585 3300031691 Bacteria 1142
59 Ga0316576_10006114 3300031727 Bacteria 7454
60 Ga0316576_10051663 3300031727 Bacteria 2992
61 Ga0316576_10059595 3300031727 Bacteria 2795
62 Ga0316576_10391465 3300031727 Unclassified 1031
63 Ga0316576_10521035 3300031727 Bacteria 873
64 Ga0316576_10558931 3300031727 Unclassified 838
65 Ga0316576_10669379 3300031727 Bacteria 754
66 Ga0316578_10002968 3300031728 Bacteria 7631
67 Ga0316578_10025873 3300031728 Bacteria 3304
68 Ga0316578_10051642 3300031728 Bacteria 2408
69 Ga0316578_10055808 3300031728 Bacteria 2319
70 Ga0316578_10063003 3300031728 Unclassified 2187
71 Ga0316578_10138244 3300031728 Bacteria 1467
72 Ga0316578_10246282 3300031728 Bacteria 1073
73 Ga0316578_10289578 3300031728 Unclassified 980
74 Ga0316578_10295444 3300031728 Bacteria 969
75 Ga0316577_10000311 3300031733 Bacteria 17784
76 Ga0316577_10000670 3300031733 Bacteria 14353
77 Ga0316577_10000831 3300031733 Bacteria 13456
78 Ga0316577_10002971 3300031733 Bacteria 8490
79 Ga0316577_10003304 3300031733 Bacteria 8124
80 Ga0316577_10005477 3300031733 Bacteria 6657
81 Ga0316577_10006298 3300031733 Bacteria 6261
82 Ga0316577_10007757 3300031733 Bacteria 5733
83 Ga0316577_10009170 3300031733 Bacteria 5318
84 Ga0316577_10021739 3300031733 Bacteria 3559
85 Ga0316577_10064764 3300031733 Bacteria 2040
86 Ga0316577_10077131 3300031733 Bacteria 1861
87 Ga0316577_10170136 3300031733 Bacteria 1229
88 Ga0316577_10263549 3300031733 Bacteria 975
89 Ga0316577_10394465 3300031733 Bacteria 786
90 Ga0316577_10457433 3300031733 Bacteria 725
91 Ga0307409_100786238 3300031995 Bacteria 958
92 Ga0316585_10015369 3300032137 Bacteria 2295
93 Ga0316585_10017057 3300032137 Bacteria 2193
94 Ga0316585_10050650 3300032137 Bacteria 1333
95 Ga0316585_10061887 3300032137 Unclassified 1210
96 Ga0316585_10071487 3300032137 Bacteria 1126
97 Ga0316585_10180534 3300032137 Unclassified 697
98 Ga0316580_10111125 3300032139 Bacteria 839
99 Ga0316593_10000039 3300032168 Bacteria 14170
100 Ga0316593_10000074 3300032168 Bacteria 12104
101 Ga0316593_10000322 3300032168 Bacteria 8245
102 Ga0316593_10000330 3300032168 Bacteria 8167
103 Ga0316593_10000340 3300032168 Bacteria 8108
104 Ga0316593_10000617 3300032168 Bacteria 6770
105 Ga0316593_10013414 3300032168 Bacteria 2426
106 Ga0316593_10021025 3300032168 Bacteria 2036
107 Ga0316593_10026849 3300032168 Bacteria 1843
108 Ga0316593_10044699 3300032168 Bacteria 1483
109 Ga0316593_10061970 3300032168 Bacteria 1280
110 Ga0316593_10146507 3300032168 Bacteria 857
111 Ga0316592_1000660 3300033524 Bacteria 5025
112 Ga0316592_1000962 3300033524 Bacteria 4429
113 Ga0316592_1025015 3300033524 Bacteria 1286
114 Ga0316592_1045819 3300033524 Bacteria 974
115 Ga0316586_1034406 3300033527 Bacteria 876
116 Ga0316596_1000338 3300033541 Bacteria 7624
117 Ga0316596_1001674 3300033541 Bacteria 4576
118 Ga0316596_1040214 3300033541 Bacteria 1228
119 Ga0373959_0024346 3300034820 Bacteria 1183
120 Ga0373949_0053437 3300035090 Bacteria 1023
121 Ga0373932_0003230 3300035112 Bacteria 3951
122 Ga0373960_0040664 3300035121 Bacteria 1343
123 Ga0373961_0008302 3300035241 Bacteria 2526
124 Ga0316574_0000232 3300035398 Bacteria 20051
125 Ga0316574_0000443 3300035398 Bacteria 16514
126 Ga0316574_0001655 3300035398 Bacteria 10724
127 Ga0316574_0012671 3300035398 Bacteria 4829
128 Ga0316582_0001055 3300036647 Bacteria 11553
129 Ga0316582_0004196 3300036647 Bacteria 7228
130 Ga0316582_0010838 3300036647 Bacteria 5013
131 Ga0316582_0013456 3300036647 Bacteria 4604
132 Ga0316582_0018109 3300036647 Bacteria 4092
133 Ga0316582_0054616 3300036647 Bacteria 2543
134 Ga0316582_0066019 3300036647 Bacteria 2331
135 Ga0316582_0096540 3300036647 Bacteria 1952
136 Ga0316582_0103206 3300036647 Bacteria 1891
137 Ga0316582_0119523 3300036647 Bacteria 1762
138 Ga0316582_0147458 3300036647 Bacteria 1589
139 Ga0316582_0168928 3300036647 Bacteria 1484
140 Ga0316582_0181466 3300036647 Bacteria 1432
141 Ga0316582_0203248 3300036647 Bacteria 1352
142 Ga0316582_0461492 3300036647 Bacteria 875
143 Ga0316582_0541364 3300036647 Bacteria 802
144 Ga0316584_0001621 3300036712 Bacteria 13714
145 Ga0316584_0002495 3300036712 Bacteria 11658
146 Ga0316584_0002774 3300036712 Bacteria 11205
147 Ga0316584_0003646 3300036712 Bacteria 10079
148 Ga0316584_0004995 3300036712 Bacteria 8838
149 Ga0316584_0007009 3300036712 Bacteria 7671
150 Ga0316584_0011431 3300036712 Bacteria 6237
151 Ga0316584_0011707 3300036712 Bacteria 6173
152 Ga0316584_0018626 3300036712 Bacteria 5011
153 Ga0316584_0047137 3300036712 Bacteria 3219
154 Ga0316584_0103025 3300036712 Unclassified 2137
155 Ga0316584_0114547 3300036712 Unclassified 2017
156 Ga0316584_0153340 3300036712 Bacteria 1714
157 Ga0316584_0168040 3300036712 Bacteria 1628
158 Ga0316584_0199906 3300036712 Unclassified 1475
159 Ga0316584_0279466 3300036712 Bacteria 1213
160 Ga0316584_0392269 3300036712 Bacteria 990
161 Ga0316584_0472078 3300036712 Bacteria 885
162 Ga0316584_0705935 3300036712 Bacteria 691
163 Ga0316581_0005454 3300037588 Bacteria 3317
164 Ga0316581_0010949 3300037588 Bacteria 2526
165 Ga0316581_0051132 3300037588 Bacteria 1267
166 Ga0316581_0055518 3300037588 Bacteria 1214
167 Ga0316581_0129707 3300037588 Bacteria 777
168 Ga0400490_60149 3300038726 Bacteria 1088
169 Ga0400489_29163 3300039093 Bacteria 29490
170 Ga0400489_86969 3300039093 Bacteria 10581
171 Ga0400487_61801 3300039110 Bacteria 1024
172 Ga0451853_3030725 3300041512 Bacteria 832
173 Ga0451577_0256923 3300042876 Bacteria 1582
174 Ga0451577_0788766 3300042876 Unclassified 858
175 Ga0451577_1644736 3300042876 Bacteria 566
176 Ga0453683_0003998 3300044673 Bacteria 10656
177 Ga0453683_0128319 3300044673 Bacteria 1597
178 Ga0453683_0401127 3300044673 Bacteria 884
179 Ga0453684_0030092 3300044712 Bacteria 7682
180 Ga0453684_0036565 3300044712 Bacteria 6766
181 Ga0453684_0052339 3300044712 Bacteria 5341
182 Ga0453684_0167534 3300044712 Bacteria 2592
183 Ga0453684_0312146 3300044712 Bacteria 1784
184 Ga0453684_0422657 3300044712 Bacteria 1488
185 Ga0453684_0457065 3300044712 Bacteria 1420
186 Ga0453684_0517131 3300044712 Bacteria 1319
187 Ga0453684_0537562 3300044712 Bacteria 1289
188 Ga0453684_0638542 3300044712 Bacteria 1163
189 Ga0453684_0705857 3300044712 Bacteria 1096
190 Ga0453684_0933224 3300044712 Bacteria 927
191 Ga0451576_0000454 3300045051 Bacteria 93047
192 Ga0451576_0019853 3300045051 Bacteria 7328
193 Ga0451576_0023521 3300045051 Bacteria 6671
194 Ga0451576_0059482 3300045051 Bacteria 3988
195 Ga0451576_0234567 3300045051 Bacteria 1916
196 Ga0451576_0364595 3300045051 Bacteria 1513
197 Ga0451576_1058397 3300045051 Bacteria 850
198 Ga0495651_0483510 3300046462 Bacteria 795
199 Ga0495608_0264899 3300046511 Bacteria 1069
200 Ga0495640_0483622 3300046533 Bacteria 754
201 Ga0495604_0159550 3300047317 Bacteria 1595
202 Ga0495674_0046358 3300047319 Bacteria 3858
203 Ga0495676_0229674 3300047321 Bacteria 1275
204 Ga0495680_0199661 3300047322 Bacteria 1435
205 Ga0495684_0206361 3300047471 Bacteria 1447
206 Ga0496108_0275544 3300048911 Bacteria 1465
207 Ga0496110_0903534 3300048913 Bacteria 789
208 Ga0496114_0243803 3300048917 Bacteria 1581
209 Ga0501318_053781 3300049534 Bacteria 604
210 Ga0501034_0049192 3300049571 Bacteria 4254
211 Ga0501034_0137081 3300049571 Bacteria 2428
212 Ga0501034_0169228 3300049571 Bacteria 2153
213 Ga0501036_0410947 3300049572 Bacteria 1129
214 Ga0501039_0114079 3300049575 Bacteria 2114
215 Ga0501039_0368719 3300049575 Bacteria 1128
216 Ga0501069_0494116 3300049585 Bacteria 730
217 Ga0501071_0233091 3300049587 Bacteria 1387
218 Ga0501074_0397626 3300049590 Bacteria 977
219 Ga0501075_0002791 3300049591 Bacteria 11695
220 Ga0501079_0142836 3300049741 Bacteria 1865
221 Ga0501080_0022383 3300049742 Bacteria 5855
222 Ga0501080_0440317 3300049742 Bacteria 1169
223 nmdc:mga05p37_19882_c1 3300050507 Bacteria 8123
224 nmdc:mga05p37_381403_c1 3300050507 Bacteria 1652
225 nmdc:mga0n895_762574_c1 3300050512 Bacteria 960
226 nmdc:mga0n895_958772_c1 3300050512 Bacteria 838
227 nmdc:mga0a205_42417_c1 3300050515 Bacteria 4385
228 nmdc:mga0a205_561540_c1 3300050515 Bacteria 996
229 Ga0501084_0502316 3300054114 Bacteria 1025
230 Ga0590077_064638 3300059426 Bacteria 832
231 Ga0587117_010449 3300059627 Bacteria 1133
232 Ga0501082_0029342 3300060353 Bacteria 4739
233 Ga0070708_100048701
234 SwRhRL2b_contig_488749
235 Ga0065704_10070890
236 Ga0065707_10082110
237 Ga0065707_10083718
238 Ga0065707_10100665
239 Ga0070689_100095292
240 Ga0070687_100141685
241 Ga0070701_10189955
242 Ga0070705_100321324
243 Ga0070700_100027695
244 Ga0070708_101115115
245 Ga0070698_100089307
246 Ga0070698_100877264
247 Ga0070698_100877265
248 Ga0070699_100044111
249 Ga0070699_100194235
250 Ga0070699_100359912
251 Ga0070697_100001474
252 Ga0070697_100054636
253 Ga0070693_100375640
254 Ga0070704_100049841
255 Ga0068859_100032785
256 Ga0068870_10419065
257 Ga0068862_100112938
258 Ga0075433_10294848
259 Ga0075434_100752121
260 Ga0097620_100032783
261 Ga0105240_10571193
262 Ga0105245_10211921
263 Ga0114129_10037280
264 Ga0114129_11602639
265 Ga0105237_10038527
266 Ga0105249_11078007
267 Ga0163163_11337123
268 Ga0207653_10049242
269 Ga0207646_10089820
270 Ga0207670_10087241
271 Ga0207670_10188804
272 Ga0207665_10103913
273 Ga0207712_10362904
274 Ga0207708_10044745
275 Ga0207676_10400692
276 Ga0207674_10242717
277 Ga0268265_10022353
278 Ga0268265_11783686
279 Ga0265323_10013566
280 Ga0265329_10190691
281 Ga0316575_10002161
282 Ga0316575_10004898
283 Ga0316579_10000803
284 Ga0316579_10000962
285 Ga0316579_10005773
286 Ga0316579_10007326
287 Ga0316579_10011187
288 Ga0316579_10094550
289 Ga0316579_10098643
290 Ga0316579_10145585
291 Ga0316576_10006114
292 Ga0316576_10051663
293 Ga0316576_10059595
294 Ga0316576_10391465
295 Ga0316576_10521035
296 Ga0316576_10558931
297 Ga0316576_10669379
298 Ga0316578_10002968
299 Ga0316578_10025873
300 Ga0316578_10051642
301 Ga0316578_10055808
302 Ga0316578_10063003
303 Ga0316578_10138244
304 Ga0316578_10246282
305 Ga0316578_10289578
306 Ga0316578_10295444
307 Ga0316577_10000311
308 Ga0316577_10000670
309 Ga0316577_10000831
310 Ga0316577_10002971
311 Ga0316577_10003304
312 Ga0316577_10005477
313 Ga0316577_10006298
314 Ga0316577_10007757
315 Ga0316577_10009170
316 Ga0316577_10021739
317 Ga0316577_10064764
318 Ga0316577_10077131
319 Ga0316577_10170136
320 Ga0316577_10263549
321 Ga0316577_10394465
322 Ga0316577_10457433
323 Ga0307409_100786238
324 Ga0316585_10015369
325 Ga0316585_10017057
326 Ga0316585_10050650
327 Ga0316585_10061887
328 Ga0316585_10071487
329 Ga0316585_10180534
330 Ga0316580_10111125
331 Ga0316593_10000039
332 Ga0316593_10000074
333 Ga0316593_10000322
334 Ga0316593_10000330
335 Ga0316593_10000340
336 Ga0316593_10000617
337 Ga0316593_10013414
338 Ga0316593_10021025
339 Ga0316593_10026849
340 Ga0316593_10044699
341 Ga0316593_10061970
342 Ga0316593_10146507
343 Ga0316592_1000660
344 Ga0316592_1000962
345 Ga0316592_1025015
346 Ga0316592_1045819
347 Ga0316586_1034406
348 Ga0316596_1000338
349 Ga0316596_1001674
350 Ga0316596_1040214
351 Ga0373959_0024346
352 Ga0373949_0053437
353 Ga0373932_0003230
354 Ga0373960_0040664
355 Ga0373961_0008302
356 Ga0316574_0000232
357 Ga0316574_0000443
358 Ga0316574_0001655
359 Ga0316574_0012671
360 Ga0316582_0001055
361 Ga0316582_0004196
362 Ga0316582_0010838
363 Ga0316582_0013456
364 Ga0316582_0018109
365 Ga0316582_0054616
366 Ga0316582_0066019
367 Ga0316582_0096540
368 Ga0316582_0103206
369 Ga0316582_0119523
370 Ga0316582_0147458
371 Ga0316582_0168928
372 Ga0316582_0181466
373 Ga0316582_0203248
374 Ga0316582_0461492
375 Ga0316582_0541364
376 Ga0316584_0001621
377 Ga0316584_0002495
378 Ga0316584_0002774
379 Ga0316584_0003646
380 Ga0316584_0004995
381 Ga0316584_0007009
382 Ga0316584_0011431
383 Ga0316584_0011707
384 Ga0316584_0018626
385 Ga0316584_0047137
386 Ga0316584_0103025
387 Ga0316584_0114547
388 Ga0316584_0153340
389 Ga0316584_0168040
390 Ga0316584_0199906
391 Ga0316584_0279466
392 Ga0316584_0392269
393 Ga0316584_0472078
394 Ga0316584_0705935
395 Ga0316581_0005454
396 Ga0316581_0010949
397 Ga0316581_0051132
398 Ga0316581_0055518
399 Ga0316581_0129707
400 Ga0400490_60149
401 Ga0400489_29163
402 Ga0400489_86969
403 Ga0400487_61801
404 Ga0451853_3030725
405 Ga0451577_0256923
406 Ga0451577_0788766
407 Ga0451577_1644736
408 Ga0453683_0003998
409 Ga0453683_0128319
410 Ga0453683_0401127
411 Ga0453684_0030092
412 Ga0453684_0036565
413 Ga0453684_0052339
414 Ga0453684_0167534
415 Ga0453684_0312146
416 Ga0453684_0422657
417 Ga0453684_0457065
418 Ga0453684_0517131
419 Ga0453684_0537562
420 Ga0453684_0638542
421 Ga0453684_0705857
422 Ga0453684_0933224
423 Ga0451576_0000454
424 Ga0451576_0019853
425 Ga0451576_0023521
426 Ga0451576_0059482
427 Ga0451576_0234567
428 Ga0451576_0364595
429 Ga0451576_1058397
430 Ga0495651_0483510
431 Ga0495608_0264899
432 Ga0495640_0483622
433 Ga0495604_0159550
434 Ga0495674_0046358
435 Ga0495676_0229674
436 Ga0495680_0199661
437 Ga0495684_0206361
438 Ga0496108_0275544
439 Ga0496110_0903534
440 Ga0496114_0243803
441 Ga0501318_053781
442 Ga0501034_0049192
443 Ga0501034_0137081
444 Ga0501034_0169228
445 Ga0501036_0410947
446 Ga0501039_0114079
447 Ga0501039_0368719
448 Ga0501069_0494116
449 Ga0501071_0233091
450 Ga0501074_0397626
451 Ga0501075_0002791
452 Ga0501079_0142836
453 Ga0501080_0022383
454 Ga0501080_0440317
455 nmdc:mga05p37_19882_c1
456 nmdc:mga05p37_381403_c1
457 nmdc:mga0n895_762574_c1
458 nmdc:mga0n895_958772_c1
459 nmdc:mga0a205_42417_c1
460 nmdc:mga0a205_561540_c1
461 Ga0501084_0502316
462 Ga0590077_064638
463 Ga0587117_010449
464 Ga0501082_0029342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

47

103

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

107

200

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9651 2 174
8cgd-assembly1.cif.gz_f clindamycin bound to the 50s subunit 0.959 2 174
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9538 2 174
6ore-assembly1.cif.gz_E release complex 70s 0.9526 2 174
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9513 2 175
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9512 2 174 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9253 2 174 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9185 19 176 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9122 19 174 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9051 19 175 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A535HG63-F1-model_v4 Large ribosomal subunit protein uL5 0.9706 2 176 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3C1C666-F1-model_v4 Large ribosomal subunit protein uL5 0.9689 3 176 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A645CRJ1-F1-model_v4 50S ribosomal protein L5 0.9687 2 176 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1E7IMJ8-F1-model_v4 Large ribosomal subunit protein uL5 0.9686 2 176 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A645BNS4-F1-model_v4 50S ribosomal protein L5 0.9681 2 176 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map