F344729

General Info

Members Datasets Scaffolds Average Seq Length
232 152 464 163

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100392816|Ga0068869_1003928162
Length 196
Sequence MPDVRTISVNVNGRAHTRTIETRTTLADFLRHDLGLTGTHVGCEHGVCGACTVLVEGLSARACLMLAVQCDGREVTTVESLAHNGELNPLQRAFQEFHGLQCGFCTPGVLMTLTEFLRDHPEPTESEVREVLTGNLCRCTGYQGIIRAVHAARDEMRPPVPETPAVEIDPLHETAQDAAQDTAPAEPEMLEPTLGS

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 0
Rhizoplane 3.02
Rhizosphere 87.93
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100392816 3300005334 Bacteria 1139
2 JGI25406J46586_10071852 3300003203 Bacteria 1084
3 JGI25404J52841_10020226 3300003659 Bacteria 1442
4 Ga0065704_10545504 3300005289 Bacteria 638
5 Ga0070687_100996167 3300005343 Bacteria 607
6 Ga0070668_100406076 3300005347 Bacteria 1164
7 Ga0070659_100647289 3300005366 Bacteria 911
8 Ga0070709_10005198 3300005434 Bacteria 7037
9 Ga0070714_100011147 3300005435 Bacteria 7125
10 Ga0070713_100005490 3300005436 Bacteria 8678
11 Ga0070711_100008790 3300005439 Bacteria 6197
12 Ga0070694_101264193 3300005444 Bacteria 620
13 Ga0070708_100119925 3300005445 Bacteria 2426
14 Ga0070706_100096430 3300005467 Bacteria 2745
15 Ga0070706_100265349 3300005467 Bacteria 1602
16 Ga0070707_100411640 3300005468 Bacteria 1312
17 Ga0070698_100387788 3300005471 Bacteria 1330
18 Ga0070698_100609265 3300005471 Bacteria 1032
19 Ga0070698_100927018 3300005471 Bacteria 817
20 Ga0070697_100082000 3300005536 Bacteria 2658
21 Ga0070697_100358369 3300005536 Bacteria 1261
22 Ga0070695_100493072 3300005545 Bacteria 946
23 Ga0070695_101145713 3300005545 Bacteria 638
24 Ga0070664_100228025 3300005564 Bacteria 1669
25 Ga0068864_101646211 3300005618 Bacteria 646
26 Ga0068863_100394657 3300005841 Bacteria 1352
27 Ga0068860_100000737 3300005843 Bacteria 37293
28 Ga0068860_100052198 3300005843 Bacteria 3889
29 Ga0068860_100726254 3300005843 Bacteria 1004
30 Ga0081455_10000595 3300005937 Bacteria 46866
31 Ga0081455_10376576 3300005937 Bacteria 993
32 Ga0081540_1000038 3300005983 Bacteria 138179
33 Ga0081540_1055867 3300005983 Bacteria 1920
34 Ga0081539_10005942 3300005985 Bacteria 12046
35 Ga0070717_10015254 3300006028 Bacteria 5929
36 Ga0075363_100029823 3300006048 Bacteria 2818
37 Ga0075363_100344949 3300006048 Bacteria 869
38 Ga0070715_10002595 3300006163 Bacteria 5581
39 Ga0070716_100004293 3300006173 Bacteria 6788
40 Ga0070712_100176239 3300006175 Bacteria 1663
41 Ga0070712_100591710 3300006175 Bacteria 938
42 Ga0070712_100973640 3300006175 Bacteria 733
43 Ga0075362_10083499 3300006177 Bacteria 1475
44 Ga0097621_100198349 3300006237 Bacteria 1741
45 Ga0075428_100001834 3300006844 Bacteria 22753
46 Ga0075428_100068797 3300006844 Bacteria 3872
47 Ga0075428_100142920 3300006844 Bacteria 2601
48 Ga0075428_100156667 3300006844 Bacteria 2474
49 Ga0075428_100169328 3300006844 Bacteria 2369
50 Ga0075430_100003945 3300006846 Bacteria 12517
51 Ga0075430_100017964 3300006846 Bacteria 6019
52 Ga0075431_100011330 3300006847 Bacteria 8983
53 Ga0075431_100014125 3300006847 Bacteria 8072
54 Ga0075431_100100345 3300006847 Bacteria 2986
55 Ga0075433_10001868 3300006852 Bacteria 15834
56 Ga0075433_10208520 3300006852 Bacteria 1737
57 Ga0075434_100002351 3300006871 Bacteria 16563
58 Ga0075434_100004218 3300006871 Bacteria 12888
59 Ga0075434_100004971 3300006871 Bacteria 12057
60 Ga0075434_100056147 3300006871 Bacteria 3913
61 Ga0075429_100000621 3300006880 Bacteria 27329
62 Ga0075429_100051116 3300006880 Bacteria 3596
63 Ga0075436_100313475 3300006914 Bacteria 1126
64 Ga0075435_100004011 3300007076 Bacteria 10066
65 Ga0075435_100023388 3300007076 Bacteria 4779
66 Ga0099795_10071453 3300007788 Bacteria 1310
67 Ga0111539_10007387 3300009094 Bacteria 14076
68 Ga0111539_10193901 3300009094 Bacteria 2370
69 Ga0111539_10248753 3300009094 Bacteria 2070
70 Ga0111539_10384118 3300009094 Bacteria 1635
71 Ga0114129_10023914 3300009147 Bacteria 8659
72 Ga0114129_10033644 3300009147 Bacteria 7242
73 Ga0114129_10106405 3300009147 Bacteria 3875
74 Ga0114129_10894762 3300009147 Bacteria 1125
75 Ga0099796_10204765 3300010159 Bacteria 802
76 Ga0157378_10574205 3300013297 Bacteria 1136
77 Ga0157376_10407444 3300014969 Bacteria 1316
78 Ga0213871_10046331 3300021441 Bacteria 1180
79 Ga0207692_10001660 3300025898 Bacteria 8412
80 Ga0207692_10241241 3300025898 Bacteria 1079
81 Ga0207685_10030080 3300025905 Bacteria 1930
82 Ga0207699_10013556 3300025906 Bacteria 4176
83 Ga0207684_10106399 3300025910 Bacteria 2399
84 Ga0207684_10693741 3300025910 Bacteria 865
85 Ga0207684_11251715 3300025910 Bacteria 613
86 Ga0207693_10007144 3300025915 Bacteria 9211
87 Ga0207663_10086105 3300025916 Bacteria 2071
88 Ga0207649_10521790 3300025920 Bacteria 906
89 Ga0207646_10259000 3300025922 Bacteria 1572
90 Ga0207646_10294003 3300025922 Bacteria 1467
91 Ga0207700_10005001 3300025928 Bacteria 7883
92 Ga0207700_10070908 3300025928 Bacteria 2681
93 Ga0207664_10449864 3300025929 Bacteria 1149
94 Ga0207690_11285254 3300025932 Bacteria 611
95 Ga0207665_10001974 3300025939 Bacteria 13820
96 Ga0207679_10299948 3300025945 Bacteria 1385
97 Ga0207712_11729485 3300025961 Bacteria 561
98 Ga0207668_10629476 3300025972 Bacteria 937
99 Ga0207675_101059979 3300026118 Bacteria 830
100 Ga0207675_101264734 3300026118 Bacteria 758
101 Ga0268264_10000158 3300028381 Bacteria 153433
102 Ga0268264_10399821 3300028381 Bacteria 1320
103 Ga0307512_10035811 3300030522 Bacteria 4222
104 Ga0265325_10001130 3300031241 Bacteria 19126
105 Ga0265339_10341064 3300031249 Bacteria 708
106 Ga0307509_10343863 3300031507 Bacteria 1218
107 Ga0307408_100049384 3300031548 Bacteria 3022
108 Ga0307516_10013426 3300031730 Bacteria 8730
109 Ga0307413_10121285 3300031824 Bacteria 1772
110 Ga0307410_10609952 3300031852 Bacteria 911
111 Ga0307410_11162818 3300031852 Bacteria 671
112 Ga0307406_10366373 3300031901 Bacteria 1131
113 Ga0307416_100391257 3300032002 Bacteria 1424
114 Ga0307414_10343756 3300032004 Bacteria 1278
115 Ga0307414_10352214 3300032004 Bacteria 1264
116 Ga0307415_100187630 3300032126 Bacteria 1629
117 Ga0307415_100231819 3300032126 Bacteria 1487
118 Ga0373940_0089106 3300035088 Bacteria 922
119 Ga0373942_0261353 3300035207 Bacteria 591
120 Ga0373931_0095209 3300035691 Bacteria 1666
121 Ga0373927_0173345 3300035695 Bacteria 1414
122 Ga0373947_0034734 3300035725 Bacteria 2983
123 Ga0373947_0135775 3300035725 Bacteria 1574
124 Ga0373937_0269758 3300036401 Bacteria 1606
125 Ga0373925_0083818 3300037068 Bacteria 2428
126 Ga0395898_0008708 3300037466 Bacteria 10706
127 Ga0436364_0102404 3300037853 Bacteria 1639
128 Ga0395901_0001033 3300038443 Bacteria 30162
129 Ga0436360_0024157 3300039438 Bacteria 1300
130 Ga0436363_1031519 3300039450 Bacteria 932
131 Ga0451845_0064893 3300041501 Bacteria 578
132 Ga0495603_0019233 3300046455 Bacteria 4135
133 Ga0495639_0206944 3300046475 Bacteria 962
134 Ga0495606_0123743 3300046507 Bacteria 1545
135 Ga0495640_0070652 3300046533 Bacteria 2345
136 Ga0495634_0294666 3300046642 Bacteria 982
137 Ga0495647_0039102 3300046681 Bacteria 1796
138 Ga0495658_0007423 3300046683 Bacteria 5424
139 Ga0495658_0669261 3300046683 Bacteria 665
140 Ga0495613_0082414 3300046689 Bacteria 2336
141 Ga0495624_0095705 3300046690 Bacteria 1830
142 Ga0495674_0016606 3300047319 Bacteria 6870
143 Ga0495684_0532968 3300047471 Bacteria 802
144 Ga0495686_0119265 3300047472 Bacteria 1574
145 Ga0496100_0176387 3300048903 Bacteria 1543
146 Ga0496102_1601356 3300048905 Bacteria 569
147 Ga0496104_0055156 3300048907 Bacteria 3757
148 Ga0496104_1040551 3300048907 Bacteria 722
149 Ga0496106_0066068 3300048909 Bacteria 2754
150 Ga0496110_0061144 3300048913 Bacteria 3324
151 Ga0496112_0326651 3300048915 Bacteria 1478
152 Ga0496126_0231117 3300048929 Unclassified 1549
153 Ga0501034_0030505 3300049571 Bacteria 5481
154 Ga0501034_0304297 3300049571 Bacteria 1530
155 Ga0501037_0321736 3300049573 Bacteria 1071
156 Ga0501037_0586191 3300049573 Bacteria 750
157 Ga0501038_0272150 3300049574 Bacteria 1335
158 Ga0501039_0030764 3300049575 Bacteria 4139
159 Ga0501041_0070205 3300049577 Bacteria 2150
160 Ga0501042_0039111 3300049578 Bacteria 3370
161 Ga0501042_0164477 3300049578 Bacteria 1601
162 Ga0501042_0226130 3300049578 Bacteria 1350
163 Ga0501043_0811436 3300049579 Bacteria 676
164 Ga0501047_1049776 3300049581 Bacteria 628
165 Ga0501068_0868671 3300049584 Bacteria 593
166 Ga0501070_0046331 3300049586 Bacteria 3616
167 Ga0501070_0569447 3300049586 Bacteria 905
168 Ga0501071_0006072 3300049587 Bacteria 7827
169 Ga0501072_0039493 3300049588 Bacteria 3705
170 Ga0501073_0725848 3300049589 Bacteria 685
171 Ga0501075_0021474 3300049591 Bacteria 4707
172 Ga0501076_0009878 3300049592 Bacteria 7054
173 Ga0501077_0503589 3300049593 Bacteria 776
174 Ga0501079_0032689 3300049741 Bacteria 4001
175 Ga0501080_0529271 3300049742 Bacteria 1051
176 Ga0501081_0011001 3300049743 Bacteria 5916
177 Ga0501035_0129361 3300049822 Bacteria 2202
178 Ga0501035_0176254 3300049822 Bacteria 1844
179 Ga0501035_0250994 3300049822 Bacteria 1502
180 Ga0501044_0163342 3300049823 Bacteria 2202
181 nmdc:mga03n38_472890_c1 3300050490 Bacteria 700
182 nmdc:mga0k408_673750_c1 3300050493 Bacteria 607
183 nmdc:mga06z11_378805_c1 3300050494 Bacteria 850
184 nmdc:mga07m45_300534_c1 3300050496 Bacteria 933
185 nmdc:mga07m45_9889_c1 3300050496 Bacteria 4961
186 nmdc:mga05p37_10627_c2 3300050507 Bacteria 7170
187 nmdc:mga05p37_1681256_c1 3300050507 Bacteria 620
188 nmdc:mga05p37_252920_c1 3300050507 Bacteria 2112
189 nmdc:mga05p37_31601_c1 3300050507 Bacteria 6468
190 nmdc:mga05p37_48322_c1 3300050507 Bacteria 5234
191 nmdc:mga05p37_733547_c1 3300050507 Bacteria 1092
192 nmdc:mga05p37_869226_c1 3300050507 Bacteria 977
193 nmdc:mga09592_13845_c1 3300050508 Bacteria 6591
194 nmdc:mga09592_26458_c1 3300050508 Bacteria 4807
195 nmdc:mga09592_47700_c1 3300050508 Bacteria 3611
196 nmdc:mga09592_56018_c1 3300050508 Bacteria 3331
197 nmdc:mga0qj67_147644_c1 3300050509 Bacteria 1906
198 nmdc:mga0qj67_235407_c1 3300050509 Bacteria 1486
199 nmdc:mga0qj67_24586_c1 3300050509 Bacteria 4646
200 nmdc:mga0qj67_357775_c1 3300050509 Bacteria 1180
201 nmdc:mga06r32_11648_c1 3300050510 Bacteria 7916
202 nmdc:mga06r32_151660_c1 3300050510 Bacteria 2296
203 nmdc:mga06r32_22131_c1 3300050510 Bacteria 5874
204 nmdc:mga06r32_751020_c1 3300050510 Bacteria 939
205 nmdc:mga06r32_75346_c1 3300050510 Bacteria 3274
206 nmdc:mga08y16_10155_c1 3300050511 Bacteria 9883
207 nmdc:mga08y16_1205018_c1 3300050511 Bacteria 728
208 nmdc:mga08y16_602974_c1 3300050511 Bacteria 1107
209 nmdc:mga0n895_372860_c1 3300050512 Bacteria 1445
210 nmdc:mga0n895_461049_c1 3300050512 Bacteria 1283
211 nmdc:mga0n895_5064_c1 3300050512 Bacteria 10946
212 nmdc:mga0rr50_29037_c1 3300050513 Bacteria 3895
213 nmdc:mga0rr50_599922_c1 3300050513 Bacteria 939
214 nmdc:mga0rr50_7848_c1 3300050513 Bacteria 6616
215 nmdc:mga0rr50_858699_c1 3300050513 Bacteria 774
216 nmdc:mga08x19_102051_c1 3300050514 Bacteria 1904
217 nmdc:mga08x19_166504_c1 3300050514 Bacteria 1499
218 nmdc:mga08x19_90494_c1 3300050514 Bacteria 2019
219 nmdc:mga0a205_1063266_c1 3300050515 Bacteria 656
220 nmdc:mga0a205_132366_c1 3300050515 Bacteria 2394
221 nmdc:mga0a205_28398_c1 3300050515 Bacteria 5350
222 Ga0495612_0141685 3300053078 Bacteria 1043
223 Ga0495595_0238025 3300053084 Bacteria 910
224 Ga0500578_0029295 3300053086 Bacteria 3536
225 Ga0500590_058572 3300053148 Bacteria 1940
226 Ga0500616_0016700 3300053153 Bacteria 4174
227 Ga0500636_0106327 3300053177 Bacteria 1590
228 Ga0500645_007123 3300053730 Bacteria 3928
229 Ga0500645_129951 3300053730 Bacteria 700
230 Ga0501084_0066312 3300054114 Bacteria 3020
231 Ga0501082_0068540 3300060353 Bacteria 3054
232 2623500940 2622736605 Bacteria 4992138
233 Ga0068869_100392816
234 JGI25406J46586_10071852
235 JGI25404J52841_10020226
236 Ga0065704_10545504
237 Ga0070687_100996167
238 Ga0070668_100406076
239 Ga0070659_100647289
240 Ga0070709_10005198
241 Ga0070714_100011147
242 Ga0070713_100005490
243 Ga0070711_100008790
244 Ga0070694_101264193
245 Ga0070708_100119925
246 Ga0070706_100096430
247 Ga0070706_100265349
248 Ga0070707_100411640
249 Ga0070698_100387788
250 Ga0070698_100609265
251 Ga0070698_100927018
252 Ga0070697_100082000
253 Ga0070697_100358369
254 Ga0070695_100493072
255 Ga0070695_101145713
256 Ga0070664_100228025
257 Ga0068864_101646211
258 Ga0068863_100394657
259 Ga0068860_100000737
260 Ga0068860_100052198
261 Ga0068860_100726254
262 Ga0081455_10000595
263 Ga0081455_10376576
264 Ga0081540_1000038
265 Ga0081540_1055867
266 Ga0081539_10005942
267 Ga0070717_10015254
268 Ga0075363_100029823
269 Ga0075363_100344949
270 Ga0070715_10002595
271 Ga0070716_100004293
272 Ga0070712_100176239
273 Ga0070712_100591710
274 Ga0070712_100973640
275 Ga0075362_10083499
276 Ga0097621_100198349
277 Ga0075428_100001834
278 Ga0075428_100068797
279 Ga0075428_100142920
280 Ga0075428_100156667
281 Ga0075428_100169328
282 Ga0075430_100003945
283 Ga0075430_100017964
284 Ga0075431_100011330
285 Ga0075431_100014125
286 Ga0075431_100100345
287 Ga0075433_10001868
288 Ga0075433_10208520
289 Ga0075434_100002351
290 Ga0075434_100004218
291 Ga0075434_100004971
292 Ga0075434_100056147
293 Ga0075429_100000621
294 Ga0075429_100051116
295 Ga0075436_100313475
296 Ga0075435_100004011
297 Ga0075435_100023388
298 Ga0099795_10071453
299 Ga0111539_10007387
300 Ga0111539_10193901
301 Ga0111539_10248753
302 Ga0111539_10384118
303 Ga0114129_10023914
304 Ga0114129_10033644
305 Ga0114129_10106405
306 Ga0114129_10894762
307 Ga0099796_10204765
308 Ga0157378_10574205
309 Ga0157376_10407444
310 Ga0213871_10046331
311 Ga0207692_10001660
312 Ga0207692_10241241
313 Ga0207685_10030080
314 Ga0207699_10013556
315 Ga0207684_10106399
316 Ga0207684_10693741
317 Ga0207684_11251715
318 Ga0207693_10007144
319 Ga0207663_10086105
320 Ga0207649_10521790
321 Ga0207646_10259000
322 Ga0207646_10294003
323 Ga0207700_10005001
324 Ga0207700_10070908
325 Ga0207664_10449864
326 Ga0207690_11285254
327 Ga0207665_10001974
328 Ga0207679_10299948
329 Ga0207712_11729485
330 Ga0207668_10629476
331 Ga0207675_101059979
332 Ga0207675_101264734
333 Ga0268264_10000158
334 Ga0268264_10399821
335 Ga0307512_10035811
336 Ga0265325_10001130
337 Ga0265339_10341064
338 Ga0307509_10343863
339 Ga0307408_100049384
340 Ga0307516_10013426
341 Ga0307413_10121285
342 Ga0307410_10609952
343 Ga0307410_11162818
344 Ga0307406_10366373
345 Ga0307416_100391257
346 Ga0307414_10343756
347 Ga0307414_10352214
348 Ga0307415_100187630
349 Ga0307415_100231819
350 Ga0373940_0089106
351 Ga0373942_0261353
352 Ga0373931_0095209
353 Ga0373927_0173345
354 Ga0373947_0034734
355 Ga0373947_0135775
356 Ga0373937_0269758
357 Ga0373925_0083818
358 Ga0395898_0008708
359 Ga0436364_0102404
360 Ga0395901_0001033
361 Ga0436360_0024157
362 Ga0436363_1031519
363 Ga0451845_0064893
364 Ga0495603_0019233
365 Ga0495639_0206944
366 Ga0495606_0123743
367 Ga0495640_0070652
368 Ga0495634_0294666
369 Ga0495647_0039102
370 Ga0495658_0007423
371 Ga0495658_0669261
372 Ga0495613_0082414
373 Ga0495624_0095705
374 Ga0495674_0016606
375 Ga0495684_0532968
376 Ga0495686_0119265
377 Ga0496100_0176387
378 Ga0496102_1601356
379 Ga0496104_0055156
380 Ga0496104_1040551
381 Ga0496106_0066068
382 Ga0496110_0061144
383 Ga0496112_0326651
384 Ga0496126_0231117
385 Ga0501034_0030505
386 Ga0501034_0304297
387 Ga0501037_0321736
388 Ga0501037_0586191
389 Ga0501038_0272150
390 Ga0501039_0030764
391 Ga0501041_0070205
392 Ga0501042_0039111
393 Ga0501042_0164477
394 Ga0501042_0226130
395 Ga0501043_0811436
396 Ga0501047_1049776
397 Ga0501068_0868671
398 Ga0501070_0046331
399 Ga0501070_0569447
400 Ga0501071_0006072
401 Ga0501072_0039493
402 Ga0501073_0725848
403 Ga0501075_0021474
404 Ga0501076_0009878
405 Ga0501077_0503589
406 Ga0501079_0032689
407 Ga0501080_0529271
408 Ga0501081_0011001
409 Ga0501035_0129361
410 Ga0501035_0176254
411 Ga0501035_0250994
412 Ga0501044_0163342
413 nmdc:mga03n38_472890_c1
414 nmdc:mga0k408_673750_c1
415 nmdc:mga06z11_378805_c1
416 nmdc:mga07m45_300534_c1
417 nmdc:mga07m45_9889_c1
418 nmdc:mga05p37_10627_c2
419 nmdc:mga05p37_1681256_c1
420 nmdc:mga05p37_252920_c1
421 nmdc:mga05p37_31601_c1
422 nmdc:mga05p37_48322_c1
423 nmdc:mga05p37_733547_c1
424 nmdc:mga05p37_869226_c1
425 nmdc:mga09592_13845_c1
426 nmdc:mga09592_26458_c1
427 nmdc:mga09592_47700_c1
428 nmdc:mga09592_56018_c1
429 nmdc:mga0qj67_147644_c1
430 nmdc:mga0qj67_235407_c1
431 nmdc:mga0qj67_24586_c1
432 nmdc:mga0qj67_357775_c1
433 nmdc:mga06r32_11648_c1
434 nmdc:mga06r32_151660_c1
435 nmdc:mga06r32_22131_c1
436 nmdc:mga06r32_751020_c1
437 nmdc:mga06r32_75346_c1
438 nmdc:mga08y16_10155_c1
439 nmdc:mga08y16_1205018_c1
440 nmdc:mga08y16_602974_c1
441 nmdc:mga0n895_372860_c1
442 nmdc:mga0n895_461049_c1
443 nmdc:mga0n895_5064_c1
444 nmdc:mga0rr50_29037_c1
445 nmdc:mga0rr50_599922_c1
446 nmdc:mga0rr50_7848_c1
447 nmdc:mga0rr50_858699_c1
448 nmdc:mga08x19_102051_c1
449 nmdc:mga08x19_166504_c1
450 nmdc:mga08x19_90494_c1
451 nmdc:mga0a205_1063266_c1
452 nmdc:mga0a205_132366_c1
453 nmdc:mga0a205_28398_c1
454 Ga0495612_0141685
455 Ga0495595_0238025
456 Ga0500578_0029295
457 Ga0500590_058572
458 Ga0500616_0016700
459 Ga0500636_0106327
460 Ga0500645_007123
461 Ga0500645_129951
462 Ga0501084_0066312
463 Ga0501082_0068540
464 2623500940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

77

150

0.95

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

8

93

0.89

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

9

80

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9832 5 158
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9821 4 156
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9802 5 157
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9777 3 158
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9707 5 158
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.987 81 156 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9787 81 156 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9785 3 79 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9769 5 79 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.973 3 79 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7Y8P5E4-F1-model_v4 deleted 0.9911 4 158
AF-A0A6N9C1Q0-F1-model_v4 (2Fe-2S)-binding protein 0.9907 4 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A1Q8LPG6-F1-model_v4 Carbon monoxide dehydrogenase small chain (EC 1.2.7.4) 0.99 4 157 GO:0043885
GO:0046872
GO:0051537
AF-A0A2V8AU59-F1-model_v4 Carbon monoxide dehydrogenase 0.9898 5 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A521G6U6-F1-model_v4 (2Fe-2S)-binding protein 0.9898 5 154 GO:0016491
GO:0046872
GO:0051537

Map