F344585

General Info

Members Datasets Scaffolds Average Seq Length
231 194 189 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935390628|2935393867
Length 353
Sequence LAVTLSTGDHCGMTSYPTATAASDVTPHANPITAPSPAPITAAAAGTWVLGDLEVNRIGFGTMRLPQTGEALIPDAVPRDRDLAVAVLRRAVELGVNHFDTAAFYFSRLLSANELINRALAPYADEVVVTTKVGPGRDANGEWQEHARTPAQLRGQVEENLRQLGRDHLDVVNLRVVGEDSVAERFGALADLRAAGLIRHLGLSNVRPHHLAEARAIAPVVCVQNAYGLGSSPDQAEFLRACGEQGVAFVPFYAIAGAGRTAGAAGGGERGYAGDADADADGHAEDALRRVARAHGVSQAQVRLAWSLHQGPHVLAIPGTGDPDHLAQNVAAGAVRLSAHDLAALDAQARAAG

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2643221548 Streptomyces sp. Root55 Isolate Unclassified
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
10 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
11 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
12 2867428634 Streptomyces sp. RP5T Isolate Unclassified
13 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
14 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
15 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
16 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
17 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
18 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
19 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
20 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
21 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
22 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
23 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
24 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
25 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
26 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
27 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
28 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
29 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
30 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
31 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
32 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
33 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
34 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
35 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
189 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
190 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
191 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
192 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
193 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
194 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 0
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 0
Rhizoplane 6.93
Rhizosphere 71.86
Stem 0
Stem Tuber 0
Unclassified 12.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1006447 3300002737 Bacteria 2029
2 JGI25164J39214_1001626 3300002772 Bacteria 4705
3 JGI25165J46597_1000107 3300003214 Bacteria 150846
4 JGI25153J46596_10033905 3300003215 Bacteria 1677
5 rootH1_10017793 3300003316 Bacteria 6930
6 rootH2_10159379 3300003320 Bacteria 9415
7 rootL2_10154778 3300003322 Bacteria 1642
8 rootH1_10057906 3300003323 Bacteria 4053
9 Ga0055532_1003706 3300003758 Bacteria 2510
10 Ga0055527_1000001 3300003760 Bacteria 850044
11 Ga0055529_1000065 3300003763 Bacteria 173112
12 Ga0070658_10026549 3300005327 Bacteria 4645
13 Ga0070660_100013739 3300005339 Bacteria 5822
14 Ga0070661_100065282 3300005344 Bacteria 2674
15 Ga0070659_100268495 3300005366 Bacteria 1417
16 Ga0070714_100096253 3300005435 Bacteria 2601
17 Ga0070714_100218113 3300005435 Bacteria 1752
18 Ga0070713_100052183 3300005436 Bacteria 3385
19 Ga0070713_100066759 3300005436 Bacteria 3026
20 Ga0070679_100053800 3300005530 Bacteria 4007
21 Ga0070665_100042664 3300005548 Bacteria 4560
22 Ga0068857_100056907 3300005577 Bacteria 3471
23 Ga0081455_10095431 3300005937 Bacteria 2400
24 Ga0070717_10183143 3300006028 Bacteria 1827
25 Ga0075363_100026431 3300006048 Bacteria 2969
26 Ga0105239_10310292 3300010375 Bacteria 1778
27 Ga0157369_10019678 3300013105 Bacteria 7555
28 Ga0157372_10108554 3300013307 Bacteria 3176
29 Ga0183367_1003 3300015688 Bacteria 814276
30 Ga0213875_10000363 3300021388 Bacteria 42235
31 Ga0209672_100006 3300025228 Bacteria 1004497
32 Ga0209147_102140 3300025229 Bacteria 5453
33 Ga0207427_100028 3300025231 Bacteria 388949
34 Ga0209437_100533 3300025233 Bacteria 26415
35 Ga0209258_105785 3300025242 Bacteria 2034
36 Ga0209148_1000015 3300025254 Bacteria 850103
37 Ga0209233_1000001 3300025261 Bacteria 2992747
38 Ga0209455_1000013 3300025272 Bacteria 850103
39 Ga0209758_1004515 3300025297 Bacteria 11533
40 Ga0207426_1017079 3300025302 Bacteria 2589
41 Ga0207705_10163175 3300025909 Bacteria 1675
42 Ga0207700_10083441 3300025928 Bacteria 2501
43 Ga0207664_10108004 3300025929 Bacteria 2310
44 Ga0207661_10017922 3300025944 Bacteria 5251
45 Ga0207679_10196240 3300025945 Bacteria 1683
46 Ga0207702_10084212 3300026078 Bacteria 2768
47 Ga0207674_10017930 3300026116 Bacteria 7715
48 Ga0268266_10031235 3300028379 Bacteria 4522
49 Ga0265337_1000343 3300028556 Bacteria 24866
50 Ga0265326_10008132 3300028558 Bacteria 3176
51 Ga0265319_1000384 3300028563 Bacteria 31990
52 Ga0265334_10000247 3300028573 Bacteria 31180
53 Ga0265318_10024058 3300028577 Bacteria 2421
54 Ga0265323_10007161 3300028653 Bacteria 4652
55 Ga0265322_10005753 3300028654 Bacteria 3660
56 Ga0265336_10004260 3300028666 Bacteria 5441
57 Ga0307515_10238593 3300028794 Bacteria 1594
58 Ga0265338_10008090 3300028800 Bacteria 12851
59 Ga0265324_10000995 3300029957 Bacteria 17419
60 Ga0307511_10028403 3300030521 Bacteria 5079
61 Ga0307511_10047816 3300030521 Bacteria 3493
62 Ga0265332_10024820 3300031238 Bacteria 2635
63 Ga0265320_10017192 3300031240 Bacteria 4025
64 Ga0265325_10025530 3300031241 Bacteria 3207
65 Ga0265340_10026747 3300031247 Bacteria 2913
66 Ga0265316_10010734 3300031344 Bacteria 8322
67 Ga0307513_10000002 3300031456 Bacteria 842612
68 Ga0307513_10045521 3300031456 Bacteria 4795
69 Ga0265313_10013932 3300031595 Bacteria 4786
70 Ga0307508_10184431 3300031616 Bacteria 1689
71 Ga0265314_10005959 3300031711 Bacteria 10883
72 Ga0265342_10007361 3300031712 Bacteria 8073
73 Ga0395900_0596955 3300037418 Bacteria 1045
74 Ga0395898_0003326 3300037466 Bacteria 18055
75 Ga0395898_0191543 3300037466 Bacteria 1954
76 Ga0436364_1018157 3300037853 Bacteria 78603
77 Ga0395901_0046593 3300038443 Bacteria 4504
78 Ga0395901_0118793 3300038443 Bacteria 2778
79 Ga0439439_0000318 3300041406 Bacteria 7768
80 Ga0451793_0031782 3300041452 Bacteria 1893
81 Ga0451802_1532034 3300041460 Bacteria 2461
82 Ga0439449_0009152 3300042007 Bacteria 3755
83 Ga0439457_008975 3300042014 Bacteria 2340
84 Ga0466969_0073416 3300044656 Bacteria 1642
85 Ga0466972_0006377 3300044658 Bacteria 5926
86 Ga0466972_0006826 3300044658 Bacteria 5731
87 Ga0466972_0034335 3300044658 Bacteria 2486
88 Ga0466965_0007140 3300044683 Bacteria 5115
89 Ga0466965_0058991 3300044683 Bacteria 1914
90 Ga0466965_0186851 3300044683 Bacteria 1095
91 Ga0466966_0001620 3300044684 Bacteria 14498
92 Ga0466961_0000576 3300044693 Bacteria 23314
93 Ga0466961_0022565 3300044693 Bacteria 4049
94 Ga0466963_0000279 3300044694 Bacteria 22827
95 Ga0466964_0003280 3300044706 Bacteria 5887
96 Ga0466971_0008676 3300044719 Bacteria 4434
97 Ga0466970_0000264 3300044765 Bacteria 25682
98 Ga0466957_0001635 3300044842 Bacteria 11755
99 Ga0466959_0000297 3300045049 Bacteria 29628
100 Ga0466958_0000301 3300045836 Bacteria 19375
101 Ga0466967_0005722 3300045976 Bacteria 8672
102 Ga0466967_0041677 3300045976 Bacteria 3961
103 Ga0466967_0054188 3300045976 Bacteria 3528
104 Ga0495592_0007728 3300046454 Bacteria 8053
105 Ga0495603_0002129 3300046455 Bacteria 11645
106 Ga0495603_0020573 3300046455 Bacteria 3997
107 Ga0495629_0022789 3300046459 Bacteria 4462
108 Ga0495629_0070343 3300046459 Bacteria 2441
109 Ga0495629_0078040 3300046459 Bacteria 2312
110 Ga0495651_0014508 3300046462 Bacteria 6092
111 Ga0495605_0019694 3300046474 Bacteria 3599
112 Ga0495594_0022487 3300046499 Bacteria 3373
113 Ga0495583_0064835 3300046506 Bacteria 1619
114 Ga0495606_0001661 3300046507 Bacteria 28901
115 Ga0495620_0038223 3300046515 Bacteria 2131
116 Ga0495628_0062438 3300046516 Bacteria 2920
117 Ga0495628_0065894 3300046516 Bacteria 2832
118 Ga0495643_0006220 3300046522 Bacteria 7919
119 Ga0495648_0106074 3300046524 Bacteria 1539
120 Ga0495652_0171008 3300046529 Bacteria 1677
121 Ga0495652_0251480 3300046529 Bacteria 1309
122 Ga0495640_0028093 3300046533 Bacteria 4052
123 Ga0495640_0100955 3300046533 Bacteria 1894
124 Ga0495645_0041003 3300046543 Bacteria 3376
125 Ga0495668_0000247 3300046616 Bacteria 77012
126 Ga0495634_0157556 3300046642 Bacteria 1433
127 Ga0495625_0001829 3300046660 Bacteria 24341
128 Ga0495625_0110274 3300046660 Bacteria 1881
129 Ga0495635_0099353 3300046663 Bacteria 1989
130 Ga0495613_0015013 3300046689 Bacteria 5749
131 Ga0495613_0026779 3300046689 Bacteria 4294
132 Ga0495589_0002710 3300046794 Bacteria 9792
133 Ga0495581_0108251 3300047315 Bacteria 1615
134 Ga0495604_0066788 3300047317 Bacteria 2734
135 Ga0495636_0006835 3300047318 Bacteria 4486
136 Ga0495674_0340044 3300047319 Bacteria 1220
137 Ga0495672_0067499 3300047320 Bacteria 2037
138 Ga0495676_0003054 3300047321 Bacteria 15139
139 Ga0495676_0007347 3300047321 Bacteria 10111
140 Ga0495676_0130754 3300047321 Bacteria 1812
141 Ga0495683_0039059 3300047323 Bacteria 2400
142 Ga0495687_000773 3300047443 Bacteria 34590
143 Ga0495687_042374 3300047443 Bacteria 1989
144 Ga0495687_068841 3300047443 Bacteria 1427
145 Ga0495675_0003141 3300047444 Bacteria 9915
146 Ga0495675_0209014 3300047444 Bacteria 1186
147 Ga0495685_031294 3300047447 Bacteria 1829
148 Ga0495593_0016435 3300047673 Bacteria 4174
149 Ga0495614_0026843 3300048089 Bacteria 2482
150 Ga0495626_0000273 3300048091 Bacteria 56906
151 Ga0496100_0167303 3300048903 Bacteria 1580
152 Ga0496101_0012165 3300048904 Bacteria 5736
153 Ga0496102_0107358 3300048905 Bacteria 2599
154 Ga0496103_0035511 3300048906 Bacteria 3052
155 Ga0496105_0137922 3300048908 Bacteria 2008
156 Ga0496106_0332313 3300048909 Bacteria 1220
157 Ga0496107_0382157 3300048910 Bacteria 1047
158 Ga0496108_0080224 3300048911 Bacteria 2764
159 Ga0496109_0061611 3300048912 Bacteria 3430
160 Ga0496111_0020757 3300048914 Bacteria 4578
161 Ga0496112_0326657 3300048915 Bacteria 1478
162 Ga0496113_0013615 3300048916 Bacteria 5518
163 Ga0496114_0028009 3300048917 Bacteria 4619
164 Ga0496115_0026384 3300048918 Bacteria 4534
165 Ga0496120_0041930 3300048923 Bacteria 2676
166 Ga0501033_0011649 3300049570 Bacteria 6724
167 Ga0501036_0282550 3300049572 Bacteria 1389
168 Ga0501038_0001431 3300049574 Bacteria 21881
169 Ga0501043_0130749 3300049579 Bacteria 1967
170 Ga0501047_0041574 3300049581 Bacteria 4442
171 Ga0501047_0115022 3300049581 Bacteria 2572
172 Ga0501047_0228036 3300049581 Bacteria 1717
173 Ga0501080_0160751 3300049742 Bacteria 2074
174 Ga0501035_0014651 3300049822 Bacteria 7238
175 Ga0501035_0043039 3300049822 Bacteria 4071
176 Ga0501035_0089029 3300049822 Bacteria 2719
177 Ga0501035_0117826 3300049822 Bacteria 2323
178 Ga0501044_0073447 3300049823 Bacteria 3476
179 Ga0501044_0075543 3300049823 Bacteria 3421
180 Ga0501044_0134488 3300049823 Bacteria 2464
181 Ga0501044_0160827 3300049823 Bacteria 2222
182 Ga0501044_0384054 3300049823 Bacteria 1319
183 Ga0501045_0392682 3300049824 Bacteria 1033
184 Ga0495601_0011101 3300053077 Bacteria 5384
185 Ga0495612_0015085 3300053078 Bacteria 3097
186 Ga0495619_0107069 3300053085 Bacteria 1907
187 Ga0500573_0081919 3300053140 Bacteria 1833
188 Ga0466962_0004101 3300061719 Bacteria 6977
189 Ga0466962_0059396 3300061719 Bacteria 1825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10000002 Ga0307513_10000002695 258
2 3300049823 Ga0501044_0384054 Ga0501044_0384054_478_1293 267
3 3300048903 Ga0496100_0167303 Ga0496100_0167303_492_1310 270
4 3300048904 Ga0496101_0012165 Ga0496101_0012165_460_1278 270
5 3300048905 Ga0496102_0107358 Ga0496102_0107358_525_1343 270
6 3300048906 Ga0496103_0035511 Ga0496103_0035511_643_1461 270
7 3300048908 Ga0496105_0137922 Ga0496105_0137922_475_1293 270
8 3300048910 Ga0496107_0382157 Ga0496107_0382157_175_993 270
9 3300048911 Ga0496108_0080224 Ga0496108_0080224_1077_1895 270
10 3300048912 Ga0496109_0061611 Ga0496109_0061611_21_839 270
11 3300048914 Ga0496111_0020757 Ga0496111_0020757_618_1436 270
12 3300048915 Ga0496112_0326657 Ga0496112_0326657_271_1089 270
13 3300048916 Ga0496113_0013615 Ga0496113_0013615_4430_5248 270
14 3300048917 Ga0496114_0028009 Ga0496114_0028009_2515_3333 270
15 3300048918 Ga0496115_0026384 Ga0496115_0026384_2779_3597 270
16 3300048923 Ga0496120_0041930 Ga0496120_0041930_625_1443 270
17 3300003758 Ga0055532_1003706 Ga0055532_10037062 272
18 3300003760 Ga0055527_1000001 Ga0055527_100000183 272
19 3300003763 Ga0055529_1000065 Ga0055529_100006583 272
20 3300025228 Ga0209672_100006 Ga0209672_100006893 272
21 3300025229 Ga0209147_102140 Ga0209147_1021405 272
22 3300025242 Ga0209258_105785 Ga0209258_1057853 272
23 3300025254 Ga0209148_1000015 Ga0209148_1000015737 272
24 3300025272 Ga0209455_1000013 Ga0209455_1000013737 272
25 3300021388 Ga0213875_10000363 Ga0213875_100003639 276
26 3300037853 Ga0436364_1018157 Ga0436364_1018157_57066_57941 276
27 3300005327 Ga0070658_10026549 Ga0070658_100265492 280
28 3300005344 Ga0070661_100065282 Ga0070661_1000652822 280
29 3300005530 Ga0070679_100053800 Ga0070679_1000538004 280
30 3300025909 Ga0207705_10163175 Ga0207705_101631752 280
31 3300046455 Ga0495603_0002129 Ga0495603_0002129_3516_4475 285
32 3300046459 Ga0495629_0022789 Ga0495629_0022789_1838_2803 285
33 3300046459 Ga0495629_0078040 Ga0495629_0078040_788_1747 285
34 3300046462 Ga0495651_0014508 Ga0495651_0014508_23_988 285
35 3300046516 Ga0495628_0065894 Ga0495628_0065894_562_1527 285
36 3300046533 Ga0495640_0028093 Ga0495640_0028093_274_1239 285
37 3300046689 Ga0495613_0015013 Ga0495613_0015013_2031_2996 285
38 3300047317 Ga0495604_0066788 Ga0495604_0066788_1711_2676 285
39 3300047321 Ga0495676_0003054 Ga0495676_0003054_6172_7137 285
40 iso_pu_bacteria 2643221601 2644015639 285
41 iso_pu_bacteria 2643221631 2644177368 285
42 3300046454 Ga0495592_0007728 Ga0495592_0007728_4364_5329 286
43 3300047444 Ga0495675_0209014 Ga0495675_0209014_172_1125 286
44 iso_pu_bacteria 2802429296 2804846918 286
45 iso_pu_bacteria 2887478801 2887486146 286
46 iso_pu_bacteria 2996221748 2996223606 286
47 iso_pu_bacteria 8025413630 8025417814 286
48 3300003316 rootH1_10017793 rootH1_100177936 287
49 3300003323 rootH1_10057906 rootH1_100579064 287
50 3300005436 Ga0070713_100052183 Ga0070713_1000521833 287
51 3300006028 Ga0070717_10183143 Ga0070717_101831432 287
52 iso_pu_bacteria 2643221548 2643765190 287
53 iso_pu_bacteria 2643221682 2644460972 287
54 iso_pu_bacteria 2906799679 2906800645 287
55 3300030521 Ga0307511_10028403 Ga0307511_100284035 288
56 3300031616 Ga0307508_10184431 Ga0307508_101844312 288
57 3300046507 Ga0495606_0001661 Ga0495606_0001661_12213_13091 288
58 3300046543 Ga0495645_0041003 Ga0495645_0041003_637_1581 288
59 3300046616 Ga0495668_0000247 Ga0495668_0000247_69171_70049 288
60 3300046660 Ga0495625_0001829 Ga0495625_0001829_7371_8249 288
61 3300047323 Ga0495683_0039059 Ga0495683_0039059_872_1750 288
62 3300048091 Ga0495626_0000273 Ga0495626_0000273_16154_17032 288
63 iso_pu_bacteria 2818991472 2819744367 288
64 3300046499 Ga0495594_0022487 Ga0495594_0022487_1409_2296 289
65 3300049822 Ga0501035_0014651 Ga0501035_0014651_5549_6451 289
66 iso_pu_bacteria 2818991472 2819744407 289
67 iso_pu_bacteria 8055066027 8055066169 289
68 iso_pu_bacteria 2582581314 2585320388 290
69 3300003322 rootL2_10154778 rootL2_101547782 291
70 3300006048 Ga0075363_100026431 Ga0075363_1000264312 291
71 3300015688 Ga0183367_1003 Ga0183367_1003654 291
72 3300046533 Ga0495640_0100955 Ga0495640_0100955_261_1148 291
73 3300049579 Ga0501043_0130749 Ga0501043_0130749_196_1128 291
74 3300049581 Ga0501047_0115022 Ga0501047_0115022_1582_2514 291
75 3300049822 Ga0501035_0117826 Ga0501035_0117826_1355_2287 291
76 3300049823 Ga0501044_0160827 Ga0501044_0160827_45_977 291
77 3300049824 Ga0501045_0392682 Ga0501045_0392682_67_999 291
78 iso_pu_bacteria 2547132111 2547408876 291
79 iso_pu_bacteria 2582581312 2585297386 291
80 iso_pu_bacteria 2643221714 2644630793 291
81 iso_pu_bacteria 2867428634 2867437256 291
82 iso_pu_bacteria 2891395885 2891397231 291
83 iso_pu_bacteria 2912723979 2912726798 291
84 iso_pu_bacteria 2946045630 2946048267 291
85 iso_pu_bacteria 2946072368 2946073024 291
86 iso_pu_bacteria 2947224130 2947224557 291
87 iso_pu_bacteria 2954002825 2954008178 291
88 iso_pu_bacteria 2954711539 2954719122 291
89 iso_pu_bacteria 2954721474 2954729092 291
90 iso_pu_bacteria 2954740390 2954747992 291
91 iso_pu_bacteria 2954749733 2954751597 291
92 iso_pu_bacteria 2954759201 2954767117 291
93 iso_pu_bacteria 3006393351 3006396701 291
94 iso_pu_bacteria 8023623736 8023624574 291
95 iso_pu_bacteria 8025530807 8025532021 291
96 iso_pu_bacteria 8056667051 8056671083 291
97 iso_pu_bacteria 8056829672 8056831002 291
98 3300005937 Ga0081455_10095431 Ga0081455_100954312 292
99 3300049581 Ga0501047_0228036 Ga0501047_0228036_646_1557 292
100 3300049823 Ga0501044_0075543 Ga0501044_0075543_1137_2063 292
101 iso_pu_bacteria 2875391855 2875394983 292
102 iso_pu_bacteria 8008574985 8008581410 292
103 3300003215 JGI25153J46596_10033905 JGI25153J46596_100339052 293
104 3300005548 Ga0070665_100042664 Ga0070665_1000426643 293
105 3300025297 Ga0209758_1004515 Ga0209758_10045156 293
106 3300025302 Ga0207426_1017079 Ga0207426_10170792 293
107 3300026078 Ga0207702_10084212 Ga0207702_100842123 293
108 3300028379 Ga0268266_10031235 Ga0268266_100312354 293
109 3300028794 Ga0307515_10238593 Ga0307515_102385932 293
110 3300030521 Ga0307511_10047816 Ga0307511_100478162 293
111 3300031456 Ga0307513_10045521 Ga0307513_100455216 293
112 3300037418 Ga0395900_0596955 Ga0395900_0596955_62_967 293
113 3300037466 Ga0395898_0003326 Ga0395898_0003326_13146_14051 293
114 3300037466 Ga0395898_0191543 Ga0395898_0191543_976_1884 293
115 3300038443 Ga0395901_0046593 Ga0395901_0046593_2285_3190 293
116 3300038443 Ga0395901_0118793 Ga0395901_0118793_969_1874 293
117 3300041406 Ga0439439_0000318 Ga0439439_0000318_1113_2021 293
118 3300041452 Ga0451793_0031782 Ga0451793_0031782_735_1634 293
119 3300041460 Ga0451802_1532034 Ga0451802_1532034_889_1788 293
120 3300042007 Ga0439449_0009152 Ga0439449_0009152_537_1445 293
121 3300042014 Ga0439457_008975 Ga0439457_008975_1415_2323 293
122 3300044656 Ga0466969_0073416 Ga0466969_0073416_137_1042 293
123 3300044658 Ga0466972_0006377 Ga0466972_0006377_1250_2158 293
124 3300044658 Ga0466972_0006826 Ga0466972_0006826_1923_2828 293
125 3300044658 Ga0466972_0034335 Ga0466972_0034335_1429_2334 293
126 3300044683 Ga0466965_0007140 Ga0466965_0007140_2004_2912 293
127 3300044683 Ga0466965_0058991 Ga0466965_0058991_789_1694 293
128 3300044683 Ga0466965_0186851 Ga0466965_0186851_175_1083 293
129 3300044684 Ga0466966_0001620 Ga0466966_0001620_8609_9517 293
130 3300044693 Ga0466961_0000576 Ga0466961_0000576_21005_21913 293
131 3300044693 Ga0466961_0022565 Ga0466961_0022565_696_1601 293
132 3300044694 Ga0466963_0000279 Ga0466963_0000279_11630_12538 293
133 3300044706 Ga0466964_0003280 Ga0466964_0003280_4646_5554 293
134 3300044719 Ga0466971_0008676 Ga0466971_0008676_2125_3033 293
135 3300044765 Ga0466970_0000264 Ga0466970_0000264_22444_23352 293
136 3300044842 Ga0466957_0001635 Ga0466957_0001635_8607_9515 293
137 3300045049 Ga0466959_0000297 Ga0466959_0000297_7532_8440 293
138 3300045836 Ga0466958_0000301 Ga0466958_0000301_15322_16230 293
139 3300045976 Ga0466967_0005722 Ga0466967_0005722_5562_6470 293
140 3300045976 Ga0466967_0041677 Ga0466967_0041677_2503_3423 293
141 3300045976 Ga0466967_0054188 Ga0466967_0054188_2478_3383 293
142 3300046455 Ga0495603_0020573 Ga0495603_0020573_2717_3622 293
143 3300046459 Ga0495629_0070343 Ga0495629_0070343_1155_2060 293
144 3300046474 Ga0495605_0019694 Ga0495605_0019694_34_939 293
145 3300046506 Ga0495583_0064835 Ga0495583_0064835_12_920 293
146 3300046515 Ga0495620_0038223 Ga0495620_0038223_458_1366 293
147 3300046516 Ga0495628_0062438 Ga0495628_0062438_1942_2850 293
148 3300046522 Ga0495643_0006220 Ga0495643_0006220_5617_6525 293
149 3300046524 Ga0495648_0106074 Ga0495648_0106074_126_1034 293
150 3300046529 Ga0495652_0171008 Ga0495652_0171008_81_1016 293
151 3300046529 Ga0495652_0251480 Ga0495652_0251480_311_1219 293
152 3300046642 Ga0495634_0157556 Ga0495634_0157556_34_942 293
153 3300046660 Ga0495625_0110274 Ga0495625_0110274_185_1093 293
154 3300046663 Ga0495635_0099353 Ga0495635_0099353_209_1117 293
155 3300046689 Ga0495613_0026779 Ga0495613_0026779_2268_3173 293
156 3300046794 Ga0495589_0002710 Ga0495589_0002710_8479_9387 293
157 3300047315 Ga0495581_0108251 Ga0495581_0108251_314_1222 293
158 3300047318 Ga0495636_0006835 Ga0495636_0006835_3227_4153 293
159 3300047319 Ga0495674_0340044 Ga0495674_0340044_235_1143 293
160 3300047320 Ga0495672_0067499 Ga0495672_0067499_532_1440 293
161 3300047321 Ga0495676_0007347 Ga0495676_0007347_8848_9753 293
162 3300047321 Ga0495676_0130754 Ga0495676_0130754_471_1379 293
163 3300047443 Ga0495687_000773 Ga0495687_000773_33082_34008 293
164 3300047443 Ga0495687_042374 Ga0495687_042374_470_1378 293
165 3300047443 Ga0495687_068841 Ga0495687_068841_52_957 293
166 3300047444 Ga0495675_0003141 Ga0495675_0003141_916_1836 293
167 3300047447 Ga0495685_031294 Ga0495685_031294_733_1659 293
168 3300047673 Ga0495593_0016435 Ga0495593_0016435_3050_3958 293
169 3300048089 Ga0495614_0026843 Ga0495614_0026843_382_1287 293
170 3300048909 Ga0496106_0332313 Ga0496106_0332313_300_1205 293
171 3300049570 Ga0501033_0011649 Ga0501033_0011649_5267_6172 293
172 3300049572 Ga0501036_0282550 Ga0501036_0282550_340_1245 293
173 3300049574 Ga0501038_0001431 Ga0501038_0001431_14964_15869 293
174 3300049581 Ga0501047_0041574 Ga0501047_0041574_1208_2113 293
175 3300049742 Ga0501080_0160751 Ga0501080_0160751_116_1021 293
176 3300049822 Ga0501035_0043039 Ga0501035_0043039_1109_2023 293
177 3300049822 Ga0501035_0089029 Ga0501035_0089029_1355_2260 293
178 3300049823 Ga0501044_0073447 Ga0501044_0073447_297_1202 293
179 3300049823 Ga0501044_0134488 Ga0501044_0134488_1167_2081 293
180 3300053077 Ga0495601_0011101 Ga0495601_0011101_793_1728 293
181 3300053078 Ga0495612_0015085 Ga0495612_0015085_620_1555 293
182 3300053085 Ga0495619_0107069 Ga0495619_0107069_860_1795 293
183 3300053140 Ga0500573_0081919 Ga0500573_0081919_270_1193 293
184 3300061719 Ga0466962_0004101 Ga0466962_0004101_3739_4647 293
185 3300061719 Ga0466962_0059396 Ga0466962_0059396_634_1539 293
186 iso_pu_bacteria 2862178590 2862184850 293
187 iso_pu_bacteria 2884693830 2884702119 293
188 iso_pu_bacteria 2895442618 2895445339 293
189 iso_pu_bacteria 2935390628 2935393867 293
190 iso_pu_bacteria 2954731030 2954732719 293
191 iso_pu_bacteria 2990059506 2990066049 293
192 3300005339 Ga0070660_100013739 Ga0070660_1000137396 294
193 3300005366 Ga0070659_100268495 Ga0070659_1002684951 294
194 3300005435 Ga0070714_100096253 Ga0070714_1000962533 294
195 3300005436 Ga0070713_100066759 Ga0070713_1000667592 294
196 3300005577 Ga0068857_100056907 Ga0068857_1000569071 294
197 3300010375 Ga0105239_10310292 Ga0105239_103102923 294
198 3300013105 Ga0157369_10019678 Ga0157369_100196785 294
199 3300025928 Ga0207700_10083441 Ga0207700_100834412 294
200 3300025944 Ga0207661_10017922 Ga0207661_100179223 294
201 3300025945 Ga0207679_10196240 Ga0207679_101962402 294
202 3300026116 Ga0207674_10017930 Ga0207674_100179302 294
203 3300003320 rootH2_10159379 rootH2_101593792 296
204 3300005435 Ga0070714_100218113 Ga0070714_1002181132 299
205 3300025929 Ga0207664_10108004 Ga0207664_101080042 299
206 3300028556 Ga0265337_1000343 Ga0265337_10003431 299
207 3300028558 Ga0265326_10008132 Ga0265326_100081322 299
208 3300028563 Ga0265319_1000384 Ga0265319_10003842 299
209 3300028573 Ga0265334_10000247 Ga0265334_100002473 299
210 3300028577 Ga0265318_10024058 Ga0265318_100240582 299
211 3300028653 Ga0265323_10007161 Ga0265323_100071616 299
212 3300028654 Ga0265322_10005753 Ga0265322_100057534 299
213 3300028666 Ga0265336_10004260 Ga0265336_100042603 299
214 3300028800 Ga0265338_10008090 Ga0265338_100080904 299
215 3300029957 Ga0265324_10000995 Ga0265324_1000099516 299
216 3300031238 Ga0265332_10024820 Ga0265332_100248202 299
217 3300031240 Ga0265320_10017192 Ga0265320_100171924 299
218 3300031241 Ga0265325_10025530 Ga0265325_100255302 299
219 3300031247 Ga0265340_10026747 Ga0265340_100267472 299
220 3300031344 Ga0265316_10010734 Ga0265316_100107348 299
221 3300031595 Ga0265313_10013932 Ga0265313_100139324 299
222 3300031711 Ga0265314_10005959 Ga0265314_1000595911 299
223 3300031712 Ga0265342_10007361 Ga0265342_100073618 299
224 iso_pu_bacteria 2995463766 2995469940 299
225 3300013307 Ga0157372_10108554 Ga0157372_101085544 301
226 3300002737 JGI25162J39368_1006447 JGI25162J39368_10064472 304
227 3300002772 JGI25164J39214_1001626 JGI25164J39214_10016265 304
228 3300003214 JGI25165J46597_1000107 JGI25165J46597_100010753 304
229 3300025231 Ga0207427_100028 Ga0207427_100028254 304
230 3300025233 Ga0209437_100533 Ga0209437_10053311 304
231 3300025261 Ga0209233_1000001 Ga0209233_1000001752 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

57

350

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9177 21 299
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8864 26 302
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8802 24 304
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8721 21 302
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8655 21 299
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.926 23 300 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9125 23 302 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9067 23 300 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8802 24 304 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8721 21 302 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0F2TLX7-F1-model_v4 Aldo/keto reductase 0.9759 21 299 GO:0004033
GO:0005737
AF-A0A4D4LGX4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9744 148 302 GO:0016491
AF-A0A4R2QBM3-F1-model_v4 deleted 0.9721 21 301
AF-A0A7W7RYD1-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase/predicted acetyltransferase 0.9691 21 299 GO:0004033
GO:0005737
GO:0016747
AF-A0A6B2RS58-F1-model_v4 Aldo/keto reductase 0.9687 21 299 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
84.25 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map