F344338

General Info

Members Datasets Scaffolds Average Seq Length
231 134 229 229

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_001210|Ga0495627_001210_11846_12607
Length 253
Sequence MPAEYLMPETPANPPKRRTKAAQRAETLQQILDAAEYLFSKHGLHGVTLKDVAQRVGVHTSLLHYYFDDKKSLFDAVIARRAPVTSGRRMAALDQYERDAGDDVTVEGALRAFLDTDLDLYIEGDEGWRNYTQLGALISNTPEWGAETMDKHFDPVVLRLVGLLKKAMPGSCDEDVFWGYHFVTGALMLTLGRTGRIDKLSGGLCRSEDFAAVKGRMTTFMAAGMTALCLNKAGAPVPAATPALTTPRRKRPA

Samples

Sample ID Description Type Environment
1 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
2 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
94 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
130 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 0
Rhizoplane 0
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000803 3300003320 Bacteria 11163
2 Ga0055536_1001991 3300003781 Bacteria 11726
3 Ga0055530_10000008 3300003791 Bacteria 174217
4 Ga0055531_10011908 3300003794 Bacteria 4141
5 Ga0055531_10012784 3300003794 Bacteria 3917
6 Ga0065165_1000222 3300005262 Bacteria 99737
7 Ga0065165_1022549 3300005262 Bacteria 2155
8 Ga0070658_10007077 3300005327 Bacteria 9052
9 Ga0070658_10066057 3300005327 Bacteria 2954
10 Ga0070683_100236579 3300005329 Bacteria 1737
11 Ga0070680_100008303 3300005336 Bacteria 7945
12 Ga0070680_100087972 3300005336 Bacteria 2569
13 Ga0070680_100098703 3300005336 Bacteria 2423
14 Ga0070680_100334471 3300005336 Bacteria 1286
15 Ga0070660_100003015 3300005339 Bacteria 11596
16 Ga0070691_10006192 3300005341 Bacteria 5460
17 Ga0070661_100025364 3300005344 Bacteria 4260
18 Ga0070659_100001785 3300005366 Bacteria 15473
19 Ga0070663_100070188 3300005455 Bacteria 2547
20 Ga0070681_10006656 3300005458 Bacteria 11247
21 Ga0070681_10013479 3300005458 Bacteria 8123
22 Ga0070681_10038433 3300005458 Bacteria 4799
23 Ga0070681_10087840 3300005458 Bacteria 3061
24 Ga0070679_100021314 3300005530 Bacteria 6324
25 Ga0070679_100283054 3300005530 Bacteria 1610
26 Ga0070679_100801508 3300005530 Bacteria 885
27 Ga0068853_100001152 3300005539 Bacteria 18762
28 Ga0068853_100009024 3300005539 Bacteria 8031
29 Ga0068853_100020677 3300005539 Bacteria 5474
30 Ga0070665_100002461 3300005548 Bacteria 20402
31 Ga0070665_100019484 3300005548 Bacteria 6810
32 Ga0068855_100000157 3300005563 Bacteria 86631
33 Ga0068855_100003507 3300005563 Bacteria 19218
34 Ga0068855_100017422 3300005563 Bacteria 8642
35 Ga0068855_100038077 3300005563 Bacteria 5716
36 Ga0068855_100103617 3300005563 Bacteria 3273
37 Ga0068857_100482145 3300005577 Bacteria 1162
38 Ga0068854_100125610 3300005578 Bacteria 1953
39 Ga0068852_100043527 3300005616 Bacteria 3809
40 Ga0068852_100067755 3300005616 Bacteria 3121
41 Ga0068852_100403054 3300005616 Bacteria 1346
42 Ga0068861_100058459 3300005719 Bacteria 2949
43 Ga0068862_100192739 3300005844 Bacteria 1835
44 Ga0075362_10171468 3300006177 Bacteria 1049
45 Ga0068871_100024549 3300006358 Bacteria 4677
46 Ga0075428_100032416 3300006844 Bacteria 5772
47 Ga0075430_100005091 3300006846 Bacteria 11062
48 Ga0075431_100001106 3300006847 Bacteria 24142
49 Ga0105240_10002740 3300009093 Bacteria 27879
50 Ga0105240_10016450 3300009093 Bacteria 10011
51 Ga0105240_10092963 3300009093 Bacteria 3682
52 Ga0105240_10093481 3300009093 Bacteria 3670
53 Ga0105240_10163501 3300009093 Bacteria 2641
54 Ga0105240_10490313 3300009093 Bacteria 1368
55 Ga0105247_10247067 3300009101 Bacteria 1218
56 Ga0114129_10433363 3300009147 Bacteria 1727
57 Ga0105237_10009748 3300009545 Bacteria 10275
58 Ga0105237_10112820 3300009545 Bacteria 2710
59 Ga0105238_10057415 3300009551 Bacteria 3903
60 Ga0105238_10066379 3300009551 Bacteria 3610
61 Ga0105238_10153208 3300009551 Bacteria 2280
62 Ga0105238_10348980 3300009551 Bacteria 1469
63 Ga0105238_10596234 3300009551 Bacteria 1112
64 Ga0105238_10665870 3300009551 Bacteria 1052
65 Ga0105238_10913172 3300009551 Bacteria 897
66 Ga0105239_10371145 3300010375 Bacteria 1617
67 Ga0157373_10050193 3300013100 Bacteria 2971
68 Ga0157371_10482334 3300013102 Unclassified 914
69 Ga0157370_10006019 3300013104 Bacteria 13495
70 Ga0157370_10513933 3300013104 Bacteria 1099
71 Ga0157369_10011959 3300013105 Bacteria 9859
72 Ga0157369_10234082 3300013105 Unclassified 1920
73 Ga0157372_10010466 3300013307 Bacteria 9871
74 Ga0157379_10297260 3300014968 Bacteria 1471
75 Ga0157379_10345803 3300014968 Bacteria 1361
76 Ga0157376_10731553 3300014969 Bacteria 997
77 Ga0209676_1000061 3300025292 Bacteria 332674
78 Ga0209758_1000215 3300025297 Bacteria 125461
79 Ga0209050_1000049 3300025298 Bacteria 364096
80 Ga0209050_1023900 3300025298 Bacteria 2133
81 Ga0209257_1000207 3300025304 Bacteria 142151
82 Ga0209257_1000915 3300025304 Bacteria 41034
83 Ga0207699_10086389 3300025906 Bacteria 1959
84 Ga0207705_10001231 3300025909 Bacteria 20618
85 Ga0207705_10030991 3300025909 Bacteria 3816
86 Ga0207705_10127202 3300025909 Bacteria 1894
87 Ga0207654_10055736 3300025911 Bacteria 2290
88 Ga0207707_10001184 3300025912 Bacteria 24565
89 Ga0207707_10011055 3300025912 Bacteria 7851
90 Ga0207707_10016495 3300025912 Bacteria 6440
91 Ga0207707_10068341 3300025912 Bacteria 3095
92 Ga0207707_10444513 3300025912 Bacteria 1110
93 Ga0207695_10000004 3300025913 Bacteria 1288665
94 Ga0207695_10013263 3300025913 Bacteria 9833
95 Ga0207695_10259178 3300025913 Bacteria 1637
96 Ga0207695_10371020 3300025913 Unclassified 1317
97 Ga0207671_10046020 3300025914 Bacteria 3227
98 Ga0207671_10169609 3300025914 Bacteria 1694
99 Ga0207671_10552538 3300025914 Bacteria 918
100 Ga0207663_10281261 3300025916 Bacteria 1236
101 Ga0207660_10000826 3300025917 Bacteria 20412
102 Ga0207660_10003006 3300025917 Bacteria 11037
103 Ga0207660_10018388 3300025917 Bacteria 4658
104 Ga0207660_10040963 3300025917 Bacteria 3245
105 Ga0207657_10000141 3300025919 Bacteria 72714
106 Ga0207657_10004370 3300025919 Bacteria 14958
107 Ga0207649_10015547 3300025920 Bacteria 4276
108 Ga0207649_10333483 3300025920 Bacteria 1118
109 Ga0207652_10001119 3300025921 Bacteria 24156
110 Ga0207652_10272854 3300025921 Bacteria 1525
111 Ga0207652_10279025 3300025921 Bacteria 1507
112 Ga0207652_10643151 3300025921 Bacteria 949
113 Ga0207694_10000015 3300025924 Bacteria 363898
114 Ga0207694_10040940 3300025924 Bacteria 3570
115 Ga0207694_10251719 3300025924 Unclassified 1446
116 Ga0207694_10618144 3300025924 Bacteria 912
117 Ga0207687_10546393 3300025927 Unclassified 971
118 Ga0207690_10318258 3300025932 Bacteria 1222
119 Ga0207690_10374428 3300025932 Unclassified 1130
120 Ga0207661_10386285 3300025944 Bacteria 1268
121 Ga0207661_10571473 3300025944 Bacteria 1037
122 Ga0207667_10000160 3300025949 Bacteria 99695
123 Ga0207667_10004111 3300025949 Bacteria 17877
124 Ga0207667_10012116 3300025949 Bacteria 9964
125 Ga0207667_10024873 3300025949 Bacteria 6566
126 Ga0207667_10029379 3300025949 Bacteria 5962
127 Ga0207640_10104362 3300025981 Bacteria 1995
128 Ga0207640_10625311 3300025981 Bacteria 914
129 Ga0207703_10166843 3300026035 Bacteria 1933
130 Ga0207639_10003714 3300026041 Bacteria 10270
131 Ga0207639_10155879 3300026041 Bacteria 1918
132 Ga0207639_10225464 3300026041 Bacteria 1621
133 Ga0207674_10151323 3300026116 Bacteria 2278
134 Ga0207675_100063751 3300026118 Bacteria 3444
135 Ga0207698_10005527 3300026142 Bacteria 7821
136 Ga0207698_10462669 3300026142 Bacteria 1227
137 Ga0268266_10002142 3300028379 Bacteria 21714
138 Ga0268266_10028690 3300028379 Bacteria 4730
139 Ga0265334_10044662 3300028573 Bacteria 1719
140 Ga0265334_10076292 3300028573 Unclassified 1241
141 Ga0265318_10000056 3300028577 Bacteria 113159
142 Ga0265338_10000014 3300028800 Bacteria 378751
143 Ga0265338_10022060 3300028800 Bacteria 6614
144 Ga0265338_10029232 3300028800 Bacteria 5468
145 Ga0265338_10030997 3300028800 Bacteria 5252
146 Ga0265338_10054682 3300028800 Bacteria 3557
147 Ga0265338_10073334 3300028800 Bacteria 2918
148 Ga0265338_10079387 3300028800 Bacteria 2762
149 Ga0265338_10087588 3300028800 Bacteria 2586
150 Ga0265338_10218927 3300028800 Bacteria 1423
151 Ga0265332_10006243 3300031238 Bacteria 5424
152 Ga0265320_10000155 3300031240 Bacteria 57130
153 Ga0265325_10000013 3300031241 Bacteria 142935
154 Ga0265325_10035361 3300031241 Bacteria 2654
155 Ga0265325_10049863 3300031241 Bacteria 2158
156 Ga0265340_10018404 3300031247 Bacteria 3603
157 Ga0265340_10206552 3300031247 Bacteria 882
158 Ga0265339_10001198 3300031249 Bacteria 19545
159 Ga0265339_10034327 3300031249 Bacteria 2851
160 Ga0265331_10002945 3300031250 Bacteria 11227
161 Ga0265331_10003281 3300031250 Bacteria 10519
162 Ga0265331_10005347 3300031250 Bacteria 7762
163 Ga0265327_10000095 3300031251 Bacteria 194803
164 Ga0265316_10324009 3300031344 Unclassified 1119
165 Ga0307513_10061299 3300031456 Bacteria 3983
166 Ga0307509_10000004 3300031507 Bacteria 535507
167 Ga0265313_10001047 3300031595 Bacteria 26908
168 Ga0265314_10044905 3300031711 Bacteria 3128
169 Ga0265314_10047579 3300031711 Bacteria 3016
170 Ga0265314_10120670 3300031711 Bacteria 1651
171 Ga0265342_10015061 3300031712 Bacteria 5102
172 Ga0307516_10058953 3300031730 Bacteria 3735
173 Ga0307414_10000558 3300032004 Bacteria 19463
174 Ga0307414_10528352 3300032004 Bacteria 1048
175 Ga0307411_10047718 3300032005 Bacteria 2770
176 Ga0373936_0010351 3300035113 Bacteria 3518
177 Ga0395898_0237821 3300037466 Bacteria 1737
178 Ga0395905_0006821 3300037471 Bacteria 11431
179 Ga0237819_05845 3300038705 Bacteria 1894
180 Ga0237816_01992 3300039145 Bacteria 1608
181 Ga0466959_0003517 3300045049 Bacteria 10281
182 Ga0466959_0008462 3300045049 Bacteria 7277
183 Ga0495627_001210 3300046453 Bacteria 16166
184 Ga0495650_0001187 3300046471 Bacteria 27632
185 Ga0495583_0033383 3300046506 Bacteria 2476
186 Ga0495610_0000451 3300046512 Bacteria 42520
187 Ga0495620_0006006 3300046515 Bacteria 6721
188 Ga0495652_0054161 3300046529 Bacteria 3417
189 Ga0495587_0097005 3300046536 Bacteria 1700
190 Ga0495645_0099846 3300046543 Bacteria 2065
191 Ga0495625_0080869 3300046660 Bacteria 2262
192 Ga0495600_0183074 3300046809 Bacteria 1350
193 Ga0495681_0001722 3300047470 Bacteria 16166
194 Ga0495686_0000088 3300047472 Bacteria 195862
195 Ga0495686_0000522 3300047472 Bacteria 55463
196 Ga0495686_0186248 3300047472 Bacteria 1199
197 Ga0495602_0475482 3300048088 Bacteria 878
198 Ga0496121_0000825 3300048924 Bacteria 56515
199 Ga0496125_0002810 3300048928 Bacteria 21973
200 Ga0496125_0128094 3300048928 Bacteria 1794
201 Ga0495682_0000882 3300049460 Bacteria 18611
202 Ga0501031_0017336 3300049568 Bacteria 4679
203 Ga0501032_0042961 3300049569 Bacteria 3064
204 Ga0501033_0060507 3300049570 Bacteria 2794
205 Ga0501033_0282074 3300049570 Bacteria 1172
206 Ga0501037_0021961 3300049573 Bacteria 4725
207 Ga0501038_0049353 3300049574 Bacteria 3639
208 Ga0501047_0019271 3300049581 Bacteria 6546
209 Ga0501070_0000444 3300049586 Bacteria 37674
210 Ga0501080_0002812 3300049742 Bacteria 15295
211 Ga0501035_0014352 3300049822 Bacteria 7313
212 Ga0501035_0092507 3300049822 Bacteria 2661
213 Ga0501044_0013209 3300049823 Bacteria 8942
214 Ga0501044_0113096 3300049823 Bacteria 2722
215 nmdc:mga05p37_631511_c1 3300050507 Bacteria 1203
216 nmdc:mga0qj67_3167_c1 3300050509 Bacteria 11850
217 nmdc:mga06r32_300_c1 3300050510 Bacteria 40927
218 Ga0500643_000718 3300053087 Bacteria 21827
219 Ga0500643_003172 3300053087 Bacteria 8036
220 Ga0500643_005631 3300053087 Bacteria 5360
221 Ga0500646_0096182 3300053090 Bacteria 924
222 Ga0500651_0086785 3300053093 Bacteria 1932
223 Ga0500595_066231 3300053119 Bacteria 1080
224 Ga0500655_005559 3300053133 Bacteria 2271
225 Ga0500559_0010408 3300053136 Bacteria 3994
226 Ga0500568_0136514 3300053139 Bacteria 910
227 Ga0500616_0000019 3300053153 Bacteria 549964
228 Ga0500637_0091561 3300053178 Bacteria 1762
229 Ga0501084_0008966 3300054114 Bacteria 8274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10018404 Ga0265340_100184041 198
2 iso_pu_bacteria 2894414249 2894415972 200
3 3300028800 Ga0265338_10029232 Ga0265338_100292322 203
4 3300028800 Ga0265338_10073334 Ga0265338_100733342 203
5 3300031250 Ga0265331_10003281 Ga0265331_100032817 204
6 3300031251 Ga0265327_10000095 Ga0265327_1000009542 204
7 3300010375 Ga0105239_10371145 Ga0105239_103711452 206
8 3300053136 Ga0500559_0010408 Ga0500559_0010408_3252_3968 206
9 3300006844 Ga0075428_100032416 Ga0075428_1000324163 207
10 3300006846 Ga0075430_100005091 Ga0075430_1000050918 207
11 3300006847 Ga0075431_100001106 Ga0075431_1000011068 207
12 3300009147 Ga0114129_10433363 Ga0114129_104333632 207
13 3300048928 Ga0496125_0002810 Ga0496125_0002810_18644_19351 207
14 3300050507 nmdc:mga05p37_631511_c1 nmdc:mga05p37_631511_c1_424_1134 207
15 3300050509 nmdc:mga0qj67_3167_c1 nmdc:mga0qj67_3167_c1_4068_4778 207
16 3300050510 nmdc:mga06r32_300_c1 nmdc:mga06r32_300_c1_21230_21940 207
17 3300038705 Ga0237819_05845 Ga0237819_05845_769_1446 211
18 3300039145 Ga0237816_01992 Ga0237816_01992_718_1395 211
19 3300046809 Ga0495600_0183074 Ga0495600_0183074_526_1218 211
20 3300005329 Ga0070683_100236579 Ga0070683_1002365792 212
21 3300005539 Ga0068853_100001152 Ga0068853_10000115211 212
22 3300005577 Ga0068857_100482145 Ga0068857_1004821452 212
23 3300005616 Ga0068852_100067755 Ga0068852_1000677553 212
24 3300025914 Ga0207671_10169609 Ga0207671_101696092 212
25 3300025944 Ga0207661_10386285 Ga0207661_103862852 212
26 3300026041 Ga0207639_10003714 Ga0207639_100037147 212
27 3300046529 Ga0495652_0054161 Ga0495652_0054161_1610_2323 212
28 3300009093 Ga0105240_10093481 Ga0105240_100934813 213
29 3300049568 Ga0501031_0017336 Ga0501031_0017336_1991_2686 213
30 3300049569 Ga0501032_0042961 Ga0501032_0042961_417_1112 213
31 3300049570 Ga0501033_0282074 Ga0501033_0282074_53_748 213
32 3300049573 Ga0501037_0021961 Ga0501037_0021961_337_1032 213
33 3300049574 Ga0501038_0049353 Ga0501038_0049353_515_1210 213
34 3300049586 Ga0501070_0000444 Ga0501070_0000444_28389_29084 213
35 3300049742 Ga0501080_0002812 Ga0501080_0002812_9142_9837 213
36 3300049822 Ga0501035_0014352 Ga0501035_0014352_6025_6720 213
37 3300049823 Ga0501044_0013209 Ga0501044_0013209_6011_6706 213
38 3300049822 Ga0501035_0092507 Ga0501035_0092507_406_1161 214
39 3300025920 Ga0207649_10333483 Ga0207649_103334832 215
40 3300028800 Ga0265338_10054682 Ga0265338_100546823 215
41 3300031711 Ga0265314_10047579 Ga0265314_100475792 215
42 3300032004 Ga0307414_10000558 Ga0307414_100005583 215
43 3300053087 Ga0500643_003172 Ga0500643_003172_4026_4727 215
44 3300053087 Ga0500643_005631 Ga0500643_005631_2711_3412 215
45 3300003781 Ga0055536_1001991 Ga0055536_10019917 216
46 3300003794 Ga0055531_10012784 Ga0055531_100127843 216
47 3300005262 Ga0065165_1022549 Ga0065165_10225491 216
48 3300006177 Ga0075362_10171468 Ga0075362_101714682 216
49 3300014968 Ga0157379_10345803 Ga0157379_103458032 216
50 3300025292 Ga0209676_1000061 Ga0209676_1000061334 216
51 3300025298 Ga0209050_1023900 Ga0209050_10239003 216
52 3300025304 Ga0209257_1000915 Ga0209257_100091521 216
53 3300025911 Ga0207654_10055736 Ga0207654_100557363 216
54 3300026142 Ga0207698_10462669 Ga0207698_104626691 216
55 3300028800 Ga0265338_10079387 Ga0265338_100793871 216
56 3300031249 Ga0265339_10034327 Ga0265339_100343271 216
57 3300031730 Ga0307516_10058953 Ga0307516_100589532 216
58 3300046506 Ga0495583_0033383 Ga0495583_0033383_834_1505 216
59 3300046660 Ga0495625_0080869 Ga0495625_0080869_1045_1716 216
60 3300047472 Ga0495686_0186248 Ga0495686_0186248_314_985 216
61 3300048924 Ga0496121_0000825 Ga0496121_0000825_11203_11907 216
62 3300049581 Ga0501047_0019271 Ga0501047_0019271_2830_3501 216
63 3300049823 Ga0501044_0113096 Ga0501044_0113096_123_806 216
64 3300003791 Ga0055530_10000008 Ga0055530_1000000824 217
65 3300003794 Ga0055531_10011908 Ga0055531_100119083 217
66 3300005262 Ga0065165_1000222 Ga0065165_100022271 217
67 3300005327 Ga0070658_10066057 Ga0070658_100660572 217
68 3300005336 Ga0070680_100008303 Ga0070680_1000083034 217
69 3300005336 Ga0070680_100087972 Ga0070680_1000879722 217
70 3300005336 Ga0070680_100098703 Ga0070680_1000987032 217
71 3300005344 Ga0070661_100025364 Ga0070661_1000253642 217
72 3300005458 Ga0070681_10006656 Ga0070681_100066562 217
73 3300005458 Ga0070681_10013479 Ga0070681_100134796 217
74 3300005458 Ga0070681_10038433 Ga0070681_100384332 217
75 3300005530 Ga0070679_100021314 Ga0070679_1000213143 217
76 3300005530 Ga0070679_100283054 Ga0070679_1002830541 217
77 3300005530 Ga0070679_100801508 Ga0070679_1008015081 217
78 3300005539 Ga0068853_100020677 Ga0068853_1000206773 217
79 3300005548 Ga0070665_100002461 Ga0070665_10000246110 217
80 3300005548 Ga0070665_100019484 Ga0070665_1000194843 217
81 3300005563 Ga0068855_100003507 Ga0068855_10000350710 217
82 3300005563 Ga0068855_100038077 Ga0068855_1000380772 217
83 3300005563 Ga0068855_100103617 Ga0068855_1001036171 217
84 3300005616 Ga0068852_100403054 Ga0068852_1004030542 217
85 3300005719 Ga0068861_100058459 Ga0068861_1000584592 217
86 3300005844 Ga0068862_100192739 Ga0068862_1001927391 217
87 3300006358 Ga0068871_100024549 Ga0068871_1000245493 217
88 3300009093 Ga0105240_10016450 Ga0105240_100164502 217
89 3300009093 Ga0105240_10092963 Ga0105240_100929632 217
90 3300009093 Ga0105240_10163501 Ga0105240_101635012 217
91 3300009093 Ga0105240_10490313 Ga0105240_104903132 217
92 3300009101 Ga0105247_10247067 Ga0105247_102470671 217
93 3300009545 Ga0105237_10009748 Ga0105237_100097485 217
94 3300009545 Ga0105237_10112820 Ga0105237_101128203 217
95 3300009551 Ga0105238_10153208 Ga0105238_101532082 217
96 3300009551 Ga0105238_10348980 Ga0105238_103489802 217
97 3300009551 Ga0105238_10596234 Ga0105238_105962342 217
98 3300009551 Ga0105238_10665870 Ga0105238_106658701 217
99 3300009551 Ga0105238_10913172 Ga0105238_109131721 217
100 3300013105 Ga0157369_10011959 Ga0157369_1001195911 217
101 3300013105 Ga0157369_10234082 Ga0157369_102340821 217
102 3300014968 Ga0157379_10297260 Ga0157379_102972602 217
103 3300025297 Ga0209758_1000215 Ga0209758_100021553 217
104 3300025298 Ga0209050_1000049 Ga0209050_100004995 217
105 3300025304 Ga0209257_1000207 Ga0209257_100020733 217
106 3300025906 Ga0207699_10086389 Ga0207699_100863892 217
107 3300025909 Ga0207705_10030991 Ga0207705_100309914 217
108 3300025909 Ga0207705_10127202 Ga0207705_101272022 217
109 3300025912 Ga0207707_10011055 Ga0207707_100110552 217
110 3300025912 Ga0207707_10016495 Ga0207707_100164954 217
111 3300025912 Ga0207707_10068341 Ga0207707_100683412 217
112 3300025912 Ga0207707_10444513 Ga0207707_104445131 217
113 3300025913 Ga0207695_10013263 Ga0207695_1001326310 217
114 3300025913 Ga0207695_10259178 Ga0207695_102591782 217
115 3300025913 Ga0207695_10371020 Ga0207695_103710202 217
116 3300025914 Ga0207671_10046020 Ga0207671_100460202 217
117 3300025914 Ga0207671_10552538 Ga0207671_105525382 217
118 3300025916 Ga0207663_10281261 Ga0207663_102812612 217
119 3300025917 Ga0207660_10003006 Ga0207660_100030067 217
120 3300025917 Ga0207660_10018388 Ga0207660_100183882 217
121 3300025917 Ga0207660_10040963 Ga0207660_100409632 217
122 3300025919 Ga0207657_10004370 Ga0207657_100043709 217
123 3300025920 Ga0207649_10015547 Ga0207649_100155472 217
124 3300025921 Ga0207652_10272854 Ga0207652_102728542 217
125 3300025921 Ga0207652_10279025 Ga0207652_102790252 217
126 3300025921 Ga0207652_10643151 Ga0207652_106431511 217
127 3300025924 Ga0207694_10251719 Ga0207694_102517191 217
128 3300025924 Ga0207694_10618144 Ga0207694_106181441 217
129 3300025927 Ga0207687_10546393 Ga0207687_105463932 217
130 3300025932 Ga0207690_10318258 Ga0207690_103182582 217
131 3300025944 Ga0207661_10571473 Ga0207661_105714731 217
132 3300025949 Ga0207667_10004111 Ga0207667_1000411110 217
133 3300025949 Ga0207667_10024873 Ga0207667_100248736 217
134 3300025949 Ga0207667_10029379 Ga0207667_100293794 217
135 3300026035 Ga0207703_10166843 Ga0207703_101668432 217
136 3300026041 Ga0207639_10225464 Ga0207639_102254642 217
137 3300026116 Ga0207674_10151323 Ga0207674_101513234 217
138 3300026118 Ga0207675_100063751 Ga0207675_1000637512 217
139 3300028379 Ga0268266_10002142 Ga0268266_1000214220 217
140 3300028379 Ga0268266_10028690 Ga0268266_100286903 217
141 3300028573 Ga0265334_10044662 Ga0265334_100446622 217
142 3300028800 Ga0265338_10022060 Ga0265338_100220603 217
143 3300028800 Ga0265338_10030997 Ga0265338_100309973 217
144 3300028800 Ga0265338_10218927 Ga0265338_102189272 217
145 3300031250 Ga0265331_10002945 Ga0265331_1000294512 217
146 3300031456 Ga0307513_10061299 Ga0307513_100612992 217
147 3300031507 Ga0307509_10000004 Ga0307509_10000004389 217
148 3300032004 Ga0307414_10528352 Ga0307414_105283522 217
149 3300032005 Ga0307411_10047718 Ga0307411_100477182 217
150 3300035113 Ga0373936_0010351 Ga0373936_0010351_2669_3418 217
151 3300037466 Ga0395898_0237821 Ga0395898_0237821_82_759 217
152 3300037471 Ga0395905_0006821 Ga0395905_0006821_7651_8328 217
153 3300045049 Ga0466959_0003517 Ga0466959_0003517_592_1305 217
154 3300045049 Ga0466959_0008462 Ga0466959_0008462_1734_2459 217
155 3300046453 Ga0495627_001210 Ga0495627_001210_11846_12607 217
156 3300046471 Ga0495650_0001187 Ga0495650_0001187_11846_12607 217
157 3300046512 Ga0495610_0000451 Ga0495610_0000451_3577_4320 217
158 3300046515 Ga0495620_0006006 Ga0495620_0006006_3543_4286 217
159 3300047470 Ga0495681_0001722 Ga0495681_0001722_3560_4321 217
160 3300047472 Ga0495686_0000088 Ga0495686_0000088_60498_61172 217
161 3300047472 Ga0495686_0000522 Ga0495686_0000522_45979_46692 217
162 3300048928 Ga0496125_0128094 Ga0496125_0128094_913_1626 217
163 3300049570 Ga0501033_0060507 Ga0501033_0060507_49_747 217
164 3300053087 Ga0500643_000718 Ga0500643_000718_10127_10843 217
165 3300053090 Ga0500646_0096182 Ga0500646_0096182_121_816 217
166 3300053093 Ga0500651_0086785 Ga0500651_0086785_1046_1741 217
167 3300053119 Ga0500595_066231 Ga0500595_066231_41_721 217
168 3300053139 Ga0500568_0136514 Ga0500568_0136514_123_836 217
169 3300053153 Ga0500616_0000019 Ga0500616_0000019_1041_1799 217
170 3300053178 Ga0500637_0091561 Ga0500637_0091561_256_969 217
171 iso_pu_bacteria 2941485952 2941486374 217
172 3300005616 Ga0068852_100043527 Ga0068852_1000435271 218
173 3300009551 Ga0105238_10066379 Ga0105238_100663792 218
174 3300025924 Ga0207694_10000015 Ga0207694_10000015286 218
175 3300026142 Ga0207698_10005527 Ga0207698_100055271 218
176 3300049460 Ga0495682_0000882 Ga0495682_0000882_16578_17276 218
177 3300053133 Ga0500655_005559 Ga0500655_005559_1080_1778 218
178 3300005327 Ga0070658_10007077 Ga0070658_100070773 219
179 3300013104 Ga0157370_10006019 Ga0157370_100060198 219
180 3300025909 Ga0207705_10001231 Ga0207705_1000123117 219
181 3300025912 Ga0207707_10001184 Ga0207707_1000118418 219
182 3300031241 Ga0265325_10035361 Ga0265325_100353612 220
183 3300005336 Ga0070680_100334471 Ga0070680_1003344712 221
184 3300005339 Ga0070660_100003015 Ga0070660_1000030154 221
185 3300005341 Ga0070691_10006192 Ga0070691_100061921 221
186 3300005366 Ga0070659_100001785 Ga0070659_10000178510 221
187 3300005455 Ga0070663_100070188 Ga0070663_1000701881 221
188 3300005458 Ga0070681_10087840 Ga0070681_100878402 221
189 3300005539 Ga0068853_100009024 Ga0068853_1000090242 221
190 3300005563 Ga0068855_100000157 Ga0068855_10000015728 221
191 3300005563 Ga0068855_100017422 Ga0068855_1000174228 221
192 3300005578 Ga0068854_100125610 Ga0068854_1001256102 221
193 3300009093 Ga0105240_10002740 Ga0105240_100027408 221
194 3300009551 Ga0105238_10057415 Ga0105238_100574152 221
195 3300013100 Ga0157373_10050193 Ga0157373_100501932 221
196 3300013102 Ga0157371_10482334 Ga0157371_104823342 221
197 3300013307 Ga0157372_10010466 Ga0157372_100104667 221
198 3300025913 Ga0207695_10000004 Ga0207695_1000000476 221
199 3300025917 Ga0207660_10000826 Ga0207660_1000082613 221
200 3300025919 Ga0207657_10000141 Ga0207657_1000014140 221
201 3300025921 Ga0207652_10001119 Ga0207652_100011197 221
202 3300025924 Ga0207694_10040940 Ga0207694_100409402 221
203 3300025932 Ga0207690_10374428 Ga0207690_103744282 221
204 3300025949 Ga0207667_10000160 Ga0207667_1000016028 221
205 3300025949 Ga0207667_10012116 Ga0207667_100121168 221
206 3300025981 Ga0207640_10104362 Ga0207640_101043622 221
207 3300025981 Ga0207640_10625311 Ga0207640_106253112 221
208 3300026041 Ga0207639_10155879 Ga0207639_101558791 221
209 3300031240 Ga0265320_10000155 Ga0265320_1000015548 221
210 3300031241 Ga0265325_10049863 Ga0265325_100498632 221
211 3300031711 Ga0265314_10120670 Ga0265314_101206702 221
212 3300003320 rootH2_10000803 rootH2_100008036 222
213 3300013104 Ga0157370_10513933 Ga0157370_105139332 222
214 3300014969 Ga0157376_10731553 Ga0157376_107315532 222
215 3300028573 Ga0265334_10076292 Ga0265334_100762921 222
216 3300028577 Ga0265318_10000056 Ga0265318_100000567 222
217 3300028800 Ga0265338_10000014 Ga0265338_10000014115 222
218 3300028800 Ga0265338_10087588 Ga0265338_100875884 222
219 3300031238 Ga0265332_10006243 Ga0265332_100062431 222
220 3300031241 Ga0265325_10000013 Ga0265325_1000001344 222
221 3300031247 Ga0265340_10206552 Ga0265340_102065521 222
222 3300031249 Ga0265339_10001198 Ga0265339_1000119814 222
223 3300031250 Ga0265331_10005347 Ga0265331_100053472 222
224 3300031344 Ga0265316_10324009 Ga0265316_103240092 222
225 3300031595 Ga0265313_10001047 Ga0265313_100010473 222
226 3300031711 Ga0265314_10044905 Ga0265314_100449052 222
227 3300031712 Ga0265342_10015061 Ga0265342_100150613 222
228 3300046536 Ga0495587_0097005 Ga0495587_0097005_731_1444 222
229 3300046543 Ga0495645_0099846 Ga0495645_0099846_465_1178 222
230 3300048088 Ga0495602_0475482 Ga0495602_0475482_92_805 222
231 3300054114 Ga0501084_0008966 Ga0501084_0008966_7267_7977 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

31

77

0.99

PF17939

TetR_C_30

Tetracyclin repressor-like, C-terminal domain

111

224

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgl-assembly1.cif.gz_A co-crystal structure of nicr2_hsp 0.8333 21 221
5fgl-assembly3.cif.gz_F co-crystal structure of nicr2_hsp 0.8319 22 221
5fgl-assembly3.cif.gz_E co-crystal structure of nicr2_hsp 0.8271 21 221
5fgl-assembly2.cif.gz_C co-crystal structure of nicr2_hsp 0.826 21 221
5fhp-assembly3.cif.gz_E semet regulator of nicotine degradation 0.8252 22 221
ID Description Score Start End Superfamily
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.97 12 59 1.10.10.60
3mvpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.968 15 59 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9656 17 61 1.10.10.60
2jj7B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9651 16 60 1.10.10.60
5mwrB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9642 20 65 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A5D4GTI8-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9807 21 221 GO:0000976
GO:0003700
AF-A0A318B465-F1-model_v4 deleted 0.9777 21 222
AF-A0A520FM87-F1-model_v4 deleted 0.9775 21 219
AF-A0A5C6TP61-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9738 21 221 GO:0000976
GO:0003700
AF-A0A3B9AUJ4-F1-model_v4 deleted 0.9666 14 219

Feature Viewer

pLDDT pTM Quality
93.6 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map