F343993

General Info

Members Datasets Scaffolds Average Seq Length
231 137 462 234

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10349159|Ga0114129_103491592
Length 264
Sequence MPIHEKHLIRPENIRSHEKLVLDGVDVSGHWSTFIETRVVSDYNEALEEEISSLPGGEHIHRCWQCGSCTNSCTVNAINPDFNPRYWIYLIRMGMEQELLRDKEIIWQCVSCNKCTYVCPREVAPEGVMKATAHWLELKGHTKESPSTIFDNVFSEQVIDTGKIEEGRVVRWFFERTNQSLNQDWLIDMVKKLMAHLPITLLARLGLANVFRPRTRNWTKASEAIKEYVEEQDAQHRKALGLAGLVEMAKGEVAMMPAHQQDVA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
43 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
44 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
49 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
50 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
55 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
56 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
68 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
69 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 1.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.3
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10349159 3300009147 Bacteria 1960
2 Ga0070658_10019157 3300005327 Bacteria 5482
3 Ga0070683_100385877 3300005329 Bacteria 1335
4 Ga0070660_100152878 3300005339 Bacteria 1856
5 Ga0070659_100060329 3300005366 Bacteria 2996
6 Ga0070709_10123770 3300005434 Bacteria 1757
7 Ga0070709_10172440 3300005434 Bacteria 1513
8 Ga0070698_100025731 3300005471 Bacteria 6130
9 Ga0070684_100235691 3300005535 Bacteria 1671
10 Ga0070704_100185464 3300005549 Bacteria 1668
11 Ga0068855_100069362 3300005563 Bacteria 4102
12 Ga0068855_100272203 3300005563 Bacteria 1883
13 Ga0068856_100016992 3300005614 Bacteria 7052
14 Ga0068852_100004484 3300005616 Bacteria 9866
15 Ga0075428_100182490 3300006844 Bacteria 2271
16 Ga0075431_100079616 3300006847 Bacteria 3382
17 Ga0105240_10015934 3300009093 Bacteria 10195
18 Ga0105240_10106535 3300009093 Bacteria 3400
19 Ga0105240_10322852 3300009093 Bacteria 1759
20 Ga0105241_10301655 3300009174 Bacteria 1375
21 Ga0105238_10006274 3300009551 Bacteria 11814
22 Ga0105238_10054967 3300009551 Bacteria 3997
23 Ga0105239_11042267 3300010375 Bacteria 941
24 Ga0157373_10229709 3300013100 Bacteria 1310
25 Ga0157370_10005561 3300013104 Bacteria 14129
26 Ga0157370_10009868 3300013104 Bacteria 10119
27 Ga0157369_10016208 3300013105 Bacteria 8387
28 Ga0157369_10087989 3300013105 Bacteria 3316
29 Ga0157372_10000388 3300013307 Bacteria 48764
30 Ga0207699_10108518 3300025906 Bacteria 1775
31 Ga0207695_10064057 3300025913 Bacteria 3787
32 Ga0207695_10168140 3300025913 Bacteria 2120
33 Ga0207695_10214247 3300025913 Bacteria 1835
34 Ga0207649_10120377 3300025920 Bacteria 1769
35 Ga0207652_10646819 3300025921 Bacteria 946
36 Ga0207694_10012340 3300025924 Bacteria 6439
37 Ga0207694_10175335 3300025924 Bacteria 1737
38 Ga0207664_10300884 3300025929 Bacteria 1411
39 Ga0207690_10037084 3300025932 Bacteria 3163
40 Ga0207690_10235182 3300025932 Bacteria 1409
41 Ga0207661_10078659 3300025944 Bacteria 2716
42 Ga0207667_10018962 3300025949 Bacteria 7692
43 Ga0207667_10052901 3300025949 Bacteria 4274
44 Ga0207639_10141015 3300026041 Bacteria 2008
45 Ga0207698_10001847 3300026142 Bacteria 12367
46 Ga0209981_1003436 3300027378 Bacteria 2058
47 Ga0210000_1000755 3300027462 Bacteria 4482
48 Ga0209995_1000712 3300027471 Bacteria 5097
49 Ga0209995_1001937 3300027471 Bacteria 3240
50 Ga0209999_1001226 3300027543 Bacteria 4404
51 Ga0209971_1001194 3300027682 Bacteria 6528
52 Ga0209971_1001981 3300027682 Bacteria 4991
53 Ga0209971_1006862 3300027682 Bacteria 2698
54 Ga0209966_1018779 3300027695 Bacteria 1327
55 Ga0209998_10013382 3300027717 Bacteria 1708
56 Ga0209974_10000722 3300027876 Bacteria 11301
57 Ga0209974_10023706 3300027876 Bacteria 2031
58 Ga0316575_10015144 3300031665 Bacteria 2905
59 Ga0316575_10036277 3300031665 Bacteria 1939
60 Ga0316575_10040507 3300031665 Bacteria 1841
61 Ga0316575_10113359 3300031665 Bacteria 1107
62 Ga0316579_10013877 3300031691 Bacteria 3475
63 Ga0316579_10044394 3300031691 Bacteria 2070
64 Ga0316579_10196437 3300031691 Bacteria 975
65 Ga0316576_10001861 3300031727 Bacteria 11720
66 Ga0316576_10001941 3300031727 Bacteria 11539
67 Ga0316576_10005531 3300031727 Bacteria 7734
68 Ga0316576_10017149 3300031727 Bacteria 4911
69 Ga0316576_10024744 3300031727 Bacteria 4196
70 Ga0316576_10027253 3300031727 Bacteria 4016
71 Ga0316576_10050107 3300031727 Bacteria 3035
72 Ga0316576_10090880 3300031727 Bacteria 2274
73 Ga0316578_10000087 3300031728 Bacteria 21219
74 Ga0316578_10052015 3300031728 Bacteria 2399
75 Ga0316577_10013607 3300031733 Bacteria 4453
76 Ga0316577_10013749 3300031733 Bacteria 4435
77 Ga0307416_100037361 3300032002 Bacteria 3736
78 Ga0316585_10007841 3300032137 Bacteria 3087
79 Ga0316580_10000801 3300032139 Bacteria 7688
80 Ga0316580_10001151 3300032139 Bacteria 6704
81 Ga0316593_10038215 3300032168 Bacteria 1589
82 Ga0316592_1016278 3300033524 Bacteria 1554
83 Ga0316588_1006263 3300033528 Bacteria 2369
84 Ga0316596_1029635 3300033541 Bacteria 1417
85 Ga0373934_0019145 3300035086 Bacteria 2625
86 Ga0373956_0014872 3300035119 Bacteria 3253
87 Ga0373946_0061988 3300035171 Bacteria 1594
88 Ga0373955_0065205 3300035172 Bacteria 2021
89 Ga0373955_0137504 3300035172 Bacteria 1430
90 Ga0316574_0000322 3300035398 Bacteria 18327
91 Ga0316574_0007220 3300035398 Bacteria 6074
92 Ga0316574_0008685 3300035398 Bacteria 5652
93 Ga0316574_0009134 3300035398 Bacteria 5539
94 Ga0316574_0025963 3300035398 Bacteria 3521
95 Ga0316574_0036581 3300035398 Bacteria 3006
96 Ga0316574_0036927 3300035398 Bacteria 2993
97 Ga0316574_0038049 3300035398 Bacteria 2952
98 Ga0316574_0048785 3300035398 Bacteria 2631
99 Ga0316574_0066690 3300035398 Bacteria 2268
100 Ga0316574_0074082 3300035398 Bacteria 2154
101 Ga0316574_0082504 3300035398 Bacteria 2043
102 Ga0316574_0090090 3300035398 Bacteria 1955
103 Ga0316574_0131961 3300035398 Bacteria 1607
104 Ga0316574_0213914 3300035398 Bacteria 1236
105 Ga0373924_0102403 3300035410 Bacteria 1233
106 Ga0373927_0008980 3300035695 Bacteria 6710
107 Ga0373933_0002547 3300035724 Bacteria 10223
108 Ga0373933_0079472 3300035724 Bacteria 2008
109 Ga0373933_0177878 3300035724 Bacteria 1356
110 Ga0373947_0075497 3300035725 Bacteria 2076
111 Ga0373947_0091473 3300035725 Bacteria 1898
112 Ga0373937_0005686 3300036401 Bacteria 10704
113 Ga0373937_0011061 3300036401 Bacteria 7911
114 Ga0373937_0257249 3300036401 Bacteria 1646
115 Ga0316582_0007156 3300036647 Bacteria 5930
116 Ga0316582_0009351 3300036647 Bacteria 5317
117 Ga0316582_0050477 3300036647 Bacteria 2635
118 Ga0316582_0119573 3300036647 Bacteria 1762
119 Ga0316584_0027693 3300036712 Bacteria 4173
120 Ga0316584_0129191 3300036712 Bacteria 1887
121 Ga0316584_0151100 3300036712 Bacteria 1728
122 Ga0316584_0188733 3300036712 Bacteria 1524
123 Ga0373925_0550267 3300037068 Bacteria 949
124 Ga0439441_008452 3300042001 Bacteria 1682
125 Ga0439441_023087 3300042001 Bacteria 1160
126 Ga0439435_0022771 3300042436 Bacteria 1638
127 Ga0439460_0033810 3300042461 Bacteria 1470
128 Ga0451577_0546482 3300042876 Bacteria 1052
129 Ga0453684_0228133 3300044712 Bacteria 2152
130 Ga0451576_0001486 3300045051 Bacteria 39626
131 Ga0495592_0005245 3300046454 Bacteria 9554
132 Ga0495592_0127950 3300046454 Bacteria 1779
133 Ga0495629_0020461 3300046459 Bacteria 4725
134 Ga0495651_0000671 3300046462 Bacteria 26614
135 Ga0495651_0005455 3300046462 Bacteria 9704
136 Ga0495653_0028243 3300046463 Bacteria 4486
137 Ga0495653_0194912 3300046463 Bacteria 1379
138 Ga0495582_0053352 3300046473 Bacteria 2230
139 Ga0495662_0161859 3300046476 Bacteria 1103
140 Ga0495664_0089333 3300046477 Bacteria 1852
141 Ga0495664_0112757 3300046477 Bacteria 1642
142 Ga0495608_0114562 3300046511 Bacteria 1731
143 Ga0495618_0039206 3300046514 Bacteria 2978
144 Ga0495628_0035846 3300046516 Bacteria 3985
145 Ga0495628_0106240 3300046516 Bacteria 2162
146 Ga0495628_0145297 3300046516 Bacteria 1808
147 Ga0495652_0027078 3300046529 Bacteria 5054
148 Ga0495652_0268440 3300046529 Bacteria 1255
149 Ga0495640_0002670 3300046533 Bacteria 14332
150 Ga0495640_0116705 3300046533 Bacteria 1738
151 Ga0495587_0029520 3300046536 Bacteria 3329
152 Ga0495587_0055147 3300046536 Bacteria 2342
153 Ga0495587_0066822 3300046536 Bacteria 2096
154 Ga0495645_0146947 3300046543 Bacteria 1641
155 Ga0495667_0190106 3300046559 Bacteria 1316
156 Ga0495667_0202429 3300046559 Bacteria 1270
157 Ga0495634_0032280 3300046642 Bacteria 3602
158 Ga0495634_0049597 3300046642 Bacteria 2822
159 Ga0495635_0023007 3300046663 Bacteria 4344
160 Ga0495635_0134040 3300046663 Bacteria 1688
161 Ga0495657_0083828 3300046675 Bacteria 2057
162 Ga0495657_0200931 3300046675 Bacteria 1215
163 Ga0495599_0166899 3300046678 Bacteria 1359
164 Ga0495623_0004481 3300046679 Bacteria 9175
165 Ga0495623_0071091 3300046679 Bacteria 2166
166 Ga0495623_0131616 3300046679 Bacteria 1497
167 Ga0495646_0067113 3300046680 Bacteria 2121
168 Ga0495600_0003979 3300046809 Bacteria 8780
169 Ga0495581_0024377 3300047315 Bacteria 3506
170 Ga0495604_0000356 3300047317 Bacteria 40982
171 Ga0495604_0109040 3300047317 Bacteria 2021
172 Ga0495604_0176052 3300047317 Bacteria 1500
173 Ga0495674_0008010 3300047319 Bacteria 10088
174 Ga0495674_0136176 3300047319 Bacteria 2066
175 Ga0495676_0095233 3300047321 Bacteria 2216
176 Ga0495676_0260395 3300047321 Bacteria 1180
177 Ga0495680_0003054 3300047322 Bacteria 16684
178 Ga0495680_0124382 3300047322 Bacteria 1901
179 Ga0495675_0008233 3300047444 Bacteria 6451
180 Ga0495675_0171510 3300047444 Bacteria 1332
181 Ga0495684_0608292 3300047471 Bacteria 736
182 Ga0495593_0095733 3300047673 Bacteria 1526
183 Ga0495602_0064741 3300048088 Bacteria 3158
184 Ga0495602_0301749 3300048088 Bacteria 1172
185 Ga0496107_0245361 3300048910 Bacteria 1333
186 Ga0496112_0051618 3300048915 Bacteria 4034
187 Ga0496112_0217129 3300048915 Bacteria 1869
188 Ga0501033_0150989 3300049570 Bacteria 1676
189 Ga0501034_0283120 3300049571 Bacteria 1597
190 Ga0501034_0536281 3300049571 Bacteria 1081
191 Ga0501036_0065658 3300049572 Bacteria 3071
192 Ga0501038_0113778 3300049574 Bacteria 2239
193 Ga0501039_0571628 3300049575 Bacteria 887
194 Ga0501040_0076573 3300049576 Bacteria 2313
195 Ga0501041_0081537 3300049577 Bacteria 1992
196 Ga0501041_0253879 3300049577 Bacteria 1105
197 Ga0501041_0329990 3300049577 Bacteria 963
198 Ga0501043_0133581 3300049579 Bacteria 1945
199 Ga0501046_0232120 3300049580 Bacteria 1363
200 Ga0501047_0007052 3300049581 Bacteria 10551
201 Ga0501048_0159306 3300049582 Bacteria 1597
202 Ga0501070_0009428 3300049586 Bacteria 8251
203 Ga0501071_0104914 3300049587 Bacteria 2086
204 Ga0501072_0088363 3300049588 Bacteria 2459
205 Ga0501073_0001316 3300049589 Bacteria 18278
206 Ga0501074_0001201 3300049590 Bacteria 17030
207 Ga0501076_0500373 3300049592 Bacteria 1002
208 Ga0501079_0177387 3300049741 Bacteria 1662
209 Ga0501079_0219151 3300049741 Bacteria 1486
210 Ga0501080_0003461 3300049742 Bacteria 13921
211 Ga0501080_0169936 3300049742 Bacteria 2011
212 Ga0501081_0104967 3300049743 Bacteria 2001
213 Ga0501083_0001863 3300049744 Bacteria 14472
214 Ga0501035_0523301 3300049822 Bacteria 974
215 Ga0501044_0666768 3300049823 Bacteria 928
216 Ga0501045_0047372 3300049824 Bacteria 3131
217 Ga0501045_0173570 3300049824 Bacteria 1606
218 nmdc:mga05p37_503996_c1 3300050507 Bacteria 1388
219 nmdc:mga06r32_125352_c1 3300050510 Bacteria 2536
220 Ga0495601_0036738 3300053077 Bacteria 3060
221 Ga0495601_0091973 3300053077 Bacteria 1953
222 Ga0495601_0302200 3300053077 Bacteria 1042
223 Ga0495612_0037495 3300053078 Bacteria 1969
224 Ga0495612_0361587 3300053078 Bacteria 656
225 Ga0495595_0000238 3300053084 Bacteria 21739
226 Ga0495595_0004786 3300053084 Bacteria 5453
227 Ga0495595_0022635 3300053084 Bacteria 2760
228 Ga0495619_0003415 3300053085 Bacteria 10253
229 Ga0495619_0003667 3300053085 Bacteria 9899
230 Ga0501082_0099172 3300060353 Bacteria 2519
231 Ga0530510_0275276 3300061734 Bacteria 1257
232 Ga0114129_10349159
233 Ga0070658_10019157
234 Ga0070683_100385877
235 Ga0070660_100152878
236 Ga0070659_100060329
237 Ga0070709_10123770
238 Ga0070709_10172440
239 Ga0070698_100025731
240 Ga0070684_100235691
241 Ga0070704_100185464
242 Ga0068855_100069362
243 Ga0068855_100272203
244 Ga0068856_100016992
245 Ga0068852_100004484
246 Ga0075428_100182490
247 Ga0075431_100079616
248 Ga0105240_10015934
249 Ga0105240_10106535
250 Ga0105240_10322852
251 Ga0105241_10301655
252 Ga0105238_10006274
253 Ga0105238_10054967
254 Ga0105239_11042267
255 Ga0157373_10229709
256 Ga0157370_10005561
257 Ga0157370_10009868
258 Ga0157369_10016208
259 Ga0157369_10087989
260 Ga0157372_10000388
261 Ga0207699_10108518
262 Ga0207695_10064057
263 Ga0207695_10168140
264 Ga0207695_10214247
265 Ga0207649_10120377
266 Ga0207652_10646819
267 Ga0207694_10012340
268 Ga0207694_10175335
269 Ga0207664_10300884
270 Ga0207690_10037084
271 Ga0207690_10235182
272 Ga0207661_10078659
273 Ga0207667_10018962
274 Ga0207667_10052901
275 Ga0207639_10141015
276 Ga0207698_10001847
277 Ga0209981_1003436
278 Ga0210000_1000755
279 Ga0209995_1000712
280 Ga0209995_1001937
281 Ga0209999_1001226
282 Ga0209971_1001194
283 Ga0209971_1001981
284 Ga0209971_1006862
285 Ga0209966_1018779
286 Ga0209998_10013382
287 Ga0209974_10000722
288 Ga0209974_10023706
289 Ga0316575_10015144
290 Ga0316575_10036277
291 Ga0316575_10040507
292 Ga0316575_10113359
293 Ga0316579_10013877
294 Ga0316579_10044394
295 Ga0316579_10196437
296 Ga0316576_10001861
297 Ga0316576_10001941
298 Ga0316576_10005531
299 Ga0316576_10017149
300 Ga0316576_10024744
301 Ga0316576_10027253
302 Ga0316576_10050107
303 Ga0316576_10090880
304 Ga0316578_10000087
305 Ga0316578_10052015
306 Ga0316577_10013607
307 Ga0316577_10013749
308 Ga0307416_100037361
309 Ga0316585_10007841
310 Ga0316580_10000801
311 Ga0316580_10001151
312 Ga0316593_10038215
313 Ga0316592_1016278
314 Ga0316588_1006263
315 Ga0316596_1029635
316 Ga0373934_0019145
317 Ga0373956_0014872
318 Ga0373946_0061988
319 Ga0373955_0065205
320 Ga0373955_0137504
321 Ga0316574_0000322
322 Ga0316574_0007220
323 Ga0316574_0008685
324 Ga0316574_0009134
325 Ga0316574_0025963
326 Ga0316574_0036581
327 Ga0316574_0036927
328 Ga0316574_0038049
329 Ga0316574_0048785
330 Ga0316574_0066690
331 Ga0316574_0074082
332 Ga0316574_0082504
333 Ga0316574_0090090
334 Ga0316574_0131961
335 Ga0316574_0213914
336 Ga0373924_0102403
337 Ga0373927_0008980
338 Ga0373933_0002547
339 Ga0373933_0079472
340 Ga0373933_0177878
341 Ga0373947_0075497
342 Ga0373947_0091473
343 Ga0373937_0005686
344 Ga0373937_0011061
345 Ga0373937_0257249
346 Ga0316582_0007156
347 Ga0316582_0009351
348 Ga0316582_0050477
349 Ga0316582_0119573
350 Ga0316584_0027693
351 Ga0316584_0129191
352 Ga0316584_0151100
353 Ga0316584_0188733
354 Ga0373925_0550267
355 Ga0439441_008452
356 Ga0439441_023087
357 Ga0439435_0022771
358 Ga0439460_0033810
359 Ga0451577_0546482
360 Ga0453684_0228133
361 Ga0451576_0001486
362 Ga0495592_0005245
363 Ga0495592_0127950
364 Ga0495629_0020461
365 Ga0495651_0000671
366 Ga0495651_0005455
367 Ga0495653_0028243
368 Ga0495653_0194912
369 Ga0495582_0053352
370 Ga0495662_0161859
371 Ga0495664_0089333
372 Ga0495664_0112757
373 Ga0495608_0114562
374 Ga0495618_0039206
375 Ga0495628_0035846
376 Ga0495628_0106240
377 Ga0495628_0145297
378 Ga0495652_0027078
379 Ga0495652_0268440
380 Ga0495640_0002670
381 Ga0495640_0116705
382 Ga0495587_0029520
383 Ga0495587_0055147
384 Ga0495587_0066822
385 Ga0495645_0146947
386 Ga0495667_0190106
387 Ga0495667_0202429
388 Ga0495634_0032280
389 Ga0495634_0049597
390 Ga0495635_0023007
391 Ga0495635_0134040
392 Ga0495657_0083828
393 Ga0495657_0200931
394 Ga0495599_0166899
395 Ga0495623_0004481
396 Ga0495623_0071091
397 Ga0495623_0131616
398 Ga0495646_0067113
399 Ga0495600_0003979
400 Ga0495581_0024377
401 Ga0495604_0000356
402 Ga0495604_0109040
403 Ga0495604_0176052
404 Ga0495674_0008010
405 Ga0495674_0136176
406 Ga0495676_0095233
407 Ga0495676_0260395
408 Ga0495680_0003054
409 Ga0495680_0124382
410 Ga0495675_0008233
411 Ga0495675_0171510
412 Ga0495684_0608292
413 Ga0495593_0095733
414 Ga0495602_0064741
415 Ga0495602_0301749
416 Ga0496107_0245361
417 Ga0496112_0051618
418 Ga0496112_0217129
419 Ga0501033_0150989
420 Ga0501034_0283120
421 Ga0501034_0536281
422 Ga0501036_0065658
423 Ga0501038_0113778
424 Ga0501039_0571628
425 Ga0501040_0076573
426 Ga0501041_0081537
427 Ga0501041_0253879
428 Ga0501041_0329990
429 Ga0501043_0133581
430 Ga0501046_0232120
431 Ga0501047_0007052
432 Ga0501048_0159306
433 Ga0501070_0009428
434 Ga0501071_0104914
435 Ga0501072_0088363
436 Ga0501073_0001316
437 Ga0501074_0001201
438 Ga0501076_0500373
439 Ga0501079_0177387
440 Ga0501079_0219151
441 Ga0501080_0003461
442 Ga0501080_0169936
443 Ga0501081_0104967
444 Ga0501083_0001863
445 Ga0501035_0523301
446 Ga0501044_0666768
447 Ga0501045_0047372
448 Ga0501045_0173570
449 nmdc:mga05p37_503996_c1
450 nmdc:mga06r32_125352_c1
451 Ga0495601_0036738
452 Ga0495601_0091973
453 Ga0495601_0302200
454 Ga0495612_0037495
455 Ga0495612_0361587
456 Ga0495595_0000238
457 Ga0495595_0004786
458 Ga0495595_0022635
459 Ga0495619_0003415
460 Ga0495619_0003667
461 Ga0501082_0099172
462 Ga0530510_0275276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13187

Fer4_9

4Fe-4S dicluster domain

62

124

0.91

PF13534

Fer4_17

4Fe-4S dicluster domain

62

124

0.88

PF12838

Fer4_7

4Fe-4S dicluster domain

62

123

0.69

PF13183

Fer4_8

4Fe-4S dicluster domain

58

123

0.67

Map