F343943

General Info

Members Datasets Scaffolds Average Seq Length
231 165 231 118

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100686432|Ga0075429_1006864321
Length 128
Sequence MRYVDGFLLPVPKKNLQAYRRMAKKAGKIWREHGALEYRECAGDDLKVKGLVSFPRTIKLKRGETVVFAWIVFKSRTDRDRVNAKVMKDPRLADSMDPKSMPFDVKRMVYGGFNVLVDETSSNGAAVS

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
100 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
101 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 6.49
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10167018 3300005295 Unclassified 1514
2 Ga0065707_10199013 3300005295 Bacteria 1320
3 Ga0070676_11419725 3300005328 Bacteria 533
4 Ga0070690_100875910 3300005330 Bacteria 701
5 Ga0068868_100998125 3300005338 Bacteria 766
6 Ga0068868_101392552 3300005338 Unclassified 654
7 Ga0070689_101108401 3300005340 Bacteria 708
8 Ga0070675_100574284 3300005354 Unclassified 1021
9 Ga0070671_101043950 3300005355 Bacteria 717
10 Ga0070674_100122544 3300005356 Bacteria 1927
11 Ga0070688_100954693 3300005365 Bacteria 679
12 Ga0070659_100829430 3300005366 Bacteria 805
13 Ga0070713_100457085 3300005436 Bacteria 1200
14 Ga0070710_10613035 3300005437 Unclassified 759
15 Ga0070711_101446102 3300005439 Bacteria 599
16 Ga0070694_100317059 3300005444 Bacteria 1199
17 Ga0070678_100828493 3300005456 Unclassified 842
18 Ga0070678_101502467 3300005456 Bacteria 631
19 Ga0068867_100194392 3300005459 Bacteria 1621
20 Ga0070706_100191371 3300005467 Unclassified 1911
21 Ga0070706_100411860 3300005467 Bacteria 1258
22 Ga0070707_100063713 3300005468 Bacteria 3538
23 Ga0070707_101157584 3300005468 Bacteria 739
24 Ga0070707_101767655 3300005468 Bacteria 585
25 Ga0070698_100155854 3300005471 Bacteria 2229
26 Ga0070698_100259068 3300005471 Bacteria 1672
27 Ga0070698_100293383 3300005471 Unclassified 1557
28 Ga0070698_101317161 3300005471 Bacteria 672
29 Ga0070699_100001514 3300005518 Bacteria 21248
30 Ga0070697_100064799 3300005536 Bacteria 2985
31 Ga0070697_101465536 3300005536 Unclassified 610
32 Ga0070695_100657432 3300005545 Bacteria 828
33 Ga0070696_100104646 3300005546 Bacteria 2032
34 Ga0070696_100699274 3300005546 Bacteria 826
35 Ga0070693_100381819 3300005547 Bacteria 972
36 Ga0070665_100314573 3300005548 Bacteria 1570
37 Ga0070665_101912627 3300005548 Bacteria 599
38 Ga0070704_100006743 3300005549 Bacteria 6796
39 Ga0070664_102186794 3300005564 Unclassified 525
40 Ga0068859_100409606 3300005617 Bacteria 1452
41 Ga0068861_100431751 3300005719 Bacteria 1176
42 Ga0068860_101196759 3300005843 Bacteria 780
43 Ga0081539_10129140 3300005985 Bacteria 1244
44 Ga0070717_11779478 3300006028 Bacteria 557
45 Ga0075364_10522189 3300006051 Bacteria 812
46 Ga0075362_10119727 3300006177 Bacteria 1245
47 Ga0075367_10198285 3300006178 Bacteria 1254
48 Ga0075366_10025767 3300006195 Bacteria 3439
49 Ga0075370_10315332 3300006353 Bacteria 931
50 Ga0068871_100330719 3300006358 Bacteria 1344
51 Ga0068871_101175175 3300006358 Bacteria 719
52 Ga0075428_100001753 3300006844 Bacteria 23179
53 Ga0075428_100048476 3300006844 Bacteria 4663
54 Ga0075430_100171480 3300006846 Bacteria 1805
55 Ga0075430_101499878 3300006846 Bacteria 554
56 Ga0075431_100000838 3300006847 Bacteria 26928
57 Ga0075431_100176162 3300006847 Unclassified 2197
58 Ga0075431_100539805 3300006847 Bacteria 1154
59 Ga0075431_101078972 3300006847 Bacteria 768
60 Ga0075433_10019144 3300006852 Bacteria 5696
61 Ga0075434_100134943 3300006871 Bacteria 2487
62 Ga0075434_100465717 3300006871 Bacteria 1285
63 Ga0075429_100000586 3300006880 Bacteria 28024
64 Ga0075429_100005745 3300006880 Bacteria 10708
65 Ga0075429_100686432 3300006880 Unclassified 897
66 Ga0075429_100798985 3300006880 Bacteria 826
67 Ga0075429_101448120 3300006880 Bacteria 598
68 Ga0068865_100635555 3300006881 Bacteria 906
69 Ga0068865_100713647 3300006881 Bacteria 858
70 Ga0097620_100409624 3300006931 Bacteria 1452
71 Ga0075435_100053319 3300007076 Bacteria 3261
72 Ga0075435_101105442 3300007076 Bacteria 693
73 Ga0111539_10002752 3300009094 Bacteria 23327
74 Ga0111539_10564609 3300009094 Bacteria 1325
75 Ga0111539_10726337 3300009094 Bacteria 1156
76 Ga0105245_10106735 3300009098 Bacteria 2599
77 Ga0105245_10866278 3300009098 Bacteria 944
78 Ga0105245_11551402 3300009098 Bacteria 714
79 Ga0105247_10117077 3300009101 Bacteria 1722
80 Ga0114129_10010941 3300009147 Bacteria 12928
81 Ga0114129_10136392 3300009147 Bacteria 3367
82 Ga0114129_10783495 3300009147 Bacteria 1218
83 Ga0114129_11503596 3300009147 Bacteria 827
84 Ga0105243_10884065 3300009148 Bacteria 887
85 Ga0105248_10244223 3300009177 Bacteria 2021
86 Ga0105248_11318185 3300009177 Bacteria 817
87 Ga0105238_10326995 3300009551 Bacteria 1519
88 Ga0105249_10561712 3300009553 Bacteria 1193
89 Ga0157378_10211527 3300013297 Bacteria 1839
90 Ga0163162_10180217 3300013306 Bacteria 2239
91 Ga0163162_10904922 3300013306 Unclassified 995
92 Ga0163162_11032094 3300013306 Bacteria 930
93 Ga0157375_10739427 3300013308 Bacteria 1136
94 Ga0157375_12176701 3300013308 Unclassified 660
95 Ga0157380_10554481 3300014326 Bacteria 1128
96 Ga0182008_10036093 3300014497 Bacteria 2474
97 Ga0157379_10207340 3300014968 Bacteria 1773
98 Ga0182006_1130905 3300015261 Bacteria 863
99 Ga0182007_10078020 3300015262 Bacteria 1086
100 Ga0163161_11771261 3300017792 Bacteria 548
101 Ga0207685_10318744 3300025905 Bacteria 775
102 Ga0207684_11124105 3300025910 Bacteria 653
103 Ga0207652_10578851 3300025921 Bacteria 1008
104 Ga0207652_11104441 3300025921 Bacteria 693
105 Ga0207646_10021474 3300025922 Bacteria 5964
106 Ga0207646_10994457 3300025922 Bacteria 741
107 Ga0207646_11638629 3300025922 Bacteria 554
108 Ga0207681_10139419 3300025923 Bacteria 1804
109 Ga0207694_11643719 3300025924 Bacteria 541
110 Ga0207700_10112130 3300025928 Bacteria 2197
111 Ga0207686_10723123 3300025934 Bacteria 793
112 Ga0207670_10221871 3300025936 Bacteria 1447
113 Ga0207665_10169739 3300025939 Bacteria 1574
114 Ga0207711_10120304 3300025941 Bacteria 2344
115 Ga0207661_12081890 3300025944 Bacteria 514
116 Ga0207639_11531369 3300026041 Bacteria 626
117 Ga0207641_10210761 3300026088 Bacteria 1797
118 Ga0207648_10500459 3300026089 Bacteria 1112
119 Ga0207648_10603966 3300026089 Bacteria 1011
120 Ga0207648_11292425 3300026089 Bacteria 685
121 Ga0207674_10743902 3300026116 Bacteria 946
122 Ga0209974_10054012 3300027876 Bacteria 1354
123 Ga0207428_10002677 3300027907 Bacteria 17749
124 Ga0207428_10660959 3300027907 Bacteria 749
125 Ga0268264_10912816 3300028381 Bacteria 882
126 Ga0307513_10705938 3300031456 Bacteria 714
127 Ga0307410_10385736 3300031852 Bacteria 1128
128 Ga0307412_11179582 3300031911 Bacteria 685
129 Ga0307416_100076535 3300032002 Plasmid 2805
130 Ga0307411_10998154 3300032005 Bacteria 749
131 Ga0373939_0002806 3300035114 Bacteria 4090
132 Ga0373939_0076630 3300035114 Bacteria 1102
133 Ga0373953_0267152 3300035117 Bacteria 745
134 Ga0373957_0318546 3300035120 Bacteria 661
135 Ga0373943_0848507 3300035170 Bacteria 545
136 Ga0373961_0038904 3300035241 Bacteria 1365
137 Ga0373962_0407660 3300035242 Bacteria 501
138 Ga0373935_0139473 3300035692 Bacteria 1637
139 Ga0373947_0313612 3300035725 Bacteria 1048
140 Ga0373937_0427672 3300036401 Bacteria 1257
141 Ga0373925_0124176 3300037068 Bacteria 2007
142 Ga0373925_1065283 3300037068 Bacteria 665
143 Ga0439461_0113110 3300041410 Unclassified 672
144 Ga0439433_0023773 3300041999 Bacteria 1380
145 Ga0439458_0090093 3300042157 Bacteria 789
146 Ga0439434_0050104 3300042435 Bacteria 1293
147 Ga0495639_0333512 3300046475 Bacteria 760
148 Ga0495587_0195151 3300046536 Bacteria 1146
149 Ga0495674_0192228 3300047319 Bacteria 1696
150 Ga0495675_0631681 3300047444 Bacteria 605
151 Ga0496101_0638352 3300048904 Bacteria 841
152 Ga0496102_0181922 3300048905 Bacteria 1981
153 Ga0496103_0405025 3300048906 Bacteria 876
154 Ga0496104_1454627 3300048907 Bacteria 588
155 Ga0496105_0230735 3300048908 Bacteria 1504
156 Ga0496106_0019508 3300048909 Bacteria 5030
157 Ga0496107_0167521 3300048910 Bacteria 1629
158 Ga0496108_0188980 3300048911 Bacteria 1785
159 Ga0496109_0084035 3300048912 Bacteria 2936
160 Ga0496111_0407717 3300048914 Bacteria 1004
161 Ga0496112_0185727 3300048915 Bacteria 2042
162 Ga0496112_0399519 3300048915 Bacteria 1314
163 Ga0496113_0200059 3300048916 Bacteria 1588
164 Ga0496114_0059111 3300048917 Bacteria 3202
165 Ga0496115_0045281 3300048918 Bacteria 3511
166 Ga0501298_085921 3300049521 Bacteria 698
167 Ga0501033_0112629 3300049570 Bacteria 1979
168 Ga0501034_0496261 3300049571 Bacteria 1135
169 Ga0501036_0073428 3300049572 Bacteria 2892
170 Ga0501036_0118107 3300049572 Bacteria 2239
171 Ga0501038_0328588 3300049574 Bacteria 1195
172 Ga0501038_0379752 3300049574 Bacteria 1096
173 Ga0501039_0854926 3300049575 Bacteria 709
174 Ga0501040_0039344 3300049576 Bacteria 3216
175 Ga0501041_0074782 3300049577 Bacteria 2082
176 Ga0501042_0137815 3300049578 Bacteria 1759
177 Ga0501043_0177964 3300049579 Bacteria 1658
178 Ga0501047_0370162 3300049581 Bacteria 1268
179 Ga0501048_0588089 3300049582 Bacteria 799
180 Ga0501067_0404602 3300049583 Bacteria 761
181 Ga0501070_0167815 3300049586 Bacteria 1809
182 Ga0501070_0396029 3300049586 Bacteria 1117
183 Ga0501071_1175624 3300049587 Bacteria 593
184 Ga0501074_0050292 3300049590 Bacteria 3009
185 Ga0501075_0030713 3300049591 Bacteria 3981
186 Ga0501076_0674293 3300049592 Bacteria 853
187 Ga0501077_0115145 3300049593 Bacteria 1704
188 Ga0501079_0117934 3300049741 Bacteria 2063
189 Ga0501080_1101893 3300049742 Bacteria 685
190 Ga0501081_0559517 3300049743 Bacteria 855
191 Ga0501081_0562413 3300049743 Bacteria 852
192 Ga0501044_0000332 3300049823 Bacteria 59619
193 Ga0501045_0054363 3300049824 Bacteria 2927
194 nmdc:mga03683_69852_c1 3300050489 Bacteria 1499
195 nmdc:mga0k408_3528_c1 3300050493 Bacteria 8261
196 nmdc:mga06z11_192204_c1 3300050494 Bacteria 1182
197 nmdc:mga07m45_274678_c1 3300050496 Bacteria 980
198 nmdc:mga05p37_1204293_c1 3300050507 Bacteria 782
199 nmdc:mga05p37_23920_c1 3300050507 Bacteria 7417
200 nmdc:mga05p37_61686_c1 3300050507 Bacteria 4615
201 nmdc:mga05p37_637674_c1 3300050507 Bacteria 1196
202 nmdc:mga05p37_648330_c1 3300050507 Bacteria 1183
203 nmdc:mga09592_1046302_c1 3300050508 Unclassified 680
204 nmdc:mga09592_20590_c1 3300050508 Bacteria 5426
205 nmdc:mga09592_32700_c1 3300050508 Bacteria 4337
206 nmdc:mga09592_733198_c1 3300050508 Bacteria 839
207 nmdc:mga0qj67_163497_c1 3300050509 Bacteria 1807
208 nmdc:mga0qj67_287989_c2 3300050509 Bacteria 573
209 nmdc:mga0qj67_678975_c1 3300050509 Unclassified 820
210 nmdc:mga06r32_10470_c1 3300050510 Bacteria 8364
211 nmdc:mga06r32_1416822_c1 3300050510 Bacteria 636
212 nmdc:mga06r32_523715_c1 3300050510 Bacteria 1161
213 nmdc:mga06r32_536526_c1 3300050510 Unclassified 1145
214 nmdc:mga06r32_602057_c1 3300050510 Bacteria 1070
215 nmdc:mga08y16_1126548_c1 3300050511 Bacteria 759
216 nmdc:mga08y16_1139579_c1 3300050511 Unclassified 753
217 nmdc:mga08y16_19916_c1 3300050511 Bacteria 7078
218 nmdc:mga0n895_323737_c1 3300050512 Bacteria 1562
219 nmdc:mga0n895_546667_c1 3300050512 Unclassified 1164
220 nmdc:mga0n895_608118_c1 3300050512 Bacteria 1095
221 nmdc:mga0rr50_760061_c1 3300050513 Bacteria 827
222 nmdc:mga08x19_300308_c1 3300050514 Bacteria 1115
223 nmdc:mga0sz30_523191_c1 3300050516 Bacteria 534
224 Ga0495601_0033586 3300053077 Bacteria 3197
225 Ga0495612_0104040 3300053078 Bacteria 1211
226 Ga0495595_0130041 3300053084 Bacteria 1230
227 Ga0495619_0237032 3300053085 Bacteria 1264
228 Ga0500650_0261481 3300053098 Unclassified 774
229 Ga0501084_1488805 3300054114 Bacteria 566
230 Ga0501082_0120252 3300060353 Bacteria 2277
231 Ga0530510_0102575 3300061734 Bacteria 2092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_536526_c1 nmdc:mga06r32_536526_c1_43_393 98
2 3300006051 Ga0075364_10522189 Ga0075364_105221892 105
3 3300006177 Ga0075362_10119727 Ga0075362_101197272 105
4 3300006195 Ga0075366_10025767 Ga0075366_100257675 105
5 3300006353 Ga0075370_10315332 Ga0075370_103153321 105
6 3300050489 nmdc:mga03683_69852_c1 nmdc:mga03683_69852_c1_898_1254 105
7 3300050493 nmdc:mga0k408_3528_c1 nmdc:mga0k408_3528_c1_7770_8126 105
8 3300050496 nmdc:mga07m45_274678_c1 nmdc:mga07m45_274678_c1_549_905 105
9 3300005328 Ga0070676_11419725 Ga0070676_114197251 107
10 3300005340 Ga0070689_101108401 Ga0070689_1011084012 107
11 3300005365 Ga0070688_100954693 Ga0070688_1009546931 107
12 3300005719 Ga0068861_100431751 Ga0068861_1004317513 107
13 3300013308 Ga0157375_10739427 Ga0157375_107394272 107
14 3300042157 Ga0439458_0090093 Ga0439458_0090093_29_385 107
15 3300014326 Ga0157380_10554481 Ga0157380_105544812 108
16 3300049743 Ga0501081_0559517 Ga0501081_0559517_425_793 108
17 3300027876 Ga0209974_10054012 Ga0209974_100540122 109
18 3300026088 Ga0207641_10210761 Ga0207641_102107612 110
19 3300049587 Ga0501071_1175624 Ga0501071_1175624_135_497 110
20 3300050516 nmdc:mga0sz30_523191_c1 nmdc:mga0sz30_523191_c1_148_504 110
21 3300050512 nmdc:mga0n895_608118_c1 nmdc:mga0n895_608118_c1_52_405 117
22 3300005338 Ga0068868_101392552 Ga0068868_1013925521 118
23 3300005354 Ga0070675_100574284 Ga0070675_1005742842 118
24 3300005356 Ga0070674_100122544 Ga0070674_1001225444 118
25 3300005436 Ga0070713_100457085 Ga0070713_1004570851 118
26 3300005456 Ga0070678_100828493 Ga0070678_1008284931 118
27 3300005459 Ga0068867_100194392 Ga0068867_1001943923 118
28 3300005545 Ga0070695_100657432 Ga0070695_1006574322 118
29 3300005547 Ga0070693_100381819 Ga0070693_1003818192 118
30 3300005548 Ga0070665_100314573 Ga0070665_1003145733 118
31 3300005564 Ga0070664_102186794 Ga0070664_1021867941 118
32 3300005617 Ga0068859_100409606 Ga0068859_1004096061 118
33 3300006881 Ga0068865_100635555 Ga0068865_1006355552 118
34 3300006931 Ga0097620_100409624 Ga0097620_1004096241 118
35 3300009094 Ga0111539_10726337 Ga0111539_107263372 118
36 3300013297 Ga0157378_10211527 Ga0157378_102115272 118
37 3300013306 Ga0163162_10904922 Ga0163162_109049222 118
38 3300013308 Ga0157375_12176701 Ga0157375_121767012 118
39 3300014497 Ga0182008_10036093 Ga0182008_100360932 118
40 3300015261 Ga0182006_1130905 Ga0182006_11309052 118
41 3300015262 Ga0182007_10078020 Ga0182007_100780202 118
42 3300025921 Ga0207652_10578851 Ga0207652_105788512 118
43 3300026089 Ga0207648_10500459 Ga0207648_105004592 118
44 3300026089 Ga0207648_11292425 Ga0207648_112924251 118
45 3300031456 Ga0307513_10705938 Ga0307513_107059381 118
46 3300032005 Ga0307411_10998154 Ga0307411_109981541 118
47 3300049583 Ga0501067_0404602 Ga0501067_0404602_317_673 118
48 3300050511 nmdc:mga08y16_1139579_c1 nmdc:mga08y16_1139579_c1_14_370 118
49 3300005295 Ga0065707_10167018 Ga0065707_101670182 119
50 3300005295 Ga0065707_10199013 Ga0065707_101990132 119
51 3300005330 Ga0070690_100875910 Ga0070690_1008759102 119
52 3300005338 Ga0068868_100998125 Ga0068868_1009981252 119
53 3300005355 Ga0070671_101043950 Ga0070671_1010439502 119
54 3300005366 Ga0070659_100829430 Ga0070659_1008294302 119
55 3300005437 Ga0070710_10613035 Ga0070710_106130352 119
56 3300005439 Ga0070711_101446102 Ga0070711_1014461021 119
57 3300005444 Ga0070694_100317059 Ga0070694_1003170592 119
58 3300005456 Ga0070678_101502467 Ga0070678_1015024671 119
59 3300005467 Ga0070706_100191371 Ga0070706_1001913713 119
60 3300005467 Ga0070706_100411860 Ga0070706_1004118602 119
61 3300005468 Ga0070707_100063713 Ga0070707_1000637134 119
62 3300005468 Ga0070707_101157584 Ga0070707_1011575841 119
63 3300005468 Ga0070707_101767655 Ga0070707_1017676551 119
64 3300005471 Ga0070698_100155854 Ga0070698_1001558542 119
65 3300005471 Ga0070698_100259068 Ga0070698_1002590681 119
66 3300005471 Ga0070698_100293383 Ga0070698_1002933832 119
67 3300005471 Ga0070698_101317161 Ga0070698_1013171611 119
68 3300005518 Ga0070699_100001514 Ga0070699_10000151419 119
69 3300005536 Ga0070697_100064799 Ga0070697_1000647994 119
70 3300005536 Ga0070697_101465536 Ga0070697_1014655361 119
71 3300005546 Ga0070696_100104646 Ga0070696_1001046461 119
72 3300005546 Ga0070696_100699274 Ga0070696_1006992741 119
73 3300005548 Ga0070665_101912627 Ga0070665_1019126271 119
74 3300005549 Ga0070704_100006743 Ga0070704_10000674311 119
75 3300005843 Ga0068860_101196759 Ga0068860_1011967592 119
76 3300005985 Ga0081539_10129140 Ga0081539_101291403 119
77 3300006028 Ga0070717_11779478 Ga0070717_117794781 119
78 3300006178 Ga0075367_10198285 Ga0075367_101982852 119
79 3300006358 Ga0068871_100330719 Ga0068871_1003307192 119
80 3300006358 Ga0068871_101175175 Ga0068871_1011751752 119
81 3300006844 Ga0075428_100001753 Ga0075428_10000175319 119
82 3300006844 Ga0075428_100048476 Ga0075428_1000484764 119
83 3300006846 Ga0075430_100171480 Ga0075430_1001714802 119
84 3300006846 Ga0075430_101499878 Ga0075430_1014998781 119
85 3300006847 Ga0075431_100000838 Ga0075431_10000083811 119
86 3300006847 Ga0075431_100176162 Ga0075431_1001761622 119
87 3300006847 Ga0075431_100539805 Ga0075431_1005398052 119
88 3300006847 Ga0075431_101078972 Ga0075431_1010789721 119
89 3300006852 Ga0075433_10019144 Ga0075433_100191447 119
90 3300006871 Ga0075434_100134943 Ga0075434_1001349433 119
91 3300006871 Ga0075434_100465717 Ga0075434_1004657172 119
92 3300006880 Ga0075429_100000586 Ga0075429_10000058621 119
93 3300006880 Ga0075429_100005745 Ga0075429_1000057456 119
94 3300006880 Ga0075429_100686432 Ga0075429_1006864321 119
95 3300006880 Ga0075429_100798985 Ga0075429_1007989851 119
96 3300006880 Ga0075429_101448120 Ga0075429_1014481202 119
97 3300006881 Ga0068865_100713647 Ga0068865_1007136472 119
98 3300007076 Ga0075435_100053319 Ga0075435_1000533195 119
99 3300007076 Ga0075435_101105442 Ga0075435_1011054422 119
100 3300009094 Ga0111539_10002752 Ga0111539_1000275219 119
101 3300009094 Ga0111539_10564609 Ga0111539_105646092 119
102 3300009098 Ga0105245_10106735 Ga0105245_101067353 119
103 3300009098 Ga0105245_10866278 Ga0105245_108662781 119
104 3300009098 Ga0105245_11551402 Ga0105245_115514021 119
105 3300009101 Ga0105247_10117077 Ga0105247_101170774 119
106 3300009147 Ga0114129_10010941 Ga0114129_1001094110 119
107 3300009147 Ga0114129_10136392 Ga0114129_101363923 119
108 3300009147 Ga0114129_10783495 Ga0114129_107834952 119
109 3300009147 Ga0114129_11503596 Ga0114129_115035962 119
110 3300009148 Ga0105243_10884065 Ga0105243_108840652 119
111 3300009177 Ga0105248_10244223 Ga0105248_102442233 119
112 3300009177 Ga0105248_11318185 Ga0105248_113181852 119
113 3300009551 Ga0105238_10326995 Ga0105238_103269952 119
114 3300009553 Ga0105249_10561712 Ga0105249_105617122 119
115 3300013306 Ga0163162_10180217 Ga0163162_101802172 119
116 3300013306 Ga0163162_11032094 Ga0163162_110320942 119
117 3300014968 Ga0157379_10207340 Ga0157379_102073402 119
118 3300017792 Ga0163161_11771261 Ga0163161_117712612 119
119 3300025905 Ga0207685_10318744 Ga0207685_103187443 119
120 3300025910 Ga0207684_11124105 Ga0207684_111241052 119
121 3300025921 Ga0207652_11104441 Ga0207652_111044412 119
122 3300025922 Ga0207646_10021474 Ga0207646_100214746 119
123 3300025922 Ga0207646_10994457 Ga0207646_109944572 119
124 3300025922 Ga0207646_11638629 Ga0207646_116386292 119
125 3300025923 Ga0207681_10139419 Ga0207681_101394193 119
126 3300025924 Ga0207694_11643719 Ga0207694_116437191 119
127 3300025928 Ga0207700_10112130 Ga0207700_101121302 119
128 3300025934 Ga0207686_10723123 Ga0207686_107231231 119
129 3300025936 Ga0207670_10221871 Ga0207670_102218713 119
130 3300025939 Ga0207665_10169739 Ga0207665_101697393 119
131 3300025941 Ga0207711_10120304 Ga0207711_101203044 119
132 3300025944 Ga0207661_12081890 Ga0207661_120818901 119
133 3300026041 Ga0207639_11531369 Ga0207639_115313692 119
134 3300026089 Ga0207648_10603966 Ga0207648_106039662 119
135 3300026116 Ga0207674_10743902 Ga0207674_107439021 119
136 3300027907 Ga0207428_10002677 Ga0207428_100026775 119
137 3300027907 Ga0207428_10660959 Ga0207428_106609592 119
138 3300028381 Ga0268264_10912816 Ga0268264_109128162 119
139 3300031852 Ga0307410_10385736 Ga0307410_103857362 119
140 3300031911 Ga0307412_11179582 Ga0307412_111795821 119
141 3300032002 Ga0307416_100076535 Ga0307416_1000765355 119
142 3300035114 Ga0373939_0002806 Ga0373939_0002806_3351_3710 119
143 3300035114 Ga0373939_0076630 Ga0373939_0076630_520_888 119
144 3300035117 Ga0373953_0267152 Ga0373953_0267152_262_621 119
145 3300035120 Ga0373957_0318546 Ga0373957_0318546_170_529 119
146 3300035170 Ga0373943_0848507 Ga0373943_0848507_81_440 119
147 3300035241 Ga0373961_0038904 Ga0373961_0038904_68_427 119
148 3300035242 Ga0373962_0407660 Ga0373962_0407660_74_433 119
149 3300035692 Ga0373935_0139473 Ga0373935_0139473_1143_1505 119
150 3300035725 Ga0373947_0313612 Ga0373947_0313612_457_816 119
151 3300036401 Ga0373937_0427672 Ga0373937_0427672_866_1225 119
152 3300037068 Ga0373925_0124176 Ga0373925_0124176_922_1281 119
153 3300037068 Ga0373925_1065283 Ga0373925_1065283_163_522 119
154 3300041410 Ga0439461_0113110 Ga0439461_0113110_171_530 119
155 3300041999 Ga0439433_0023773 Ga0439433_0023773_141_500 119
156 3300042435 Ga0439434_0050104 Ga0439434_0050104_877_1236 119
157 3300046475 Ga0495639_0333512 Ga0495639_0333512_285_644 119
158 3300046536 Ga0495587_0195151 Ga0495587_0195151_715_1074 119
159 3300047319 Ga0495674_0192228 Ga0495674_0192228_181_540 119
160 3300047444 Ga0495675_0631681 Ga0495675_0631681_110_469 119
161 3300048904 Ga0496101_0638352 Ga0496101_0638352_317_676 119
162 3300048905 Ga0496102_0181922 Ga0496102_0181922_111_470 119
163 3300048906 Ga0496103_0405025 Ga0496103_0405025_184_543 119
164 3300048907 Ga0496104_1454627 Ga0496104_1454627_92_451 119
165 3300048908 Ga0496105_0230735 Ga0496105_0230735_154_513 119
166 3300048909 Ga0496106_0019508 Ga0496106_0019508_1486_1845 119
167 3300048910 Ga0496107_0167521 Ga0496107_0167521_711_1070 119
168 3300048911 Ga0496108_0188980 Ga0496108_0188980_959_1318 119
169 3300048912 Ga0496109_0084035 Ga0496109_0084035_731_1090 119
170 3300048914 Ga0496111_0407717 Ga0496111_0407717_604_963 119
171 3300048915 Ga0496112_0185727 Ga0496112_0185727_212_571 119
172 3300048915 Ga0496112_0399519 Ga0496112_0399519_115_474 119
173 3300048916 Ga0496113_0200059 Ga0496113_0200059_25_384 119
174 3300048917 Ga0496114_0059111 Ga0496114_0059111_22_381 119
175 3300048918 Ga0496115_0045281 Ga0496115_0045281_1289_1648 119
176 3300049521 Ga0501298_085921 Ga0501298_085921_37_423 119
177 3300049570 Ga0501033_0112629 Ga0501033_0112629_853_1215 119
178 3300049571 Ga0501034_0496261 Ga0501034_0496261_91_453 119
179 3300049572 Ga0501036_0073428 Ga0501036_0073428_608_967 119
180 3300049572 Ga0501036_0118107 Ga0501036_0118107_1280_1642 119
181 3300049574 Ga0501038_0328588 Ga0501038_0328588_34_396 119
182 3300049574 Ga0501038_0379752 Ga0501038_0379752_166_525 119
183 3300049575 Ga0501039_0854926 Ga0501039_0854926_92_451 119
184 3300049576 Ga0501040_0039344 Ga0501040_0039344_1724_2083 119
185 3300049577 Ga0501041_0074782 Ga0501041_0074782_791_1150 119
186 3300049578 Ga0501042_0137815 Ga0501042_0137815_480_839 119
187 3300049579 Ga0501043_0177964 Ga0501043_0177964_1042_1401 119
188 3300049581 Ga0501047_0370162 Ga0501047_0370162_831_1193 119
189 3300049582 Ga0501048_0588089 Ga0501048_0588089_97_456 119
190 3300049586 Ga0501070_0167815 Ga0501070_0167815_430_789 119
191 3300049586 Ga0501070_0396029 Ga0501070_0396029_637_999 119
192 3300049590 Ga0501074_0050292 Ga0501074_0050292_2389_2748 119
193 3300049591 Ga0501075_0030713 Ga0501075_0030713_106_465 119
194 3300049592 Ga0501076_0674293 Ga0501076_0674293_46_405 119
195 3300049593 Ga0501077_0115145 Ga0501077_0115145_37_396 119
196 3300049741 Ga0501079_0117934 Ga0501079_0117934_819_1178 119
197 3300049742 Ga0501080_1101893 Ga0501080_1101893_296_655 119
198 3300049743 Ga0501081_0562413 Ga0501081_0562413_202_561 119
199 3300049823 Ga0501044_0000332 Ga0501044_0000332_39832_40194 119
200 3300049824 Ga0501045_0054363 Ga0501045_0054363_1359_1718 119
201 3300050494 nmdc:mga06z11_192204_c1 nmdc:mga06z11_192204_c1_206_565 119
202 3300050507 nmdc:mga05p37_1204293_c1 nmdc:mga05p37_1204293_c1_180_539 119
203 3300050507 nmdc:mga05p37_23920_c1 nmdc:mga05p37_23920_c1_5433_5792 119
204 3300050507 nmdc:mga05p37_61686_c1 nmdc:mga05p37_61686_c1_2179_2538 119
205 3300050507 nmdc:mga05p37_637674_c1 nmdc:mga05p37_637674_c1_318_680 119
206 3300050507 nmdc:mga05p37_648330_c1 nmdc:mga05p37_648330_c1_303_662 119
207 3300050508 nmdc:mga09592_1046302_c1 nmdc:mga09592_1046302_c1_207_593 119
208 3300050508 nmdc:mga09592_20590_c1 nmdc:mga09592_20590_c1_4595_4957 119
209 3300050508 nmdc:mga09592_32700_c1 nmdc:mga09592_32700_c1_1805_2167 119
210 3300050508 nmdc:mga09592_733198_c1 nmdc:mga09592_733198_c1_28_387 119
211 3300050509 nmdc:mga0qj67_163497_c1 nmdc:mga0qj67_163497_c1_532_894 119
212 3300050509 nmdc:mga0qj67_287989_c2 nmdc:mga0qj67_287989_c2_74_436 119
213 3300050509 nmdc:mga0qj67_678975_c1 nmdc:mga0qj67_678975_c1_159_521 119
214 3300050510 nmdc:mga06r32_10470_c1 nmdc:mga06r32_10470_c1_7824_8186 119
215 3300050510 nmdc:mga06r32_1416822_c1 nmdc:mga06r32_1416822_c1_263_622 119
216 3300050510 nmdc:mga06r32_523715_c1 nmdc:mga06r32_523715_c1_545_904 119
217 3300050510 nmdc:mga06r32_602057_c1 nmdc:mga06r32_602057_c1_39_398 119
218 3300050511 nmdc:mga08y16_1126548_c1 nmdc:mga08y16_1126548_c1_152_511 119
219 3300050511 nmdc:mga08y16_19916_c1 nmdc:mga08y16_19916_c1_4911_5273 119
220 3300050512 nmdc:mga0n895_323737_c1 nmdc:mga0n895_323737_c1_69_428 119
221 3300050512 nmdc:mga0n895_546667_c1 nmdc:mga0n895_546667_c1_225_584 119
222 3300050513 nmdc:mga0rr50_760061_c1 nmdc:mga0rr50_760061_c1_333_692 119
223 3300050514 nmdc:mga08x19_300308_c1 nmdc:mga08x19_300308_c1_634_993 119
224 3300053077 Ga0495601_0033586 Ga0495601_0033586_1433_1792 119
225 3300053078 Ga0495612_0104040 Ga0495612_0104040_17_376 119
226 3300053084 Ga0495595_0130041 Ga0495595_0130041_98_457 119
227 3300053085 Ga0495619_0237032 Ga0495619_0237032_679_1038 119
228 3300053098 Ga0500650_0261481 Ga0500650_0261481_267_626 119
229 3300054114 Ga0501084_1488805 Ga0501084_1488805_161_520 119
230 3300060353 Ga0501082_0120252 Ga0501082_0120252_92_451 119
231 3300061734 Ga0530510_0102575 Ga0530510_0102575_306_665 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

2

105

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8915 1 119
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8826 1 119
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8705 1 119
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8132 1 119
1xbw-assembly1.cif.gz_A 1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg 0.7524 1 119
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8828 1 119 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8759 1 119 3.30.70.100
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7524 1 119 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7331 2 116 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7282 2 112 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7V3H9G9-F1-model_v4 DUF1428 domain-containing protein 0.9746 1 118
AF-A0A3N5W334-F1-model_v4 DUF1428 domain-containing protein 0.964 3 119
AF-A0A2A2QDK1-F1-model_v4 RNA signal recognition particle 0.9615 2 119
AF-A0A7V3H9G9-F1-model_v4 DUF1428 domain-containing protein 0.9586 1 118
AF-A0A7W0LC78-F1-model_v4 DUF1428 domain-containing protein 0.954 3 119

Feature Viewer

pLDDT pTM Quality
90.97 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map