F343856

General Info

Members Datasets Scaffolds Average Seq Length
231 161 228 170

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100018137|Ga0068855_1000181377
Length 201
Sequence VAAFAGRAACAVNEAVPSALRRYAAFLRGVSPQNLSMPVLKACLERCGFSDVRTLLSSGNATFTTRAPTQEAALERKIEAALKEDAGRPFMTFVRSVDALNELLDSDPYARFPPVPAAKRVVTFLRHAPAVAPKNALPLERDGARILCVRGAEAFGDYIPGPRGPVFMTLLERTFGKAITTRTWETVRKSAADPPAKPPRR

Samples

Sample ID Description Type Environment
1 2738543012 Acidovorax sp. CF301 Isolate Unclassified
2 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
3 2816332133 Acidovorax radicis 2721A Isolate Unclassified
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
155 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 0
Rhizoplane 1.3
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1021947 3300001977 Unclassified 891
2 JGI25152J39213_1000260 3300002773 Bacteria 35206
3 JGI25150J39212_1010982 3300002774 Bacteria 1660
4 JGI25153J46596_10014867 3300003215 Bacteria 3209
5 rootL2_10116321 3300003322 Bacteria 1090
6 rootH1_10379503 3300003323 Bacteria 1116
7 Ga0055524_1000891 3300003775 Bacteria 19357
8 Ga0065715_10605446 3300005293 Unclassified 681
9 Ga0070658_10104291 3300005327 Bacteria 2346
10 Ga0070676_10000418 3300005328 Bacteria 20037
11 Ga0070676_10010164 3300005328 Bacteria 5101
12 Ga0070670_100180709 3300005331 Bacteria 1832
13 Ga0068869_100051105 3300005334 Bacteria 2998
14 Ga0068868_100025336 3300005338 Bacteria 4511
15 Ga0068868_100328003 3300005338 Bacteria 1306
16 Ga0068868_100639909 3300005338 Bacteria 946
17 Ga0070660_100030682 3300005339 Bacteria 4033
18 Ga0070660_100236843 3300005339 Unclassified 1486
19 Ga0070660_100321460 3300005339 Bacteria 1271
20 Ga0070689_100077474 3300005340 Bacteria 2605
21 Ga0070691_10146863 3300005341 Unclassified 1206
22 Ga0070661_100016225 3300005344 Bacteria 5262
23 Ga0070661_100109548 3300005344 Bacteria 2061
24 Ga0070669_100002144 3300005353 Bacteria 14271
25 Ga0070669_100045643 3300005353 Bacteria 3193
26 Ga0070675_100000360 3300005354 Bacteria 30832
27 Ga0070674_100022925 3300005356 Bacteria 4032
28 Ga0070673_100039238 3300005364 Bacteria 3622
29 Ga0070659_100015594 3300005366 Bacteria 5692
30 Ga0070659_100390797 3300005366 Bacteria 1173
31 Ga0070659_100551111 3300005366 Bacteria 987
32 Ga0070659_100846939 3300005366 Bacteria 797
33 Ga0070714_100272508 3300005435 Bacteria 1570
34 Ga0070710_10356163 3300005437 Unclassified 970
35 Ga0070708_100115096 3300005445 Bacteria 2475
36 Ga0070708_100697288 3300005445 Unclassified 956
37 Ga0070662_100008609 3300005457 Bacteria 6657
38 Ga0070662_100322856 3300005457 Bacteria 1259
39 Ga0070681_10002863 3300005458 Bacteria 15941
40 Ga0070681_10178552 3300005458 Bacteria 2045
41 Ga0068867_100022578 3300005459 Bacteria 4498
42 Ga0070679_100313958 3300005530 Bacteria 1517
43 Ga0070697_100667745 3300005536 Unclassified 916
44 Ga0068853_100166336 3300005539 Bacteria 1993
45 Ga0070672_100145245 3300005543 Bacteria 1960
46 Ga0070672_100233509 3300005543 Bacteria 1546
47 Ga0070686_100256239 3300005544 Unclassified 1280
48 Ga0070686_100941785 3300005544 Unclassified 705
49 Ga0070665_100198913 3300005548 Bacteria 2005
50 Ga0068855_100018137 3300005563 Bacteria 8457
51 Ga0068855_100095432 3300005563 Bacteria 3427
52 Ga0068855_100368658 3300005563 Bacteria 1579
53 Ga0068857_101118060 3300005577 Bacteria 761
54 Ga0068854_100028369 3300005578 Bacteria 3867
55 Ga0068856_100080579 3300005614 Bacteria 3229
56 Ga0068856_100196463 3300005614 Bacteria 2031
57 Ga0068856_100412067 3300005614 Unclassified 1371
58 Ga0068852_100006828 3300005616 Bacteria 8291
59 Ga0068852_100014364 3300005616 Bacteria 6094
60 Ga0068852_100053368 3300005616 Bacteria 3479
61 Ga0068859_100003147 3300005617 Bacteria 16781
62 Ga0068859_100339167 3300005617 Unclassified 1597
63 Ga0068864_100037232 3300005618 Bacteria 4151
64 Ga0068866_10156736 3300005718 Bacteria 1324
65 Ga0068861_100049581 3300005719 Unclassified 3180
66 Ga0068851_10015598 3300005834 Bacteria 3621
67 Ga0068863_100013201 3300005841 Bacteria 7968
68 Ga0068863_100287026 3300005841 Bacteria 1595
69 Ga0068858_100129898 3300005842 Bacteria 2361
70 Ga0068860_100001039 3300005843 Bacteria 30519
71 Ga0068860_100122986 3300005843 Bacteria 2486
72 Ga0068860_100694098 3300005843 Bacteria 1027
73 Ga0068862_100002345 3300005844 Bacteria 16861
74 Ga0070716_100029819 3300006173 Bacteria 2954
75 Ga0075366_10031023 3300006195 Bacteria 3144
76 Ga0075366_10075360 3300006195 Bacteria 2012
77 Ga0097621_100009874 3300006237 Bacteria 6951
78 Ga0068871_100040127 3300006358 Bacteria 3748
79 Ga0068871_100431082 3300006358 Bacteria 1179
80 Ga0075430_100181673 3300006846 Bacteria 1750
81 Ga0075431_100028105 3300006847 Bacteria 5774
82 Ga0075434_100070772 3300006871 Unclassified 3479
83 Ga0068865_100065079 3300006881 Bacteria 2567
84 Ga0097620_100003147 3300006931 Bacteria 16781
85 Ga0097620_100339153 3300006931 Unclassified 1597
86 Ga0075435_100764292 3300007076 Unclassified 841
87 Ga0105240_10002112 3300009093 Bacteria 32514
88 Ga0105240_10584670 3300009093 Bacteria 1231
89 Ga0111539_10391874 3300009094 Bacteria 1618
90 Ga0105245_10076865 3300009098 Bacteria 3042
91 Ga0105245_10096960 3300009098 Bacteria 2722
92 Ga0114129_11223278 3300009147 Bacteria 934
93 Ga0114129_12190858 3300009147 Unclassified 665
94 Ga0105243_11754719 3300009148 Unclassified 651
95 Ga0105241_10076203 3300009174 Bacteria 2615
96 Ga0105248_10019906 3300009177 Bacteria 7430
97 Ga0105248_10072701 3300009177 Bacteria 3865
98 Ga0105248_10322683 3300009177 Unclassified 1739
99 Ga0105237_10530653 3300009545 Bacteria 1184
100 Ga0105238_10007872 3300009551 Bacteria 10662
101 Ga0105238_10008963 3300009551 Bacteria 10012
102 Ga0105249_10000609 3300009553 Bacteria 32611
103 Ga0105239_10010146 3300010375 Bacteria 10555
104 Ga0105239_10068971 3300010375 Bacteria 3886
105 Ga0105239_10348719 3300010375 Bacteria 1671
106 Ga0105246_10790319 3300011119 Bacteria 841
107 Ga0157371_10004910 3300013102 Bacteria 11488
108 Ga0157371_10089438 3300013102 Bacteria 2181
109 Ga0157371_10154445 3300013102 Bacteria 1638
110 Ga0157370_10082345 3300013104 Bacteria 3027
111 Ga0157370_10125239 3300013104 Bacteria 2398
112 Ga0157369_10027429 3300013105 Bacteria 6313
113 Ga0157369_10885402 3300013105 Bacteria 916
114 Ga0157374_10075387 3300013296 Bacteria 3188
115 Ga0157374_10102586 3300013296 Bacteria 2744
116 Ga0157374_10126030 3300013296 Bacteria 2476
117 Ga0157378_10013996 3300013297 Bacteria 7021
118 Ga0163162_10023165 3300013306 Bacteria 6126
119 Ga0163162_10035168 3300013306 Bacteria 4989
120 Ga0163162_10281196 3300013306 Bacteria 1796
121 Ga0157372_10106217 3300013307 Bacteria 3212
122 Ga0157372_10389617 3300013307 Bacteria 1624
123 Ga0157372_11297766 3300013307 Unclassified 840
124 Ga0157375_10329904 3300013308 Bacteria 1691
125 Ga0163163_10010035 3300014325 Bacteria 8495
126 Ga0163163_11058690 3300014325 Bacteria 874
127 Ga0157379_10001050 3300014968 Bacteria 22453
128 Ga0157379_10029336 3300014968 Bacteria 4892
129 Ga0157379_10334001 3300014968 Bacteria 1385
130 Ga0207425_1000001 3300025245 Bacteria 2525432
131 Ga0209129_1000001 3300025258 Bacteria 1452436
132 Ga0207673_1002141 3300025290 Bacteria 2223
133 Ga0209758_1000020 3300025297 Bacteria 734220
134 Ga0209256_1000028 3300025299 Bacteria 420213
135 Ga0207697_10000006 3300025315 Bacteria 82632
136 Ga0207656_10000295 3300025321 Bacteria 17228
137 Ga0207642_10127064 3300025899 Bacteria 1324
138 Ga0207688_10771485 3300025901 Bacteria 609
139 Ga0207645_10000071 3300025907 Bacteria 72725
140 Ga0207645_10144441 3300025907 Bacteria 1551
141 Ga0207705_10212912 3300025909 Unclassified 1466
142 Ga0207707_10018620 3300025912 Bacteria 6054
143 Ga0207695_10001465 3300025913 Bacteria 39532
144 Ga0207695_10741432 3300025913 Bacteria 863
145 Ga0207657_10054843 3300025919 Bacteria 3445
146 Ga0207657_10093294 3300025919 Bacteria 2508
147 Ga0207649_10084688 3300025920 Bacteria 2061
148 Ga0207649_10096064 3300025920 Bacteria 1951
149 Ga0207652_10265973 3300025921 Bacteria 1547
150 Ga0207681_10001148 3300025923 Bacteria 17100
151 Ga0207694_10136619 3300025924 Bacteria 1969
152 Ga0207650_10196743 3300025925 Bacteria 1613
153 Ga0207659_10006115 3300025926 Bacteria 7355
154 Ga0207659_10325308 3300025926 Bacteria 1269
155 Ga0207687_10093907 3300025927 Bacteria 2194
156 Ga0207687_10476311 3300025927 Unclassified 1039
157 Ga0207664_10217176 3300025929 Bacteria 1657
158 Ga0207690_10357740 3300025932 Bacteria 1156
159 Ga0207690_10374614 3300025932 Bacteria 1130
160 Ga0207690_10632018 3300025932 Unclassified 876
161 Ga0207706_10000835 3300025933 Bacteria 31957
162 Ga0207670_10044042 3300025936 Bacteria 2951
163 Ga0207669_10169169 3300025937 Bacteria 1553
164 Ga0207704_10023519 3300025938 Bacteria 3323
165 Ga0207665_10119941 3300025939 Archaea 1857
166 Ga0207691_10313270 3300025940 Bacteria 1346
167 Ga0207711_10190253 3300025941 Bacteria 1870
168 Ga0207689_10173602 3300025942 Unclassified 1777
169 Ga0207667_10017593 3300025949 Bacteria 8038
170 Ga0207667_10328707 3300025949 Bacteria 1561
171 Ga0207651_10046630 3300025960 Bacteria 2916
172 Ga0207668_10124968 3300025972 Bacteria 1954
173 Ga0207668_10341088 3300025972 Bacteria 1250
174 Ga0207640_10113837 3300025981 Bacteria 1923
175 Ga0207677_10419623 3300026023 Unclassified 1139
176 Ga0207703_10147768 3300026035 Bacteria 2046
177 Ga0207639_10086188 3300026041 Bacteria 2500
178 Ga0207639_10923457 3300026041 Bacteria 816
179 Ga0207702_10019906 3300026078 Bacteria 5559
180 Ga0207702_10371082 3300026078 Unclassified 1374
181 Ga0207641_10025591 3300026088 Bacteria 4866
182 Ga0207648_10040129 3300026089 Bacteria 4113
183 Ga0207676_10061775 3300026095 Bacteria 2968
184 Ga0207675_100073107 3300026118 Unclassified 3208
185 Ga0207698_10002977 3300026142 Bacteria 10151
186 Ga0207698_10492757 3300026142 Bacteria 1191
187 Ga0207698_11226433 3300026142 Bacteria 764
188 Ga0209982_1024825 3300027552 Unclassified 930
189 Ga0268265_10003396 3300028380 Bacteria 11457
190 Ga0268264_10025392 3300028381 Bacteria 4841
191 Ga0268264_10090814 3300028381 Bacteria 2633
192 Ga0268264_10471061 3300028381 Unclassified 1220
193 Ga0265338_10004975 3300028800 Bacteria 17602
194 Ga0307509_10215591 3300031507 Bacteria 1739
195 Ga0307408_100114320 3300031548 Bacteria 2079
196 Ga0307416_100321519 3300032002 Bacteria 1550
197 Ga0307414_10018620 3300032004 Bacteria 4281
198 Ga0307411_10904787 3300032005 Bacteria 784
199 Ga0373931_0046102 3300035691 Bacteria 2304
200 Ga0373925_0909524 3300037068 Unclassified 725
201 Ga0395898_0171427 3300037466 Bacteria 2074
202 Ga0395905_0008487 3300037471 Bacteria 10130
203 Ga0395905_0034467 3300037471 Bacteria 4753
204 Ga0395901_0074245 3300038443 Bacteria 3548
205 Ga0466972_0011932 3300044658 Bacteria 4366
206 Ga0466965_0053727 3300044683 Bacteria 2002
207 Ga0453684_0154298 3300044712 Bacteria 2724
208 Ga0451576_0466020 3300045051 Bacteria 1327
209 Ga0451576_0562508 3300045051 Unclassified 1198
210 Ga0495582_0167194 3300046473 Unclassified 1251
211 Ga0495658_0369105 3300046683 Bacteria 913
212 Ga0495613_0392900 3300046689 Unclassified 947
213 Ga0495636_0002166 3300047318 Bacteria 7532
214 Ga0495636_0239523 3300047318 Bacteria 837
215 Ga0496104_0827919 3300048907 Bacteria 831
216 Ga0496105_0439208 3300048908 Unclassified 1031
217 Ga0496110_0147875 3300048913 Bacteria 2126
218 Ga0501072_1348613 3300049588 Unclassified 552
219 Ga0501266_052933 3300049763 Unclassified 632
220 Ga0501279_004139 3300049775 Bacteria 1902
221 nmdc:mga0k408_11428_c1 3300050493 Bacteria 4835
222 nmdc:mga0k408_144718_c1 3300050493 Bacteria 1414
223 nmdc:mga0k408_15571_c1 3300050493 Bacteria 4205
224 nmdc:mga05p37_1115180_c1 3300050507 Bacteria 824
225 nmdc:mga09592_319571_c1 3300050508 Bacteria 1345
226 nmdc:mga0qj67_174844_c1 3300050509 Bacteria 1744
227 nmdc:mga06r32_31279_c1 3300050510 Bacteria 4997
228 nmdc:mga0n895_183742_c1 3300050512 Unclassified 2122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10389617 Ga0157372_103896172 147
2 3300050493 nmdc:mga0k408_11428_c1 nmdc:mga0k408_11428_c1_805_1266 153
3 3300005328 Ga0070676_10000418 Ga0070676_1000041817 154
4 3300005340 Ga0070689_100077474 Ga0070689_1000774744 154
5 3300005353 Ga0070669_100002144 Ga0070669_1000021447 154
6 3300005354 Ga0070675_100000360 Ga0070675_10000036023 154
7 3300005366 Ga0070659_100015594 Ga0070659_1000155942 154
8 3300005457 Ga0070662_100008609 Ga0070662_1000086093 154
9 3300005536 Ga0070697_100667745 Ga0070697_1006677451 154
10 3300009098 Ga0105245_10076865 Ga0105245_100768653 154
11 3300009148 Ga0105243_11754719 Ga0105243_117547191 154
12 3300009553 Ga0105249_10000609 Ga0105249_100006099 154
13 3300010375 Ga0105239_10010146 Ga0105239_1001014612 154
14 3300013102 Ga0157371_10089438 Ga0157371_100894381 154
15 3300013296 Ga0157374_10075387 Ga0157374_100753874 154
16 3300013297 Ga0157378_10013996 Ga0157378_100139966 154
17 3300013306 Ga0163162_10023165 Ga0163162_100231657 154
18 3300013308 Ga0157375_10329904 Ga0157375_103299043 154
19 3300014968 Ga0157379_10334001 Ga0157379_103340011 154
20 3300025923 Ga0207681_10001148 Ga0207681_100011487 154
21 3300005445 Ga0070708_100115096 Ga0070708_1001150963 157
22 3300013296 Ga0157374_10102586 Ga0157374_101025862 157
23 3300013306 Ga0163162_10035168 Ga0163162_100351685 157
24 3300005841 Ga0068863_100287026 Ga0068863_1002870261 158
25 3300005843 Ga0068860_100122986 Ga0068860_1001229862 158
26 3300006846 Ga0075430_100181673 Ga0075430_1001816732 158
27 3300006871 Ga0075434_100070772 Ga0075434_1000707725 158
28 3300009094 Ga0111539_10391874 Ga0111539_103918742 158
29 3300009147 Ga0114129_11223278 Ga0114129_112232782 158
30 3300009147 Ga0114129_12190858 Ga0114129_121908581 158
31 3300013296 Ga0157374_10126030 Ga0157374_101260304 158
32 3300014968 Ga0157379_10029336 Ga0157379_100293364 158
33 3300025925 Ga0207650_10196743 Ga0207650_101967432 158
34 3300025972 Ga0207668_10341088 Ga0207668_103410882 158
35 3300027552 Ga0209982_1024825 Ga0209982_10248252 158
36 3300035691 Ga0373931_0046102 Ga0373931_0046102_1233_1709 158
37 3300037068 Ga0373925_0909524 Ga0373925_0909524_204_680 158
38 3300045051 Ga0451576_0466020 Ga0451576_0466020_769_1245 158
39 3300046473 Ga0495582_0167194 Ga0495582_0167194_546_1022 158
40 3300046683 Ga0495658_0369105 Ga0495658_0369105_82_558 158
41 3300046689 Ga0495613_0392900 Ga0495613_0392900_206_682 158
42 3300049763 Ga0501266_052933 Ga0501266_052933_103_582 158
43 3300050507 nmdc:mga05p37_1115180_c1 nmdc:mga05p37_1115180_c1_287_763 158
44 3300050512 nmdc:mga0n895_183742_c1 nmdc:mga0n895_183742_c1_1119_1595 158
45 3300005339 Ga0070660_100321460 Ga0070660_1003214602 159
46 3300005366 Ga0070659_100551111 Ga0070659_1005511112 159
47 3300049588 Ga0501072_1348613 Ga0501072_1348613_20_502 160
48 3300003322 rootL2_10116321 rootL2_101163212 164
49 3300005339 Ga0070660_100030682 Ga0070660_1000306824 164
50 3300005344 Ga0070661_100016225 Ga0070661_1000162257 164
51 3300005344 Ga0070661_100109548 Ga0070661_1001095482 164
52 3300005356 Ga0070674_100022925 Ga0070674_1000229252 164
53 3300005364 Ga0070673_100039238 Ga0070673_1000392382 164
54 3300005366 Ga0070659_100846939 Ga0070659_1008469392 164
55 3300005457 Ga0070662_100322856 Ga0070662_1003228562 164
56 3300005458 Ga0070681_10178552 Ga0070681_101785523 164
57 3300005459 Ga0068867_100022578 Ga0068867_1000225785 164
58 3300005543 Ga0070672_100233509 Ga0070672_1002335093 164
59 3300005548 Ga0070665_100198913 Ga0070665_1001989132 164
60 3300005563 Ga0068855_100095432 Ga0068855_1000954323 164
61 3300005577 Ga0068857_101118060 Ga0068857_1011180602 164
62 3300005578 Ga0068854_100028369 Ga0068854_1000283692 164
63 3300005614 Ga0068856_100080579 Ga0068856_1000805794 164
64 3300005614 Ga0068856_100196463 Ga0068856_1001964633 164
65 3300005616 Ga0068852_100006828 Ga0068852_1000068282 164
66 3300005616 Ga0068852_100014364 Ga0068852_1000143642 164
67 3300005718 Ga0068866_10156736 Ga0068866_101567363 164
68 3300006881 Ga0068865_100065079 Ga0068865_1000650792 164
69 3300009174 Ga0105241_10076203 Ga0105241_100762032 164
70 3300009545 Ga0105237_10530653 Ga0105237_105306532 164
71 3300009551 Ga0105238_10007872 Ga0105238_100078722 164
72 3300010375 Ga0105239_10068971 Ga0105239_100689713 164
73 3300010375 Ga0105239_10348719 Ga0105239_103487193 164
74 3300011119 Ga0105246_10790319 Ga0105246_107903192 164
75 3300013102 Ga0157371_10004910 Ga0157371_1000491012 164
76 3300013102 Ga0157371_10154445 Ga0157371_101544452 164
77 3300013104 Ga0157370_10082345 Ga0157370_100823452 164
78 3300013104 Ga0157370_10125239 Ga0157370_101252392 164
79 3300013105 Ga0157369_10027429 Ga0157369_100274297 164
80 3300013105 Ga0157369_10885402 Ga0157369_108854022 164
81 3300013307 Ga0157372_10106217 Ga0157372_101062172 164
82 3300025899 Ga0207642_10127064 Ga0207642_101270642 164
83 3300025907 Ga0207645_10144441 Ga0207645_101444412 164
84 3300025913 Ga0207695_10741432 Ga0207695_107414322 164
85 3300025919 Ga0207657_10054843 Ga0207657_100548433 164
86 3300025919 Ga0207657_10093294 Ga0207657_100932943 164
87 3300025920 Ga0207649_10084688 Ga0207649_100846882 164
88 3300025920 Ga0207649_10096064 Ga0207649_100960643 164
89 3300025926 Ga0207659_10325308 Ga0207659_103253082 164
90 3300025937 Ga0207669_10169169 Ga0207669_101691693 164
91 3300025938 Ga0207704_10023519 Ga0207704_100235193 164
92 3300025940 Ga0207691_10313270 Ga0207691_103132702 164
93 3300025949 Ga0207667_10017593 Ga0207667_100175933 164
94 3300025960 Ga0207651_10046630 Ga0207651_100466304 164
95 3300025981 Ga0207640_10113837 Ga0207640_101138372 164
96 3300026041 Ga0207639_10923457 Ga0207639_109234572 164
97 3300026078 Ga0207702_10019906 Ga0207702_100199065 164
98 3300026089 Ga0207648_10040129 Ga0207648_100401294 164
99 3300026142 Ga0207698_11226433 Ga0207698_112264331 164
100 3300037466 Ga0395898_0171427 Ga0395898_0171427_682_1212 164
101 3300025932 Ga0207690_10632018 Ga0207690_106320182 165
102 iso_pu_bacteria 2738543012 2739244239 167
103 iso_pu_bacteria 2786546940 2788437309 167
104 iso_pu_bacteria 2816332133 2816472511 167
105 3300005617 Ga0068859_100339167 Ga0068859_1003391672 169
106 3300005618 Ga0068864_100037232 Ga0068864_1000372322 169
107 3300005841 Ga0068863_100013201 Ga0068863_1000132016 169
108 3300005842 Ga0068858_100129898 Ga0068858_1001298982 169
109 3300005843 Ga0068860_100001039 Ga0068860_1000010392 169
110 3300006358 Ga0068871_100431082 Ga0068871_1004310822 169
111 3300006931 Ga0097620_100339153 Ga0097620_1003391532 169
112 3300009177 Ga0105248_10019906 Ga0105248_100199068 169
113 3300009177 Ga0105248_10322683 Ga0105248_103226833 169
114 3300013306 Ga0163162_10281196 Ga0163162_102811962 169
115 3300014325 Ga0163163_10010035 Ga0163163_1001003510 169
116 3300014968 Ga0157379_10001050 Ga0157379_100010502 169
117 3300025901 Ga0207688_10771485 Ga0207688_107714851 169
118 3300025941 Ga0207711_10190253 Ga0207711_101902533 169
119 3300026035 Ga0207703_10147768 Ga0207703_101477682 169
120 3300026088 Ga0207641_10025591 Ga0207641_100255912 169
121 3300026095 Ga0207676_10061775 Ga0207676_100617754 169
122 3300026142 Ga0207698_10492757 Ga0207698_104927572 169
123 3300028381 Ga0268264_10090814 Ga0268264_100908144 169
124 3300003323 rootH1_10379503 rootH1_103795032 170
125 3300005338 Ga0068868_100328003 Ga0068868_1003280031 170
126 3300005338 Ga0068868_100639909 Ga0068868_1006399092 170
127 3300005366 Ga0070659_100390797 Ga0070659_1003907972 170
128 3300005437 Ga0070710_10356163 Ga0070710_103561631 170
129 3300005458 Ga0070681_10002863 Ga0070681_100028636 170
130 3300005530 Ga0070679_100313958 Ga0070679_1003139582 170
131 3300005614 Ga0068856_100412067 Ga0068856_1004120672 170
132 3300005616 Ga0068852_100053368 Ga0068852_1000533684 170
133 3300005834 Ga0068851_10015598 Ga0068851_100155985 170
134 3300005843 Ga0068860_100694098 Ga0068860_1006940981 170
135 3300006195 Ga0075366_10075360 Ga0075366_100753602 170
136 3300006237 Ga0097621_100009874 Ga0097621_1000098747 170
137 3300006358 Ga0068871_100040127 Ga0068871_1000401275 170
138 3300006847 Ga0075431_100028105 Ga0075431_1000281053 170
139 3300009093 Ga0105240_10584670 Ga0105240_105846702 170
140 3300009098 Ga0105245_10096960 Ga0105245_100969602 170
141 3300009177 Ga0105248_10072701 Ga0105248_100727015 170
142 3300025321 Ga0207656_10000295 Ga0207656_100002954 170
143 3300025912 Ga0207707_10018620 Ga0207707_100186202 170
144 3300025921 Ga0207652_10265973 Ga0207652_102659732 170
145 3300025927 Ga0207687_10093907 Ga0207687_100939074 170
146 3300025932 Ga0207690_10357740 Ga0207690_103577402 170
147 3300026078 Ga0207702_10371082 Ga0207702_103710822 170
148 3300026142 Ga0207698_10002977 Ga0207698_100029779 170
149 3300028381 Ga0268264_10471061 Ga0268264_104710612 170
150 3300031507 Ga0307509_10215591 Ga0307509_102155912 170
151 3300032002 Ga0307416_100321519 Ga0307416_1003215192 170
152 3300037471 Ga0395905_0008487 Ga0395905_0008487_7388_7930 170
153 3300037471 Ga0395905_0034467 Ga0395905_0034467_3704_4219 170
154 3300038443 Ga0395901_0074245 Ga0395901_0074245_1915_2430 170
155 3300044712 Ga0453684_0154298 Ga0453684_0154298_1596_2108 170
156 3300045051 Ga0451576_0562508 Ga0451576_0562508_638_1150 170
157 3300048907 Ga0496104_0827919 Ga0496104_0827919_239_751 170
158 3300048908 Ga0496105_0439208 Ga0496105_0439208_398_910 170
159 3300048913 Ga0496110_0147875 Ga0496110_0147875_142_654 170
160 3300050493 nmdc:mga0k408_144718_c1 nmdc:mga0k408_144718_c1_627_1139 170
161 3300050493 nmdc:mga0k408_15571_c1 nmdc:mga0k408_15571_c1_37_549 170
162 3300050508 nmdc:mga09592_319571_c1 nmdc:mga09592_319571_c1_633_1145 170
163 3300050509 nmdc:mga0qj67_174844_c1 nmdc:mga0qj67_174844_c1_1205_1717 170
164 3300050510 nmdc:mga06r32_31279_c1 nmdc:mga06r32_31279_c1_559_1071 170
165 3300001977 JGI24746J21847_1021947 JGI24746J21847_10219471 171
166 3300002773 JGI25152J39213_1000260 JGI25152J39213_10002602 171
167 3300002774 JGI25150J39212_1010982 JGI25150J39212_10109822 171
168 3300003215 JGI25153J46596_10014867 JGI25153J46596_100148677 171
169 3300003775 Ga0055524_1000891 Ga0055524_100089112 171
170 3300005293 Ga0065715_10605446 Ga0065715_106054461 171
171 3300005327 Ga0070658_10104291 Ga0070658_101042912 171
172 3300005328 Ga0070676_10010164 Ga0070676_100101642 171
173 3300005331 Ga0070670_100180709 Ga0070670_1001807092 171
174 3300005334 Ga0068869_100051105 Ga0068869_1000511054 171
175 3300005338 Ga0068868_100025336 Ga0068868_1000253363 171
176 3300005339 Ga0070660_100236843 Ga0070660_1002368431 171
177 3300005341 Ga0070691_10146863 Ga0070691_101468632 171
178 3300005353 Ga0070669_100045643 Ga0070669_1000456433 171
179 3300005435 Ga0070714_100272508 Ga0070714_1002725082 171
180 3300005445 Ga0070708_100697288 Ga0070708_1006972882 171
181 3300005539 Ga0068853_100166336 Ga0068853_1001663362 171
182 3300005543 Ga0070672_100145245 Ga0070672_1001452453 171
183 3300005544 Ga0070686_100256239 Ga0070686_1002562392 171
184 3300005544 Ga0070686_100941785 Ga0070686_1009417852 171
185 3300005563 Ga0068855_100018137 Ga0068855_1000181377 171
186 3300005563 Ga0068855_100368658 Ga0068855_1003686583 171
187 3300005617 Ga0068859_100003147 Ga0068859_10000314710 171
188 3300005719 Ga0068861_100049581 Ga0068861_1000495813 171
189 3300005844 Ga0068862_100002345 Ga0068862_1000023456 171
190 3300006173 Ga0070716_100029819 Ga0070716_1000298194 171
191 3300006195 Ga0075366_10031023 Ga0075366_100310233 171
192 3300006931 Ga0097620_100003147 Ga0097620_10000314710 171
193 3300007076 Ga0075435_100764292 Ga0075435_1007642922 171
194 3300009093 Ga0105240_10002112 Ga0105240_1000211225 171
195 3300009551 Ga0105238_10008963 Ga0105238_100089639 171
196 3300013307 Ga0157372_11297766 Ga0157372_112977661 171
197 3300014325 Ga0163163_11058690 Ga0163163_110586902 171
198 3300025245 Ga0207425_1000001 Ga0207425_1000001982 171
199 3300025258 Ga0209129_1000001 Ga0209129_1000001159 171
200 3300025290 Ga0207673_1002141 Ga0207673_10021413 171
201 3300025297 Ga0209758_1000020 Ga0209758_1000020294 171
202 3300025299 Ga0209256_1000028 Ga0209256_1000028266 171
203 3300025315 Ga0207697_10000006 Ga0207697_1000000677 171
204 3300025907 Ga0207645_10000071 Ga0207645_100000718 171
205 3300025909 Ga0207705_10212912 Ga0207705_102129122 171
206 3300025913 Ga0207695_10001465 Ga0207695_1000146524 171
207 3300025924 Ga0207694_10136619 Ga0207694_101366193 171
208 3300025926 Ga0207659_10006115 Ga0207659_100061153 171
209 3300025927 Ga0207687_10476311 Ga0207687_104763112 171
210 3300025929 Ga0207664_10217176 Ga0207664_102171763 171
211 3300025932 Ga0207690_10374614 Ga0207690_103746141 171
212 3300025933 Ga0207706_10000835 Ga0207706_100008359 171
213 3300025936 Ga0207670_10044042 Ga0207670_100440425 171
214 3300025939 Ga0207665_10119941 Ga0207665_101199414 171
215 3300025942 Ga0207689_10173602 Ga0207689_101736021 171
216 3300025949 Ga0207667_10328707 Ga0207667_103287072 171
217 3300025972 Ga0207668_10124968 Ga0207668_101249681 171
218 3300026023 Ga0207677_10419623 Ga0207677_104196231 171
219 3300026041 Ga0207639_10086188 Ga0207639_100861884 171
220 3300026118 Ga0207675_100073107 Ga0207675_1000731073 171
221 3300028380 Ga0268265_10003396 Ga0268265_100033961 171
222 3300028381 Ga0268264_10025392 Ga0268264_100253921 171
223 3300028800 Ga0265338_10004975 Ga0265338_100049753 171
224 3300031548 Ga0307408_100114320 Ga0307408_1001143201 171
225 3300032004 Ga0307414_10018620 Ga0307414_100186204 171
226 3300032005 Ga0307411_10904787 Ga0307411_109047872 171
227 3300044658 Ga0466972_0011932 Ga0466972_0011932_3540_4067 171
228 3300044683 Ga0466965_0053727 Ga0466965_0053727_1156_1683 171
229 3300047318 Ga0495636_0002166 Ga0495636_0002166_1140_1655 171
230 3300047318 Ga0495636_0239523 Ga0495636_0239523_58_573 171
231 3300049775 Ga0501279_004139 Ga0501279_004139_500_1015 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

20

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7076 1 169
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7004 1 169
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.6873 2 169
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.678 2 75
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.6764 2 169
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9079 2 83 3.30.70.1280
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8413 2 83 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8402 2 83 3.30.70.1280
2hiyB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.7845 1 84 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.7813 2 83 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A1W9LB56-F1-model_v4 Uncharacterized protein 0.984 2 170 GO:0004560
GO:0005975
AF-A0A1I4TFT3-F1-model_v4 Uncharacterized conserved protein, DUF1697 family 0.9816 1 170
AF-A0A2V7REZ7-F1-model_v4 DUF1697 domain-containing protein 0.9771 1 94
AF-A0A2V7GUE3-F1-model_v4 DUF1697 domain-containing protein 0.9761 1 170
AF-A0A1I4TFT3-F1-model_v4 Uncharacterized conserved protein, DUF1697 family 0.9759 1 170

Feature Viewer

pLDDT pTM Quality
93.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map