F343856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 231 | 161 | 228 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100018137|Ga0068855_1000181377 |
| Length | 201 |
| Sequence | VAAFAGRAACAVNEAVPSALRRYAAFLRGVSPQNLSMPVLKACLERCGFSDVRTLLSSGNATFTTRAPTQEAALERKIEAALKEDAGRPFMTFVRSVDALNELLDSDPYARFPPVPAAKRVVTFLRHAPAVAPKNALPLERDGARILCVRGAEAFGDYIPGPRGPVFMTLLERTFGKAITTRTWETVRKSAADPPAKPPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 2 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 3 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 155 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 156 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 157 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 0 |
| Isolates | 1.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.63 |
| Nodule | 0 |
| Rhizoplane | 1.3 |
| Rhizosphere | 90.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1021947 | 3300001977 | Unclassified | 891 |
| 2 | JGI25152J39213_1000260 | 3300002773 | Bacteria | 35206 |
| 3 | JGI25150J39212_1010982 | 3300002774 | Bacteria | 1660 |
| 4 | JGI25153J46596_10014867 | 3300003215 | Bacteria | 3209 |
| 5 | rootL2_10116321 | 3300003322 | Bacteria | 1090 |
| 6 | rootH1_10379503 | 3300003323 | Bacteria | 1116 |
| 7 | Ga0055524_1000891 | 3300003775 | Bacteria | 19357 |
| 8 | Ga0065715_10605446 | 3300005293 | Unclassified | 681 |
| 9 | Ga0070658_10104291 | 3300005327 | Bacteria | 2346 |
| 10 | Ga0070676_10000418 | 3300005328 | Bacteria | 20037 |
| 11 | Ga0070676_10010164 | 3300005328 | Bacteria | 5101 |
| 12 | Ga0070670_100180709 | 3300005331 | Bacteria | 1832 |
| 13 | Ga0068869_100051105 | 3300005334 | Bacteria | 2998 |
| 14 | Ga0068868_100025336 | 3300005338 | Bacteria | 4511 |
| 15 | Ga0068868_100328003 | 3300005338 | Bacteria | 1306 |
| 16 | Ga0068868_100639909 | 3300005338 | Bacteria | 946 |
| 17 | Ga0070660_100030682 | 3300005339 | Bacteria | 4033 |
| 18 | Ga0070660_100236843 | 3300005339 | Unclassified | 1486 |
| 19 | Ga0070660_100321460 | 3300005339 | Bacteria | 1271 |
| 20 | Ga0070689_100077474 | 3300005340 | Bacteria | 2605 |
| 21 | Ga0070691_10146863 | 3300005341 | Unclassified | 1206 |
| 22 | Ga0070661_100016225 | 3300005344 | Bacteria | 5262 |
| 23 | Ga0070661_100109548 | 3300005344 | Bacteria | 2061 |
| 24 | Ga0070669_100002144 | 3300005353 | Bacteria | 14271 |
| 25 | Ga0070669_100045643 | 3300005353 | Bacteria | 3193 |
| 26 | Ga0070675_100000360 | 3300005354 | Bacteria | 30832 |
| 27 | Ga0070674_100022925 | 3300005356 | Bacteria | 4032 |
| 28 | Ga0070673_100039238 | 3300005364 | Bacteria | 3622 |
| 29 | Ga0070659_100015594 | 3300005366 | Bacteria | 5692 |
| 30 | Ga0070659_100390797 | 3300005366 | Bacteria | 1173 |
| 31 | Ga0070659_100551111 | 3300005366 | Bacteria | 987 |
| 32 | Ga0070659_100846939 | 3300005366 | Bacteria | 797 |
| 33 | Ga0070714_100272508 | 3300005435 | Bacteria | 1570 |
| 34 | Ga0070710_10356163 | 3300005437 | Unclassified | 970 |
| 35 | Ga0070708_100115096 | 3300005445 | Bacteria | 2475 |
| 36 | Ga0070708_100697288 | 3300005445 | Unclassified | 956 |
| 37 | Ga0070662_100008609 | 3300005457 | Bacteria | 6657 |
| 38 | Ga0070662_100322856 | 3300005457 | Bacteria | 1259 |
| 39 | Ga0070681_10002863 | 3300005458 | Bacteria | 15941 |
| 40 | Ga0070681_10178552 | 3300005458 | Bacteria | 2045 |
| 41 | Ga0068867_100022578 | 3300005459 | Bacteria | 4498 |
| 42 | Ga0070679_100313958 | 3300005530 | Bacteria | 1517 |
| 43 | Ga0070697_100667745 | 3300005536 | Unclassified | 916 |
| 44 | Ga0068853_100166336 | 3300005539 | Bacteria | 1993 |
| 45 | Ga0070672_100145245 | 3300005543 | Bacteria | 1960 |
| 46 | Ga0070672_100233509 | 3300005543 | Bacteria | 1546 |
| 47 | Ga0070686_100256239 | 3300005544 | Unclassified | 1280 |
| 48 | Ga0070686_100941785 | 3300005544 | Unclassified | 705 |
| 49 | Ga0070665_100198913 | 3300005548 | Bacteria | 2005 |
| 50 | Ga0068855_100018137 | 3300005563 | Bacteria | 8457 |
| 51 | Ga0068855_100095432 | 3300005563 | Bacteria | 3427 |
| 52 | Ga0068855_100368658 | 3300005563 | Bacteria | 1579 |
| 53 | Ga0068857_101118060 | 3300005577 | Bacteria | 761 |
| 54 | Ga0068854_100028369 | 3300005578 | Bacteria | 3867 |
| 55 | Ga0068856_100080579 | 3300005614 | Bacteria | 3229 |
| 56 | Ga0068856_100196463 | 3300005614 | Bacteria | 2031 |
| 57 | Ga0068856_100412067 | 3300005614 | Unclassified | 1371 |
| 58 | Ga0068852_100006828 | 3300005616 | Bacteria | 8291 |
| 59 | Ga0068852_100014364 | 3300005616 | Bacteria | 6094 |
| 60 | Ga0068852_100053368 | 3300005616 | Bacteria | 3479 |
| 61 | Ga0068859_100003147 | 3300005617 | Bacteria | 16781 |
| 62 | Ga0068859_100339167 | 3300005617 | Unclassified | 1597 |
| 63 | Ga0068864_100037232 | 3300005618 | Bacteria | 4151 |
| 64 | Ga0068866_10156736 | 3300005718 | Bacteria | 1324 |
| 65 | Ga0068861_100049581 | 3300005719 | Unclassified | 3180 |
| 66 | Ga0068851_10015598 | 3300005834 | Bacteria | 3621 |
| 67 | Ga0068863_100013201 | 3300005841 | Bacteria | 7968 |
| 68 | Ga0068863_100287026 | 3300005841 | Bacteria | 1595 |
| 69 | Ga0068858_100129898 | 3300005842 | Bacteria | 2361 |
| 70 | Ga0068860_100001039 | 3300005843 | Bacteria | 30519 |
| 71 | Ga0068860_100122986 | 3300005843 | Bacteria | 2486 |
| 72 | Ga0068860_100694098 | 3300005843 | Bacteria | 1027 |
| 73 | Ga0068862_100002345 | 3300005844 | Bacteria | 16861 |
| 74 | Ga0070716_100029819 | 3300006173 | Bacteria | 2954 |
| 75 | Ga0075366_10031023 | 3300006195 | Bacteria | 3144 |
| 76 | Ga0075366_10075360 | 3300006195 | Bacteria | 2012 |
| 77 | Ga0097621_100009874 | 3300006237 | Bacteria | 6951 |
| 78 | Ga0068871_100040127 | 3300006358 | Bacteria | 3748 |
| 79 | Ga0068871_100431082 | 3300006358 | Bacteria | 1179 |
| 80 | Ga0075430_100181673 | 3300006846 | Bacteria | 1750 |
| 81 | Ga0075431_100028105 | 3300006847 | Bacteria | 5774 |
| 82 | Ga0075434_100070772 | 3300006871 | Unclassified | 3479 |
| 83 | Ga0068865_100065079 | 3300006881 | Bacteria | 2567 |
| 84 | Ga0097620_100003147 | 3300006931 | Bacteria | 16781 |
| 85 | Ga0097620_100339153 | 3300006931 | Unclassified | 1597 |
| 86 | Ga0075435_100764292 | 3300007076 | Unclassified | 841 |
| 87 | Ga0105240_10002112 | 3300009093 | Bacteria | 32514 |
| 88 | Ga0105240_10584670 | 3300009093 | Bacteria | 1231 |
| 89 | Ga0111539_10391874 | 3300009094 | Bacteria | 1618 |
| 90 | Ga0105245_10076865 | 3300009098 | Bacteria | 3042 |
| 91 | Ga0105245_10096960 | 3300009098 | Bacteria | 2722 |
| 92 | Ga0114129_11223278 | 3300009147 | Bacteria | 934 |
| 93 | Ga0114129_12190858 | 3300009147 | Unclassified | 665 |
| 94 | Ga0105243_11754719 | 3300009148 | Unclassified | 651 |
| 95 | Ga0105241_10076203 | 3300009174 | Bacteria | 2615 |
| 96 | Ga0105248_10019906 | 3300009177 | Bacteria | 7430 |
| 97 | Ga0105248_10072701 | 3300009177 | Bacteria | 3865 |
| 98 | Ga0105248_10322683 | 3300009177 | Unclassified | 1739 |
| 99 | Ga0105237_10530653 | 3300009545 | Bacteria | 1184 |
| 100 | Ga0105238_10007872 | 3300009551 | Bacteria | 10662 |
| 101 | Ga0105238_10008963 | 3300009551 | Bacteria | 10012 |
| 102 | Ga0105249_10000609 | 3300009553 | Bacteria | 32611 |
| 103 | Ga0105239_10010146 | 3300010375 | Bacteria | 10555 |
| 104 | Ga0105239_10068971 | 3300010375 | Bacteria | 3886 |
| 105 | Ga0105239_10348719 | 3300010375 | Bacteria | 1671 |
| 106 | Ga0105246_10790319 | 3300011119 | Bacteria | 841 |
| 107 | Ga0157371_10004910 | 3300013102 | Bacteria | 11488 |
| 108 | Ga0157371_10089438 | 3300013102 | Bacteria | 2181 |
| 109 | Ga0157371_10154445 | 3300013102 | Bacteria | 1638 |
| 110 | Ga0157370_10082345 | 3300013104 | Bacteria | 3027 |
| 111 | Ga0157370_10125239 | 3300013104 | Bacteria | 2398 |
| 112 | Ga0157369_10027429 | 3300013105 | Bacteria | 6313 |
| 113 | Ga0157369_10885402 | 3300013105 | Bacteria | 916 |
| 114 | Ga0157374_10075387 | 3300013296 | Bacteria | 3188 |
| 115 | Ga0157374_10102586 | 3300013296 | Bacteria | 2744 |
| 116 | Ga0157374_10126030 | 3300013296 | Bacteria | 2476 |
| 117 | Ga0157378_10013996 | 3300013297 | Bacteria | 7021 |
| 118 | Ga0163162_10023165 | 3300013306 | Bacteria | 6126 |
| 119 | Ga0163162_10035168 | 3300013306 | Bacteria | 4989 |
| 120 | Ga0163162_10281196 | 3300013306 | Bacteria | 1796 |
| 121 | Ga0157372_10106217 | 3300013307 | Bacteria | 3212 |
| 122 | Ga0157372_10389617 | 3300013307 | Bacteria | 1624 |
| 123 | Ga0157372_11297766 | 3300013307 | Unclassified | 840 |
| 124 | Ga0157375_10329904 | 3300013308 | Bacteria | 1691 |
| 125 | Ga0163163_10010035 | 3300014325 | Bacteria | 8495 |
| 126 | Ga0163163_11058690 | 3300014325 | Bacteria | 874 |
| 127 | Ga0157379_10001050 | 3300014968 | Bacteria | 22453 |
| 128 | Ga0157379_10029336 | 3300014968 | Bacteria | 4892 |
| 129 | Ga0157379_10334001 | 3300014968 | Bacteria | 1385 |
| 130 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 131 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 132 | Ga0207673_1002141 | 3300025290 | Bacteria | 2223 |
| 133 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 134 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 135 | Ga0207697_10000006 | 3300025315 | Bacteria | 82632 |
| 136 | Ga0207656_10000295 | 3300025321 | Bacteria | 17228 |
| 137 | Ga0207642_10127064 | 3300025899 | Bacteria | 1324 |
| 138 | Ga0207688_10771485 | 3300025901 | Bacteria | 609 |
| 139 | Ga0207645_10000071 | 3300025907 | Bacteria | 72725 |
| 140 | Ga0207645_10144441 | 3300025907 | Bacteria | 1551 |
| 141 | Ga0207705_10212912 | 3300025909 | Unclassified | 1466 |
| 142 | Ga0207707_10018620 | 3300025912 | Bacteria | 6054 |
| 143 | Ga0207695_10001465 | 3300025913 | Bacteria | 39532 |
| 144 | Ga0207695_10741432 | 3300025913 | Bacteria | 863 |
| 145 | Ga0207657_10054843 | 3300025919 | Bacteria | 3445 |
| 146 | Ga0207657_10093294 | 3300025919 | Bacteria | 2508 |
| 147 | Ga0207649_10084688 | 3300025920 | Bacteria | 2061 |
| 148 | Ga0207649_10096064 | 3300025920 | Bacteria | 1951 |
| 149 | Ga0207652_10265973 | 3300025921 | Bacteria | 1547 |
| 150 | Ga0207681_10001148 | 3300025923 | Bacteria | 17100 |
| 151 | Ga0207694_10136619 | 3300025924 | Bacteria | 1969 |
| 152 | Ga0207650_10196743 | 3300025925 | Bacteria | 1613 |
| 153 | Ga0207659_10006115 | 3300025926 | Bacteria | 7355 |
| 154 | Ga0207659_10325308 | 3300025926 | Bacteria | 1269 |
| 155 | Ga0207687_10093907 | 3300025927 | Bacteria | 2194 |
| 156 | Ga0207687_10476311 | 3300025927 | Unclassified | 1039 |
| 157 | Ga0207664_10217176 | 3300025929 | Bacteria | 1657 |
| 158 | Ga0207690_10357740 | 3300025932 | Bacteria | 1156 |
| 159 | Ga0207690_10374614 | 3300025932 | Bacteria | 1130 |
| 160 | Ga0207690_10632018 | 3300025932 | Unclassified | 876 |
| 161 | Ga0207706_10000835 | 3300025933 | Bacteria | 31957 |
| 162 | Ga0207670_10044042 | 3300025936 | Bacteria | 2951 |
| 163 | Ga0207669_10169169 | 3300025937 | Bacteria | 1553 |
| 164 | Ga0207704_10023519 | 3300025938 | Bacteria | 3323 |
| 165 | Ga0207665_10119941 | 3300025939 | Archaea | 1857 |
| 166 | Ga0207691_10313270 | 3300025940 | Bacteria | 1346 |
| 167 | Ga0207711_10190253 | 3300025941 | Bacteria | 1870 |
| 168 | Ga0207689_10173602 | 3300025942 | Unclassified | 1777 |
| 169 | Ga0207667_10017593 | 3300025949 | Bacteria | 8038 |
| 170 | Ga0207667_10328707 | 3300025949 | Bacteria | 1561 |
| 171 | Ga0207651_10046630 | 3300025960 | Bacteria | 2916 |
| 172 | Ga0207668_10124968 | 3300025972 | Bacteria | 1954 |
| 173 | Ga0207668_10341088 | 3300025972 | Bacteria | 1250 |
| 174 | Ga0207640_10113837 | 3300025981 | Bacteria | 1923 |
| 175 | Ga0207677_10419623 | 3300026023 | Unclassified | 1139 |
| 176 | Ga0207703_10147768 | 3300026035 | Bacteria | 2046 |
| 177 | Ga0207639_10086188 | 3300026041 | Bacteria | 2500 |
| 178 | Ga0207639_10923457 | 3300026041 | Bacteria | 816 |
| 179 | Ga0207702_10019906 | 3300026078 | Bacteria | 5559 |
| 180 | Ga0207702_10371082 | 3300026078 | Unclassified | 1374 |
| 181 | Ga0207641_10025591 | 3300026088 | Bacteria | 4866 |
| 182 | Ga0207648_10040129 | 3300026089 | Bacteria | 4113 |
| 183 | Ga0207676_10061775 | 3300026095 | Bacteria | 2968 |
| 184 | Ga0207675_100073107 | 3300026118 | Unclassified | 3208 |
| 185 | Ga0207698_10002977 | 3300026142 | Bacteria | 10151 |
| 186 | Ga0207698_10492757 | 3300026142 | Bacteria | 1191 |
| 187 | Ga0207698_11226433 | 3300026142 | Bacteria | 764 |
| 188 | Ga0209982_1024825 | 3300027552 | Unclassified | 930 |
| 189 | Ga0268265_10003396 | 3300028380 | Bacteria | 11457 |
| 190 | Ga0268264_10025392 | 3300028381 | Bacteria | 4841 |
| 191 | Ga0268264_10090814 | 3300028381 | Bacteria | 2633 |
| 192 | Ga0268264_10471061 | 3300028381 | Unclassified | 1220 |
| 193 | Ga0265338_10004975 | 3300028800 | Bacteria | 17602 |
| 194 | Ga0307509_10215591 | 3300031507 | Bacteria | 1739 |
| 195 | Ga0307408_100114320 | 3300031548 | Bacteria | 2079 |
| 196 | Ga0307416_100321519 | 3300032002 | Bacteria | 1550 |
| 197 | Ga0307414_10018620 | 3300032004 | Bacteria | 4281 |
| 198 | Ga0307411_10904787 | 3300032005 | Bacteria | 784 |
| 199 | Ga0373931_0046102 | 3300035691 | Bacteria | 2304 |
| 200 | Ga0373925_0909524 | 3300037068 | Unclassified | 725 |
| 201 | Ga0395898_0171427 | 3300037466 | Bacteria | 2074 |
| 202 | Ga0395905_0008487 | 3300037471 | Bacteria | 10130 |
| 203 | Ga0395905_0034467 | 3300037471 | Bacteria | 4753 |
| 204 | Ga0395901_0074245 | 3300038443 | Bacteria | 3548 |
| 205 | Ga0466972_0011932 | 3300044658 | Bacteria | 4366 |
| 206 | Ga0466965_0053727 | 3300044683 | Bacteria | 2002 |
| 207 | Ga0453684_0154298 | 3300044712 | Bacteria | 2724 |
| 208 | Ga0451576_0466020 | 3300045051 | Bacteria | 1327 |
| 209 | Ga0451576_0562508 | 3300045051 | Unclassified | 1198 |
| 210 | Ga0495582_0167194 | 3300046473 | Unclassified | 1251 |
| 211 | Ga0495658_0369105 | 3300046683 | Bacteria | 913 |
| 212 | Ga0495613_0392900 | 3300046689 | Unclassified | 947 |
| 213 | Ga0495636_0002166 | 3300047318 | Bacteria | 7532 |
| 214 | Ga0495636_0239523 | 3300047318 | Bacteria | 837 |
| 215 | Ga0496104_0827919 | 3300048907 | Bacteria | 831 |
| 216 | Ga0496105_0439208 | 3300048908 | Unclassified | 1031 |
| 217 | Ga0496110_0147875 | 3300048913 | Bacteria | 2126 |
| 218 | Ga0501072_1348613 | 3300049588 | Unclassified | 552 |
| 219 | Ga0501266_052933 | 3300049763 | Unclassified | 632 |
| 220 | Ga0501279_004139 | 3300049775 | Bacteria | 1902 |
| 221 | nmdc:mga0k408_11428_c1 | 3300050493 | Bacteria | 4835 |
| 222 | nmdc:mga0k408_144718_c1 | 3300050493 | Bacteria | 1414 |
| 223 | nmdc:mga0k408_15571_c1 | 3300050493 | Bacteria | 4205 |
| 224 | nmdc:mga05p37_1115180_c1 | 3300050507 | Bacteria | 824 |
| 225 | nmdc:mga09592_319571_c1 | 3300050508 | Bacteria | 1345 |
| 226 | nmdc:mga0qj67_174844_c1 | 3300050509 | Bacteria | 1744 |
| 227 | nmdc:mga06r32_31279_c1 | 3300050510 | Bacteria | 4997 |
| 228 | nmdc:mga0n895_183742_c1 | 3300050512 | Unclassified | 2122 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10389617 | Ga0157372_103896172 | 147 |
| 2 | 3300050493 | nmdc:mga0k408_11428_c1 | nmdc:mga0k408_11428_c1_805_1266 | 153 |
| 3 | 3300005328 | Ga0070676_10000418 | Ga0070676_1000041817 | 154 |
| 4 | 3300005340 | Ga0070689_100077474 | Ga0070689_1000774744 | 154 |
| 5 | 3300005353 | Ga0070669_100002144 | Ga0070669_1000021447 | 154 |
| 6 | 3300005354 | Ga0070675_100000360 | Ga0070675_10000036023 | 154 |
| 7 | 3300005366 | Ga0070659_100015594 | Ga0070659_1000155942 | 154 |
| 8 | 3300005457 | Ga0070662_100008609 | Ga0070662_1000086093 | 154 |
| 9 | 3300005536 | Ga0070697_100667745 | Ga0070697_1006677451 | 154 |
| 10 | 3300009098 | Ga0105245_10076865 | Ga0105245_100768653 | 154 |
| 11 | 3300009148 | Ga0105243_11754719 | Ga0105243_117547191 | 154 |
| 12 | 3300009553 | Ga0105249_10000609 | Ga0105249_100006099 | 154 |
| 13 | 3300010375 | Ga0105239_10010146 | Ga0105239_1001014612 | 154 |
| 14 | 3300013102 | Ga0157371_10089438 | Ga0157371_100894381 | 154 |
| 15 | 3300013296 | Ga0157374_10075387 | Ga0157374_100753874 | 154 |
| 16 | 3300013297 | Ga0157378_10013996 | Ga0157378_100139966 | 154 |
| 17 | 3300013306 | Ga0163162_10023165 | Ga0163162_100231657 | 154 |
| 18 | 3300013308 | Ga0157375_10329904 | Ga0157375_103299043 | 154 |
| 19 | 3300014968 | Ga0157379_10334001 | Ga0157379_103340011 | 154 |
| 20 | 3300025923 | Ga0207681_10001148 | Ga0207681_100011487 | 154 |
| 21 | 3300005445 | Ga0070708_100115096 | Ga0070708_1001150963 | 157 |
| 22 | 3300013296 | Ga0157374_10102586 | Ga0157374_101025862 | 157 |
| 23 | 3300013306 | Ga0163162_10035168 | Ga0163162_100351685 | 157 |
| 24 | 3300005841 | Ga0068863_100287026 | Ga0068863_1002870261 | 158 |
| 25 | 3300005843 | Ga0068860_100122986 | Ga0068860_1001229862 | 158 |
| 26 | 3300006846 | Ga0075430_100181673 | Ga0075430_1001816732 | 158 |
| 27 | 3300006871 | Ga0075434_100070772 | Ga0075434_1000707725 | 158 |
| 28 | 3300009094 | Ga0111539_10391874 | Ga0111539_103918742 | 158 |
| 29 | 3300009147 | Ga0114129_11223278 | Ga0114129_112232782 | 158 |
| 30 | 3300009147 | Ga0114129_12190858 | Ga0114129_121908581 | 158 |
| 31 | 3300013296 | Ga0157374_10126030 | Ga0157374_101260304 | 158 |
| 32 | 3300014968 | Ga0157379_10029336 | Ga0157379_100293364 | 158 |
| 33 | 3300025925 | Ga0207650_10196743 | Ga0207650_101967432 | 158 |
| 34 | 3300025972 | Ga0207668_10341088 | Ga0207668_103410882 | 158 |
| 35 | 3300027552 | Ga0209982_1024825 | Ga0209982_10248252 | 158 |
| 36 | 3300035691 | Ga0373931_0046102 | Ga0373931_0046102_1233_1709 | 158 |
| 37 | 3300037068 | Ga0373925_0909524 | Ga0373925_0909524_204_680 | 158 |
| 38 | 3300045051 | Ga0451576_0466020 | Ga0451576_0466020_769_1245 | 158 |
| 39 | 3300046473 | Ga0495582_0167194 | Ga0495582_0167194_546_1022 | 158 |
| 40 | 3300046683 | Ga0495658_0369105 | Ga0495658_0369105_82_558 | 158 |
| 41 | 3300046689 | Ga0495613_0392900 | Ga0495613_0392900_206_682 | 158 |
| 42 | 3300049763 | Ga0501266_052933 | Ga0501266_052933_103_582 | 158 |
| 43 | 3300050507 | nmdc:mga05p37_1115180_c1 | nmdc:mga05p37_1115180_c1_287_763 | 158 |
| 44 | 3300050512 | nmdc:mga0n895_183742_c1 | nmdc:mga0n895_183742_c1_1119_1595 | 158 |
| 45 | 3300005339 | Ga0070660_100321460 | Ga0070660_1003214602 | 159 |
| 46 | 3300005366 | Ga0070659_100551111 | Ga0070659_1005511112 | 159 |
| 47 | 3300049588 | Ga0501072_1348613 | Ga0501072_1348613_20_502 | 160 |
| 48 | 3300003322 | rootL2_10116321 | rootL2_101163212 | 164 |
| 49 | 3300005339 | Ga0070660_100030682 | Ga0070660_1000306824 | 164 |
| 50 | 3300005344 | Ga0070661_100016225 | Ga0070661_1000162257 | 164 |
| 51 | 3300005344 | Ga0070661_100109548 | Ga0070661_1001095482 | 164 |
| 52 | 3300005356 | Ga0070674_100022925 | Ga0070674_1000229252 | 164 |
| 53 | 3300005364 | Ga0070673_100039238 | Ga0070673_1000392382 | 164 |
| 54 | 3300005366 | Ga0070659_100846939 | Ga0070659_1008469392 | 164 |
| 55 | 3300005457 | Ga0070662_100322856 | Ga0070662_1003228562 | 164 |
| 56 | 3300005458 | Ga0070681_10178552 | Ga0070681_101785523 | 164 |
| 57 | 3300005459 | Ga0068867_100022578 | Ga0068867_1000225785 | 164 |
| 58 | 3300005543 | Ga0070672_100233509 | Ga0070672_1002335093 | 164 |
| 59 | 3300005548 | Ga0070665_100198913 | Ga0070665_1001989132 | 164 |
| 60 | 3300005563 | Ga0068855_100095432 | Ga0068855_1000954323 | 164 |
| 61 | 3300005577 | Ga0068857_101118060 | Ga0068857_1011180602 | 164 |
| 62 | 3300005578 | Ga0068854_100028369 | Ga0068854_1000283692 | 164 |
| 63 | 3300005614 | Ga0068856_100080579 | Ga0068856_1000805794 | 164 |
| 64 | 3300005614 | Ga0068856_100196463 | Ga0068856_1001964633 | 164 |
| 65 | 3300005616 | Ga0068852_100006828 | Ga0068852_1000068282 | 164 |
| 66 | 3300005616 | Ga0068852_100014364 | Ga0068852_1000143642 | 164 |
| 67 | 3300005718 | Ga0068866_10156736 | Ga0068866_101567363 | 164 |
| 68 | 3300006881 | Ga0068865_100065079 | Ga0068865_1000650792 | 164 |
| 69 | 3300009174 | Ga0105241_10076203 | Ga0105241_100762032 | 164 |
| 70 | 3300009545 | Ga0105237_10530653 | Ga0105237_105306532 | 164 |
| 71 | 3300009551 | Ga0105238_10007872 | Ga0105238_100078722 | 164 |
| 72 | 3300010375 | Ga0105239_10068971 | Ga0105239_100689713 | 164 |
| 73 | 3300010375 | Ga0105239_10348719 | Ga0105239_103487193 | 164 |
| 74 | 3300011119 | Ga0105246_10790319 | Ga0105246_107903192 | 164 |
| 75 | 3300013102 | Ga0157371_10004910 | Ga0157371_1000491012 | 164 |
| 76 | 3300013102 | Ga0157371_10154445 | Ga0157371_101544452 | 164 |
| 77 | 3300013104 | Ga0157370_10082345 | Ga0157370_100823452 | 164 |
| 78 | 3300013104 | Ga0157370_10125239 | Ga0157370_101252392 | 164 |
| 79 | 3300013105 | Ga0157369_10027429 | Ga0157369_100274297 | 164 |
| 80 | 3300013105 | Ga0157369_10885402 | Ga0157369_108854022 | 164 |
| 81 | 3300013307 | Ga0157372_10106217 | Ga0157372_101062172 | 164 |
| 82 | 3300025899 | Ga0207642_10127064 | Ga0207642_101270642 | 164 |
| 83 | 3300025907 | Ga0207645_10144441 | Ga0207645_101444412 | 164 |
| 84 | 3300025913 | Ga0207695_10741432 | Ga0207695_107414322 | 164 |
| 85 | 3300025919 | Ga0207657_10054843 | Ga0207657_100548433 | 164 |
| 86 | 3300025919 | Ga0207657_10093294 | Ga0207657_100932943 | 164 |
| 87 | 3300025920 | Ga0207649_10084688 | Ga0207649_100846882 | 164 |
| 88 | 3300025920 | Ga0207649_10096064 | Ga0207649_100960643 | 164 |
| 89 | 3300025926 | Ga0207659_10325308 | Ga0207659_103253082 | 164 |
| 90 | 3300025937 | Ga0207669_10169169 | Ga0207669_101691693 | 164 |
| 91 | 3300025938 | Ga0207704_10023519 | Ga0207704_100235193 | 164 |
| 92 | 3300025940 | Ga0207691_10313270 | Ga0207691_103132702 | 164 |
| 93 | 3300025949 | Ga0207667_10017593 | Ga0207667_100175933 | 164 |
| 94 | 3300025960 | Ga0207651_10046630 | Ga0207651_100466304 | 164 |
| 95 | 3300025981 | Ga0207640_10113837 | Ga0207640_101138372 | 164 |
| 96 | 3300026041 | Ga0207639_10923457 | Ga0207639_109234572 | 164 |
| 97 | 3300026078 | Ga0207702_10019906 | Ga0207702_100199065 | 164 |
| 98 | 3300026089 | Ga0207648_10040129 | Ga0207648_100401294 | 164 |
| 99 | 3300026142 | Ga0207698_11226433 | Ga0207698_112264331 | 164 |
| 100 | 3300037466 | Ga0395898_0171427 | Ga0395898_0171427_682_1212 | 164 |
| 101 | 3300025932 | Ga0207690_10632018 | Ga0207690_106320182 | 165 |
| 102 | iso_pu_bacteria | 2738543012 | 2739244239 | 167 |
| 103 | iso_pu_bacteria | 2786546940 | 2788437309 | 167 |
| 104 | iso_pu_bacteria | 2816332133 | 2816472511 | 167 |
| 105 | 3300005617 | Ga0068859_100339167 | Ga0068859_1003391672 | 169 |
| 106 | 3300005618 | Ga0068864_100037232 | Ga0068864_1000372322 | 169 |
| 107 | 3300005841 | Ga0068863_100013201 | Ga0068863_1000132016 | 169 |
| 108 | 3300005842 | Ga0068858_100129898 | Ga0068858_1001298982 | 169 |
| 109 | 3300005843 | Ga0068860_100001039 | Ga0068860_1000010392 | 169 |
| 110 | 3300006358 | Ga0068871_100431082 | Ga0068871_1004310822 | 169 |
| 111 | 3300006931 | Ga0097620_100339153 | Ga0097620_1003391532 | 169 |
| 112 | 3300009177 | Ga0105248_10019906 | Ga0105248_100199068 | 169 |
| 113 | 3300009177 | Ga0105248_10322683 | Ga0105248_103226833 | 169 |
| 114 | 3300013306 | Ga0163162_10281196 | Ga0163162_102811962 | 169 |
| 115 | 3300014325 | Ga0163163_10010035 | Ga0163163_1001003510 | 169 |
| 116 | 3300014968 | Ga0157379_10001050 | Ga0157379_100010502 | 169 |
| 117 | 3300025901 | Ga0207688_10771485 | Ga0207688_107714851 | 169 |
| 118 | 3300025941 | Ga0207711_10190253 | Ga0207711_101902533 | 169 |
| 119 | 3300026035 | Ga0207703_10147768 | Ga0207703_101477682 | 169 |
| 120 | 3300026088 | Ga0207641_10025591 | Ga0207641_100255912 | 169 |
| 121 | 3300026095 | Ga0207676_10061775 | Ga0207676_100617754 | 169 |
| 122 | 3300026142 | Ga0207698_10492757 | Ga0207698_104927572 | 169 |
| 123 | 3300028381 | Ga0268264_10090814 | Ga0268264_100908144 | 169 |
| 124 | 3300003323 | rootH1_10379503 | rootH1_103795032 | 170 |
| 125 | 3300005338 | Ga0068868_100328003 | Ga0068868_1003280031 | 170 |
| 126 | 3300005338 | Ga0068868_100639909 | Ga0068868_1006399092 | 170 |
| 127 | 3300005366 | Ga0070659_100390797 | Ga0070659_1003907972 | 170 |
| 128 | 3300005437 | Ga0070710_10356163 | Ga0070710_103561631 | 170 |
| 129 | 3300005458 | Ga0070681_10002863 | Ga0070681_100028636 | 170 |
| 130 | 3300005530 | Ga0070679_100313958 | Ga0070679_1003139582 | 170 |
| 131 | 3300005614 | Ga0068856_100412067 | Ga0068856_1004120672 | 170 |
| 132 | 3300005616 | Ga0068852_100053368 | Ga0068852_1000533684 | 170 |
| 133 | 3300005834 | Ga0068851_10015598 | Ga0068851_100155985 | 170 |
| 134 | 3300005843 | Ga0068860_100694098 | Ga0068860_1006940981 | 170 |
| 135 | 3300006195 | Ga0075366_10075360 | Ga0075366_100753602 | 170 |
| 136 | 3300006237 | Ga0097621_100009874 | Ga0097621_1000098747 | 170 |
| 137 | 3300006358 | Ga0068871_100040127 | Ga0068871_1000401275 | 170 |
| 138 | 3300006847 | Ga0075431_100028105 | Ga0075431_1000281053 | 170 |
| 139 | 3300009093 | Ga0105240_10584670 | Ga0105240_105846702 | 170 |
| 140 | 3300009098 | Ga0105245_10096960 | Ga0105245_100969602 | 170 |
| 141 | 3300009177 | Ga0105248_10072701 | Ga0105248_100727015 | 170 |
| 142 | 3300025321 | Ga0207656_10000295 | Ga0207656_100002954 | 170 |
| 143 | 3300025912 | Ga0207707_10018620 | Ga0207707_100186202 | 170 |
| 144 | 3300025921 | Ga0207652_10265973 | Ga0207652_102659732 | 170 |
| 145 | 3300025927 | Ga0207687_10093907 | Ga0207687_100939074 | 170 |
| 146 | 3300025932 | Ga0207690_10357740 | Ga0207690_103577402 | 170 |
| 147 | 3300026078 | Ga0207702_10371082 | Ga0207702_103710822 | 170 |
| 148 | 3300026142 | Ga0207698_10002977 | Ga0207698_100029779 | 170 |
| 149 | 3300028381 | Ga0268264_10471061 | Ga0268264_104710612 | 170 |
| 150 | 3300031507 | Ga0307509_10215591 | Ga0307509_102155912 | 170 |
| 151 | 3300032002 | Ga0307416_100321519 | Ga0307416_1003215192 | 170 |
| 152 | 3300037471 | Ga0395905_0008487 | Ga0395905_0008487_7388_7930 | 170 |
| 153 | 3300037471 | Ga0395905_0034467 | Ga0395905_0034467_3704_4219 | 170 |
| 154 | 3300038443 | Ga0395901_0074245 | Ga0395901_0074245_1915_2430 | 170 |
| 155 | 3300044712 | Ga0453684_0154298 | Ga0453684_0154298_1596_2108 | 170 |
| 156 | 3300045051 | Ga0451576_0562508 | Ga0451576_0562508_638_1150 | 170 |
| 157 | 3300048907 | Ga0496104_0827919 | Ga0496104_0827919_239_751 | 170 |
| 158 | 3300048908 | Ga0496105_0439208 | Ga0496105_0439208_398_910 | 170 |
| 159 | 3300048913 | Ga0496110_0147875 | Ga0496110_0147875_142_654 | 170 |
| 160 | 3300050493 | nmdc:mga0k408_144718_c1 | nmdc:mga0k408_144718_c1_627_1139 | 170 |
| 161 | 3300050493 | nmdc:mga0k408_15571_c1 | nmdc:mga0k408_15571_c1_37_549 | 170 |
| 162 | 3300050508 | nmdc:mga09592_319571_c1 | nmdc:mga09592_319571_c1_633_1145 | 170 |
| 163 | 3300050509 | nmdc:mga0qj67_174844_c1 | nmdc:mga0qj67_174844_c1_1205_1717 | 170 |
| 164 | 3300050510 | nmdc:mga06r32_31279_c1 | nmdc:mga06r32_31279_c1_559_1071 | 170 |
| 165 | 3300001977 | JGI24746J21847_1021947 | JGI24746J21847_10219471 | 171 |
| 166 | 3300002773 | JGI25152J39213_1000260 | JGI25152J39213_10002602 | 171 |
| 167 | 3300002774 | JGI25150J39212_1010982 | JGI25150J39212_10109822 | 171 |
| 168 | 3300003215 | JGI25153J46596_10014867 | JGI25153J46596_100148677 | 171 |
| 169 | 3300003775 | Ga0055524_1000891 | Ga0055524_100089112 | 171 |
| 170 | 3300005293 | Ga0065715_10605446 | Ga0065715_106054461 | 171 |
| 171 | 3300005327 | Ga0070658_10104291 | Ga0070658_101042912 | 171 |
| 172 | 3300005328 | Ga0070676_10010164 | Ga0070676_100101642 | 171 |
| 173 | 3300005331 | Ga0070670_100180709 | Ga0070670_1001807092 | 171 |
| 174 | 3300005334 | Ga0068869_100051105 | Ga0068869_1000511054 | 171 |
| 175 | 3300005338 | Ga0068868_100025336 | Ga0068868_1000253363 | 171 |
| 176 | 3300005339 | Ga0070660_100236843 | Ga0070660_1002368431 | 171 |
| 177 | 3300005341 | Ga0070691_10146863 | Ga0070691_101468632 | 171 |
| 178 | 3300005353 | Ga0070669_100045643 | Ga0070669_1000456433 | 171 |
| 179 | 3300005435 | Ga0070714_100272508 | Ga0070714_1002725082 | 171 |
| 180 | 3300005445 | Ga0070708_100697288 | Ga0070708_1006972882 | 171 |
| 181 | 3300005539 | Ga0068853_100166336 | Ga0068853_1001663362 | 171 |
| 182 | 3300005543 | Ga0070672_100145245 | Ga0070672_1001452453 | 171 |
| 183 | 3300005544 | Ga0070686_100256239 | Ga0070686_1002562392 | 171 |
| 184 | 3300005544 | Ga0070686_100941785 | Ga0070686_1009417852 | 171 |
| 185 | 3300005563 | Ga0068855_100018137 | Ga0068855_1000181377 | 171 |
| 186 | 3300005563 | Ga0068855_100368658 | Ga0068855_1003686583 | 171 |
| 187 | 3300005617 | Ga0068859_100003147 | Ga0068859_10000314710 | 171 |
| 188 | 3300005719 | Ga0068861_100049581 | Ga0068861_1000495813 | 171 |
| 189 | 3300005844 | Ga0068862_100002345 | Ga0068862_1000023456 | 171 |
| 190 | 3300006173 | Ga0070716_100029819 | Ga0070716_1000298194 | 171 |
| 191 | 3300006195 | Ga0075366_10031023 | Ga0075366_100310233 | 171 |
| 192 | 3300006931 | Ga0097620_100003147 | Ga0097620_10000314710 | 171 |
| 193 | 3300007076 | Ga0075435_100764292 | Ga0075435_1007642922 | 171 |
| 194 | 3300009093 | Ga0105240_10002112 | Ga0105240_1000211225 | 171 |
| 195 | 3300009551 | Ga0105238_10008963 | Ga0105238_100089639 | 171 |
| 196 | 3300013307 | Ga0157372_11297766 | Ga0157372_112977661 | 171 |
| 197 | 3300014325 | Ga0163163_11058690 | Ga0163163_110586902 | 171 |
| 198 | 3300025245 | Ga0207425_1000001 | Ga0207425_1000001982 | 171 |
| 199 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001159 | 171 |
| 200 | 3300025290 | Ga0207673_1002141 | Ga0207673_10021413 | 171 |
| 201 | 3300025297 | Ga0209758_1000020 | Ga0209758_1000020294 | 171 |
| 202 | 3300025299 | Ga0209256_1000028 | Ga0209256_1000028266 | 171 |
| 203 | 3300025315 | Ga0207697_10000006 | Ga0207697_1000000677 | 171 |
| 204 | 3300025907 | Ga0207645_10000071 | Ga0207645_100000718 | 171 |
| 205 | 3300025909 | Ga0207705_10212912 | Ga0207705_102129122 | 171 |
| 206 | 3300025913 | Ga0207695_10001465 | Ga0207695_1000146524 | 171 |
| 207 | 3300025924 | Ga0207694_10136619 | Ga0207694_101366193 | 171 |
| 208 | 3300025926 | Ga0207659_10006115 | Ga0207659_100061153 | 171 |
| 209 | 3300025927 | Ga0207687_10476311 | Ga0207687_104763112 | 171 |
| 210 | 3300025929 | Ga0207664_10217176 | Ga0207664_102171763 | 171 |
| 211 | 3300025932 | Ga0207690_10374614 | Ga0207690_103746141 | 171 |
| 212 | 3300025933 | Ga0207706_10000835 | Ga0207706_100008359 | 171 |
| 213 | 3300025936 | Ga0207670_10044042 | Ga0207670_100440425 | 171 |
| 214 | 3300025939 | Ga0207665_10119941 | Ga0207665_101199414 | 171 |
| 215 | 3300025942 | Ga0207689_10173602 | Ga0207689_101736021 | 171 |
| 216 | 3300025949 | Ga0207667_10328707 | Ga0207667_103287072 | 171 |
| 217 | 3300025972 | Ga0207668_10124968 | Ga0207668_101249681 | 171 |
| 218 | 3300026023 | Ga0207677_10419623 | Ga0207677_104196231 | 171 |
| 219 | 3300026041 | Ga0207639_10086188 | Ga0207639_100861884 | 171 |
| 220 | 3300026118 | Ga0207675_100073107 | Ga0207675_1000731073 | 171 |
| 221 | 3300028380 | Ga0268265_10003396 | Ga0268265_100033961 | 171 |
| 222 | 3300028381 | Ga0268264_10025392 | Ga0268264_100253921 | 171 |
| 223 | 3300028800 | Ga0265338_10004975 | Ga0265338_100049753 | 171 |
| 224 | 3300031548 | Ga0307408_100114320 | Ga0307408_1001143201 | 171 |
| 225 | 3300032004 | Ga0307414_10018620 | Ga0307414_100186204 | 171 |
| 226 | 3300032005 | Ga0307411_10904787 | Ga0307411_109047872 | 171 |
| 227 | 3300044658 | Ga0466972_0011932 | Ga0466972_0011932_3540_4067 | 171 |
| 228 | 3300044683 | Ga0466965_0053727 | Ga0466965_0053727_1156_1683 | 171 |
| 229 | 3300047318 | Ga0495636_0002166 | Ga0495636_0002166_1140_1655 | 171 |
| 230 | 3300047318 | Ga0495636_0239523 | Ga0495636_0239523_58_573 | 171 |
| 231 | 3300049775 | Ga0501279_004139 | Ga0501279_004139_500_1015 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hiy-assembly1.cif.gz_A | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.7076 | 1 | 169 |
| 2hiy-assembly1.cif.gz_A | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.7004 | 1 | 169 |
| 2hiy-assembly1.cif.gz_B | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.6873 | 2 | 169 |
| 2rsq-assembly1.cif.gz_A | copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs | 0.678 | 2 | 75 |
| 2hiy-assembly1.cif.gz_B | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.6764 | 2 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06552_36_123_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.9079 | 2 | 83 | 3.30.70.1280 |
| af_O06552_36_123_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.8413 | 2 | 83 | 3.30.70.1280 |
| af_Q54D49_1_88_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.8402 | 2 | 83 | 3.30.70.1280 |
| 2hiyB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.7845 | 1 | 84 | 3.30.70.1280 |
| af_Q54D49_1_88_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.7813 | 2 | 83 | 3.30.70.1280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9LB56-F1-model_v4 | Uncharacterized protein | 0.984 | 2 | 170 |
GO:0004560
GO:0005975 |
| AF-A0A1I4TFT3-F1-model_v4 | Uncharacterized conserved protein, DUF1697 family | 0.9816 | 1 | 170 |
|
| AF-A0A2V7REZ7-F1-model_v4 | DUF1697 domain-containing protein | 0.9771 | 1 | 94 |
|
| AF-A0A2V7GUE3-F1-model_v4 | DUF1697 domain-containing protein | 0.9761 | 1 | 170 |
|
| AF-A0A1I4TFT3-F1-model_v4 | Uncharacterized conserved protein, DUF1697 family | 0.9759 | 1 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar