F343803

General Info

Members Datasets Scaffolds Average Seq Length
231 161 231 156

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100098217|Ga0070708_1000982172
Length 186
Sequence LPAGFRRTPGRSPDVLSVGVASERLSTLVAVVGGEELRELMRRFPAGVAIVGVDLEGERLGLTIGTLIPLSLEPPLVGFAVRRGAALHELLRRSGAFGVSLLAAGQEAVAQHFARGVPPIALWEGIEVREGAGPPLVVGAIGWLTGRVSAELPAGEDTFFVGEVLSVEEGARERPLVYVDQRYVNA

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
95 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
98 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
99 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.93
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c006348 3300000044 Bacteria 994
2 Ga0070676_10551767 3300005328 Bacteria 825
3 Ga0070683_100053795 3300005329 Bacteria 3731
4 Ga0070683_100098496 3300005329 Bacteria 2752
5 Ga0070683_100388019 3300005329 Bacteria 1331
6 Ga0070687_100876327 3300005343 Bacteria 642
7 Ga0070692_10758921 3300005345 Bacteria 658
8 Ga0070668_100834018 3300005347 Archaea 821
9 Ga0070709_10533917 3300005434 Archaea 895
10 Ga0070713_101546540 3300005436 Bacteria 644
11 Ga0070710_10284758 3300005437 Unclassified 1073
12 Ga0070711_100230561 3300005439 Bacteria 1443
13 Ga0070711_101006453 3300005439 Unclassified 715
14 Ga0070694_100129281 3300005444 Unclassified 1823
15 Ga0070694_100436078 3300005444 Unclassified 1032
16 Ga0070708_100098217 3300005445 Bacteria 2678
17 Ga0070678_100201195 3300005456 Bacteria 1644
18 Ga0070685_10123263 3300005466 Bacteria 1612
19 Ga0070685_11026799 3300005466 Bacteria 620
20 Ga0070706_100312500 3300005467 Unclassified 1466
21 Ga0070706_100312916 3300005467 Bacteria 1465
22 Ga0070707_100171911 3300005468 Bacteria 2111
23 Ga0070698_100019108 3300005471 Bacteria 7202
24 Ga0070699_100169071 3300005518 Archaea 1937
25 Ga0070699_100180947 3300005518 Bacteria 1871
26 Ga0070684_100039675 3300005535 Bacteria 4052
27 Ga0070684_100123005 3300005535 Bacteria 2335
28 Ga0070684_100286968 3300005535 Unclassified 1508
29 Ga0070684_100515637 3300005535 Bacteria 1108
30 Ga0070697_100086453 3300005536 Bacteria 2587
31 Ga0070697_100304235 3300005536 Unclassified 1371
32 Ga0070695_101014336 3300005545 Archaea 675
33 Ga0070696_100687970 3300005546 Unclassified 832
34 Ga0070704_100584705 3300005549 Bacteria 979
35 Ga0070664_100148422 3300005564 Unclassified 2069
36 Ga0070664_100377025 3300005564 Bacteria 1294
37 Ga0068857_100098439 3300005577 Bacteria 2623
38 Ga0068857_101100411 3300005577 Bacteria 767
39 Ga0068866_10591440 3300005718 Bacteria 748
40 Ga0068861_100694619 3300005719 Bacteria 945
41 Ga0068870_10081418 3300005840 Bacteria 1791
42 Ga0081538_10063231 3300005981 Bacteria 2103
43 Ga0081538_10124639 3300005981 Unclassified 1228
44 Ga0070717_10483741 3300006028 Unclassified 1118
45 Ga0070715_10358169 3300006163 Unclassified 799
46 Ga0070716_100077089 3300006173 Bacteria 1977
47 Ga0070716_100312582 3300006173 Bacteria 1097
48 Ga0070712_100039294 3300006175 Bacteria 3238
49 Ga0070712_100304699 3300006175 Bacteria 1290
50 Ga0070712_100457787 3300006175 Bacteria 1063
51 Ga0097621_100270624 3300006237 Bacteria 1493
52 Ga0068871_100563544 3300006358 Bacteria 1033
53 Ga0075433_10084424 3300006852 Bacteria 2803
54 Ga0075433_10184366 3300006852 Bacteria 1857
55 Ga0075434_100025872 3300006871 Bacteria 5744
56 Ga0075434_100040715 3300006871 Bacteria 4602
57 Ga0068865_100032832 3300006881 Bacteria 3472
58 Ga0075436_100017429 3300006914 Bacteria 4917
59 Ga0075436_100090247 3300006914 Bacteria 2130
60 Ga0075435_100024395 3300007076 Bacteria 4693
61 Ga0075435_100223413 3300007076 Bacteria 1599
62 Ga0075435_100439525 3300007076 Bacteria 1124
63 Ga0105240_10452656 3300009093 Unclassified 1436
64 Ga0111539_10534118 3300009094 Bacteria 1366
65 Ga0111539_10687983 3300009094 Unclassified 1190
66 Ga0111539_12699301 3300009094 Bacteria 576
67 Ga0114129_10227310 3300009147 Bacteria 2514
68 Ga0114129_10301774 3300009147 Unclassified 2134
69 Ga0105243_10209458 3300009148 Bacteria 1716
70 Ga0105242_10126459 3300009176 Bacteria 2200
71 Ga0105249_12777898 3300009553 Bacteria 561
72 Ga0157378_10512672 3300013297 Unclassified 1200
73 Ga0157375_10637713 3300013308 Bacteria 1222
74 Ga0163163_10301483 3300014325 Unclassified 1655
75 Ga0182008_10378880 3300014497 Bacteria 756
76 Ga0157377_10022607 3300014745 Bacteria 3323
77 Ga0157376_10136517 3300014969 Bacteria 2195
78 Ga0157376_10821271 3300014969 Bacteria 943
79 Ga0207653_10209434 3300025885 Bacteria 737
80 Ga0207642_10478028 3300025899 Bacteria 759
81 Ga0207685_10279518 3300025905 Bacteria 818
82 Ga0207685_10529638 3300025905 Bacteria 624
83 Ga0207699_10424263 3300025906 Unclassified 950
84 Ga0207684_10087213 3300025910 Bacteria 2659
85 Ga0207684_10279094 3300025910 Bacteria 1441
86 Ga0207684_10335976 3300025910 Unclassified 1301
87 Ga0207684_10372543 3300025910 Bacteria 1228
88 Ga0207684_10459677 3300025910 Archaea 1093
89 Ga0207693_10004848 3300025915 Bacteria 11321
90 Ga0207693_10009876 3300025915 Bacteria 7763
91 Ga0207693_10325999 3300025915 Bacteria 1202
92 Ga0207693_10990305 3300025915 Bacteria 642
93 Ga0207663_10127563 3300025916 Bacteria 1752
94 Ga0207663_10621852 3300025916 Unclassified 850
95 Ga0207663_10676273 3300025916 Unclassified 816
96 Ga0207663_10961590 3300025916 Bacteria 684
97 Ga0207662_10169927 3300025918 Unclassified 1397
98 Ga0207646_10034691 3300025922 Bacteria 4560
99 Ga0207646_10397719 3300025922 Bacteria 1244
100 Ga0207687_10681722 3300025927 Bacteria 871
101 Ga0207664_10202266 3300025929 Bacteria 1715
102 Ga0207644_10599329 3300025931 Bacteria 915
103 Ga0207706_10403127 3300025933 Bacteria 1186
104 Ga0207706_11039263 3300025933 Bacteria 687
105 Ga0207709_10291322 3300025935 Bacteria 1210
106 Ga0207665_10041267 3300025939 Unclassified 3080
107 Ga0207665_10057293 3300025939 Bacteria 2632
108 Ga0207665_10066996 3300025939 Archaea 2444
109 Ga0207665_10450957 3300025939 Bacteria 987
110 Ga0207661_10761218 3300025944 Unclassified 891
111 Ga0207679_10291142 3300025945 Bacteria 1404
112 Ga0207679_11373002 3300025945 Bacteria 648
113 Ga0207667_10572804 3300025949 Bacteria 1140
114 Ga0207668_10035721 3300025972 Bacteria 3312
115 Ga0207677_10182345 3300026023 Unclassified 1652
116 Ga0207708_11034262 3300026075 Unclassified 714
117 Ga0207702_10118059 3300026078 Bacteria 2370
118 Ga0207702_10338734 3300026078 Bacteria 1436
119 Ga0207648_10236604 3300026089 Bacteria 1625
120 Ga0207674_10060815 3300026116 Bacteria 3819
121 Ga0207674_10097822 3300026116 Bacteria 2918
122 Ga0207683_10296081 3300026121 Bacteria 1480
123 Ga0265318_10284345 3300028577 Bacteria 603
124 Ga0265338_10029168 3300028800 Bacteria 5479
125 Ga0265340_10028975 3300031247 Bacteria 2782
126 Ga0265313_10038323 3300031595 Bacteria 2388
127 Ga0265342_10156943 3300031712 Bacteria 1260
128 Ga0307407_10137892 3300031903 Unclassified 1570
129 Ga0307412_10616890 3300031911 Bacteria 921
130 Ga0307416_101402968 3300032002 Bacteria 804
131 Ga0373943_0003823 3300035170 Bacteria 6842
132 Ga0373946_0174718 3300035171 Bacteria 1016
133 Ga0373947_0017608 3300035725 Bacteria 4110
134 Ga0395899_0086984 3300037312 Bacteria 2269
135 Ga0395900_0004531 3300037418 Bacteria 14705
136 Ga0395900_0007539 3300037418 Bacteria 11239
137 Ga0395900_0217108 3300037418 Bacteria 1929
138 Ga0395898_0003467 3300037466 Bacteria 17616
139 Ga0395898_0003715 3300037466 Bacteria 16932
140 Ga0395898_0085434 3300037466 Bacteria 3041
141 Ga0395898_0904385 3300037466 Bacteria 821
142 Ga0395905_0036311 3300037471 Bacteria 4627
143 Ga0395905_0037087 3300037471 Bacteria 4578
144 Ga0395905_0048340 3300037471 Bacteria 3987
145 Ga0395905_0347230 3300037471 Unclassified 1375
146 Ga0395905_0525282 3300037471 Bacteria 1084
147 Ga0395901_0000376 3300038443 Bacteria 53640
148 Ga0395901_0005500 3300038443 Bacteria 12835
149 Ga0395901_0114289 3300038443 Bacteria 2835
150 Ga0395901_0149808 3300038443 Bacteria 2452
151 Ga0439461_0010858 3300041410 Bacteria 1680
152 Ga0439466_0135358 3300041411 Bacteria 757
153 Ga0451853_3194870 3300041512 Unclassified 748
154 Ga0439441_020105 3300042001 Bacteria 1220
155 Ga0450920_075957 3300042122 Bacteria 686
156 Ga0450900_030125 3300042136 Bacteria 786
157 Ga0439446_0000692 3300042156 Bacteria 7022
158 Ga0439434_0087082 3300042435 Bacteria 996
159 Ga0466972_0349262 3300044658 Bacteria 692
160 Ga0466965_0639355 3300044683 Bacteria 607
161 Ga0466963_0063381 3300044694 Bacteria 2474
162 Ga0466960_0004691 3300044901 Bacteria 5362
163 Ga0466960_0294064 3300044901 Bacteria 913
164 Ga0466960_0465772 3300044901 Bacteria 736
165 Ga0495603_0012586 3300046455 Bacteria 5119
166 Ga0495641_0017055 3300046461 Bacteria 3798
167 Ga0495651_0249511 3300046462 Bacteria 1213
168 Ga0495653_0185486 3300046463 Bacteria 1424
169 Ga0495582_0004806 3300046473 Bacteria 7581
170 Ga0495584_0455404 3300046491 Bacteria 651
171 Ga0495594_0005319 3300046499 Bacteria 6612
172 Ga0495628_0295493 3300046516 Bacteria 1200
173 Ga0495665_0238921 3300046531 Bacteria 937
174 Ga0495609_0264673 3300046538 Unclassified 706
175 Ga0495667_0923994 3300046559 Bacteria 534
176 Ga0495588_0022655 3300046674 Bacteria 3105
177 Ga0495676_0011073 3300047321 Bacteria 8152
178 Ga0496102_0162509 3300048905 Bacteria 2101
179 Ga0496103_0284430 3300048906 Bacteria 1064
180 Ga0496106_0105282 3300048909 Bacteria 2192
181 Ga0496107_0166757 3300048910 Archaea 1633
182 Ga0496108_0118350 3300048911 Bacteria 2271
183 Ga0496108_0280656 3300048911 Bacteria 1450
184 Ga0496109_0028614 3300048912 Bacteria 4985
185 Ga0496109_0363252 3300048912 Bacteria 1368
186 Ga0496110_0030008 3300048913 Bacteria 4685
187 Ga0496110_0069761 3300048913 Bacteria 3113
188 Ga0496110_0126943 3300048913 Bacteria 2302
189 Ga0496111_0567328 3300048914 Bacteria 832
190 Ga0496111_0641541 3300048914 Unclassified 775
191 Ga0496112_0854505 3300048915 Bacteria 833
192 Ga0496113_0056160 3300048916 Bacteria 2955
193 Ga0496113_1240084 3300048916 Bacteria 581
194 Ga0501033_0165670 3300049570 Bacteria 1589
195 Ga0501036_0008854 3300049572 Bacteria 8262
196 Ga0501040_0100507 3300049576 Bacteria 2016
197 Ga0501041_0018025 3300049577 Bacteria 4203
198 Ga0501042_0142573 3300049578 Bacteria 1727
199 Ga0501043_0341529 3300049579 Bacteria 1139
200 Ga0501046_0101922 3300049580 Bacteria 2201
201 Ga0501048_0045861 3300049582 Bacteria 3120
202 Ga0501067_0013630 3300049583 Bacteria 4500
203 Ga0501069_0020581 3300049585 Bacteria 3575
204 Ga0501069_0124770 3300049585 Bacteria 1472
205 Ga0501070_0085415 3300049586 Bacteria 2613
206 Ga0501070_0110754 3300049586 Bacteria 2269
207 Ga0501071_0181034 3300049587 Bacteria 1579
208 Ga0501072_0023928 3300049588 Bacteria 4747
209 Ga0501074_0406536 3300049590 Bacteria 965
210 Ga0501075_0522963 3300049591 Bacteria 905
211 Ga0501076_0136488 3300049592 Bacteria 1991
212 Ga0501077_0069575 3300049593 Bacteria 2230
213 Ga0501079_0149516 3300049741 Bacteria 1820
214 Ga0501080_0046229 3300049742 Bacteria 4054
215 Ga0501081_0357845 3300049743 Bacteria 1076
216 Ga0501035_0065039 3300049822 Bacteria 3240
217 Ga0501045_0021180 3300049824 Bacteria 4648
218 nmdc:mga05p37_174070_c1 3300050507 Bacteria 2623
219 nmdc:mga05p37_728781_c1 3300050507 Bacteria 1097
220 nmdc:mga09592_251899_c1 3300050508 Bacteria 1530
221 nmdc:mga08y16_243364_c1 3300050511 Bacteria 1859
222 nmdc:mga08y16_598588_c1 3300050511 Bacteria 1111
223 nmdc:mga0n895_67362_c1 3300050512 Bacteria 3546
224 nmdc:mga0rr50_36133_c1 3300050513 Bacteria 3555
225 nmdc:mga08x19_138523_c1 3300050514 Bacteria 1642
226 nmdc:mga0a205_16882_c1 3300050515 Bacteria 6833
227 Ga0501084_0109891 3300054114 Bacteria 2316
228 Ga0590077_078370 3300059426 Bacteria 759
229 Ga0501082_0020772 3300060353 Bacteria 5662
230 Ga0530510_0043312 3300061734 Bacteria 3251
231 Ga0530510_0245227 3300061734 Unclassified 1334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0162509 Ga0496102_0162509_28_411 125
2 3300025933 Ga0207706_11039263 Ga0207706_110392632 126
3 3300006852 Ga0075433_10184366 Ga0075433_101843662 131
4 3300006871 Ga0075434_100025872 Ga0075434_1000258723 131
5 3300006914 Ga0075436_100090247 Ga0075436_1000902473 131
6 3300007076 Ga0075435_100024395 Ga0075435_1000243954 131
7 3300009147 Ga0114129_10227310 Ga0114129_102273102 131
8 3300050507 nmdc:mga05p37_174070_c1 nmdc:mga05p37_174070_c1_1705_2172 131
9 3300050512 nmdc:mga0n895_67362_c1 nmdc:mga0n895_67362_c1_1950_2417 131
10 3300050513 nmdc:mga0rr50_36133_c1 nmdc:mga0rr50_36133_c1_1960_2427 131
11 3300050514 nmdc:mga08x19_138523_c1 nmdc:mga08x19_138523_c1_1042_1509 131
12 3300050515 nmdc:mga0a205_16882_c1 nmdc:mga0a205_16882_c1_4438_4905 131
13 3300005981 Ga0081538_10063231 Ga0081538_100632313 137
14 3300005329 Ga0070683_100053795 Ga0070683_1000537953 144
15 3300005329 Ga0070683_100098496 Ga0070683_1000984962 144
16 3300005456 Ga0070678_100201195 Ga0070678_1002011951 144
17 3300005466 Ga0070685_11026799 Ga0070685_110267991 144
18 3300005535 Ga0070684_100039675 Ga0070684_1000396754 144
19 3300005535 Ga0070684_100286968 Ga0070684_1002869682 144
20 3300005564 Ga0070664_100148422 Ga0070664_1001484222 144
21 3300005577 Ga0068857_100098439 Ga0068857_1000984392 144
22 3300005718 Ga0068866_10591440 Ga0068866_105914402 144
23 3300005840 Ga0068870_10081418 Ga0068870_100814182 144
24 3300006881 Ga0068865_100032832 Ga0068865_1000328324 144
25 3300009094 Ga0111539_10687983 Ga0111539_106879832 144
26 3300009176 Ga0105242_10126459 Ga0105242_101264593 144
27 3300014325 Ga0163163_10301483 Ga0163163_103014832 144
28 3300014969 Ga0157376_10136517 Ga0157376_101365172 144
29 3300025899 Ga0207642_10478028 Ga0207642_104780281 144
30 3300025944 Ga0207661_10761218 Ga0207661_107612182 144
31 3300026075 Ga0207708_11034262 Ga0207708_110342622 144
32 3300026116 Ga0207674_10060815 Ga0207674_100608151 144
33 3300026116 Ga0207674_10097822 Ga0207674_100978223 144
34 3300026121 Ga0207683_10296081 Ga0207683_102960812 144
35 3300041410 Ga0439461_0010858 Ga0439461_0010858_1016_1480 144
36 3300041411 Ga0439466_0135358 Ga0439466_0135358_124_588 144
37 3300042156 Ga0439446_0000692 Ga0439446_0000692_3586_4050 144
38 3300042435 Ga0439434_0087082 Ga0439434_0087082_250_714 144
39 3300048914 Ga0496111_0641541 Ga0496111_0641541_162_626 144
40 3300050511 nmdc:mga08y16_243364_c1 nmdc:mga08y16_243364_c1_1207_1671 144
41 3300028577 Ga0265318_10284345 Ga0265318_102843452 145
42 3300028800 Ga0265338_10029168 Ga0265338_100291686 145
43 3300031247 Ga0265340_10028975 Ga0265340_100289752 145
44 3300031595 Ga0265313_10038323 Ga0265313_100383233 145
45 3300031712 Ga0265342_10156943 Ga0265342_101569431 145
46 3300035170 Ga0373943_0003823 Ga0373943_0003823_3764_4237 145
47 3300035171 Ga0373946_0174718 Ga0373946_0174718_130_603 145
48 3300035725 Ga0373947_0017608 Ga0373947_0017608_139_612 145
49 3300046455 Ga0495603_0012586 Ga0495603_0012586_4307_4780 145
50 3300046461 Ga0495641_0017055 Ga0495641_0017055_2902_3375 145
51 3300046473 Ga0495582_0004806 Ga0495582_0004806_5326_5799 145
52 3300046499 Ga0495594_0005319 Ga0495594_0005319_3397_3870 145
53 3300046531 Ga0495665_0238921 Ga0495665_0238921_74_547 145
54 3300046674 Ga0495588_0022655 Ga0495588_0022655_2277_2750 145
55 3300047321 Ga0495676_0011073 Ga0495676_0011073_189_662 145
56 3300048915 Ga0496112_0854505 Ga0496112_0854505_158_655 145
57 3300000044 ARSoilOldRDRAFT_c006348 ARSoilOldRDRAFT_0063482 146
58 3300005328 Ga0070676_10551767 Ga0070676_105517672 146
59 3300005329 Ga0070683_100388019 Ga0070683_1003880192 146
60 3300005343 Ga0070687_100876327 Ga0070687_1008763272 146
61 3300005345 Ga0070692_10758921 Ga0070692_107589211 146
62 3300005347 Ga0070668_100834018 Ga0070668_1008340182 146
63 3300005434 Ga0070709_10533917 Ga0070709_105339171 146
64 3300005436 Ga0070713_101546540 Ga0070713_1015465401 146
65 3300005437 Ga0070710_10284758 Ga0070710_102847582 146
66 3300005439 Ga0070711_100230561 Ga0070711_1002305611 146
67 3300005439 Ga0070711_101006453 Ga0070711_1010064531 146
68 3300005444 Ga0070694_100129281 Ga0070694_1001292812 146
69 3300005444 Ga0070694_100436078 Ga0070694_1004360782 146
70 3300005445 Ga0070708_100098217 Ga0070708_1000982172 146
71 3300005466 Ga0070685_10123263 Ga0070685_101232633 146
72 3300005467 Ga0070706_100312500 Ga0070706_1003125001 146
73 3300005467 Ga0070706_100312916 Ga0070706_1003129161 146
74 3300005468 Ga0070707_100171911 Ga0070707_1001719112 146
75 3300005471 Ga0070698_100019108 Ga0070698_1000191085 146
76 3300005518 Ga0070699_100169071 Ga0070699_1001690711 146
77 3300005518 Ga0070699_100180947 Ga0070699_1001809472 146
78 3300005535 Ga0070684_100123005 Ga0070684_1001230051 146
79 3300005535 Ga0070684_100515637 Ga0070684_1005156372 146
80 3300005536 Ga0070697_100086453 Ga0070697_1000864533 146
81 3300005536 Ga0070697_100304235 Ga0070697_1003042351 146
82 3300005545 Ga0070695_101014336 Ga0070695_1010143361 146
83 3300005546 Ga0070696_100687970 Ga0070696_1006879701 146
84 3300005549 Ga0070704_100584705 Ga0070704_1005847052 146
85 3300005564 Ga0070664_100377025 Ga0070664_1003770252 146
86 3300005577 Ga0068857_101100411 Ga0068857_1011004111 146
87 3300005719 Ga0068861_100694619 Ga0068861_1006946192 146
88 3300005981 Ga0081538_10124639 Ga0081538_101246392 146
89 3300006028 Ga0070717_10483741 Ga0070717_104837412 146
90 3300006163 Ga0070715_10358169 Ga0070715_103581691 146
91 3300006173 Ga0070716_100077089 Ga0070716_1000770893 146
92 3300006173 Ga0070716_100312582 Ga0070716_1003125822 146
93 3300006175 Ga0070712_100039294 Ga0070712_1000392945 146
94 3300006175 Ga0070712_100304699 Ga0070712_1003046992 146
95 3300006175 Ga0070712_100457787 Ga0070712_1004577872 146
96 3300006237 Ga0097621_100270624 Ga0097621_1002706242 146
97 3300006358 Ga0068871_100563544 Ga0068871_1005635442 146
98 3300006852 Ga0075433_10084424 Ga0075433_100844242 146
99 3300006871 Ga0075434_100040715 Ga0075434_1000407152 146
100 3300006914 Ga0075436_100017429 Ga0075436_1000174294 146
101 3300007076 Ga0075435_100223413 Ga0075435_1002234131 146
102 3300007076 Ga0075435_100439525 Ga0075435_1004395252 146
103 3300009093 Ga0105240_10452656 Ga0105240_104526562 146
104 3300009094 Ga0111539_10534118 Ga0111539_105341183 146
105 3300009094 Ga0111539_12699301 Ga0111539_126993011 146
106 3300009147 Ga0114129_10301774 Ga0114129_103017742 146
107 3300009148 Ga0105243_10209458 Ga0105243_102094582 146
108 3300009553 Ga0105249_12777898 Ga0105249_127778982 146
109 3300013297 Ga0157378_10512672 Ga0157378_105126722 146
110 3300013308 Ga0157375_10637713 Ga0157375_106377132 146
111 3300014497 Ga0182008_10378880 Ga0182008_103788802 146
112 3300014745 Ga0157377_10022607 Ga0157377_100226073 146
113 3300014969 Ga0157376_10821271 Ga0157376_108212712 146
114 3300025885 Ga0207653_10209434 Ga0207653_102094342 146
115 3300025905 Ga0207685_10279518 Ga0207685_102795182 146
116 3300025905 Ga0207685_10529638 Ga0207685_105296381 146
117 3300025906 Ga0207699_10424263 Ga0207699_104242632 146
118 3300025910 Ga0207684_10087213 Ga0207684_100872133 146
119 3300025910 Ga0207684_10279094 Ga0207684_102790942 146
120 3300025910 Ga0207684_10335976 Ga0207684_103359762 146
121 3300025910 Ga0207684_10372543 Ga0207684_103725432 146
122 3300025910 Ga0207684_10459677 Ga0207684_104596772 146
123 3300025915 Ga0207693_10004848 Ga0207693_1000484810 146
124 3300025915 Ga0207693_10009876 Ga0207693_100098762 146
125 3300025915 Ga0207693_10325999 Ga0207693_103259992 146
126 3300025915 Ga0207693_10990305 Ga0207693_109903052 146
127 3300025916 Ga0207663_10127563 Ga0207663_101275633 146
128 3300025916 Ga0207663_10621852 Ga0207663_106218522 146
129 3300025916 Ga0207663_10676273 Ga0207663_106762731 146
130 3300025916 Ga0207663_10961590 Ga0207663_109615901 146
131 3300025918 Ga0207662_10169927 Ga0207662_101699272 146
132 3300025922 Ga0207646_10034691 Ga0207646_100346916 146
133 3300025922 Ga0207646_10397719 Ga0207646_103977192 146
134 3300025927 Ga0207687_10681722 Ga0207687_106817222 146
135 3300025929 Ga0207664_10202266 Ga0207664_102022663 146
136 3300025931 Ga0207644_10599329 Ga0207644_105993292 146
137 3300025933 Ga0207706_10403127 Ga0207706_104031272 146
138 3300025935 Ga0207709_10291322 Ga0207709_102913222 146
139 3300025939 Ga0207665_10041267 Ga0207665_100412672 146
140 3300025939 Ga0207665_10057293 Ga0207665_100572934 146
141 3300025939 Ga0207665_10066996 Ga0207665_100669962 146
142 3300025939 Ga0207665_10450957 Ga0207665_104509572 146
143 3300025945 Ga0207679_10291142 Ga0207679_102911423 146
144 3300025945 Ga0207679_11373002 Ga0207679_113730021 146
145 3300025949 Ga0207667_10572804 Ga0207667_105728042 146
146 3300025972 Ga0207668_10035721 Ga0207668_100357212 146
147 3300026023 Ga0207677_10182345 Ga0207677_101823452 146
148 3300026078 Ga0207702_10118059 Ga0207702_101180593 146
149 3300026078 Ga0207702_10338734 Ga0207702_103387342 146
150 3300026089 Ga0207648_10236604 Ga0207648_102366042 146
151 3300031903 Ga0307407_10137892 Ga0307407_101378922 146
152 3300031911 Ga0307412_10616890 Ga0307412_106168902 146
153 3300032002 Ga0307416_101402968 Ga0307416_1014029681 146
154 3300037312 Ga0395899_0086984 Ga0395899_0086984_1744_2211 146
155 3300037418 Ga0395900_0004531 Ga0395900_0004531_4088_4576 146
156 3300037418 Ga0395900_0007539 Ga0395900_0007539_76_549 146
157 3300037418 Ga0395900_0217108 Ga0395900_0217108_368_835 146
158 3300037466 Ga0395898_0003467 Ga0395898_0003467_14396_14884 146
159 3300037466 Ga0395898_0003715 Ga0395898_0003715_10303_10857 146
160 3300037466 Ga0395898_0085434 Ga0395898_0085434_518_988 146
161 3300037466 Ga0395898_0904385 Ga0395898_0904385_311_781 146
162 3300037471 Ga0395905_0036311 Ga0395905_0036311_1535_2023 146
163 3300037471 Ga0395905_0037087 Ga0395905_0037087_2962_3429 146
164 3300037471 Ga0395905_0048340 Ga0395905_0048340_1138_1692 146
165 3300037471 Ga0395905_0347230 Ga0395905_0347230_561_1031 146
166 3300037471 Ga0395905_0525282 Ga0395905_0525282_204_686 146
167 3300038443 Ga0395901_0000376 Ga0395901_0000376_19366_19920 146
168 3300038443 Ga0395901_0005500 Ga0395901_0005500_3494_3982 146
169 3300038443 Ga0395901_0114289 Ga0395901_0114289_1513_1980 146
170 3300038443 Ga0395901_0149808 Ga0395901_0149808_269_751 146
171 3300041512 Ga0451853_3194870 Ga0451853_3194870_196_666 146
172 3300042001 Ga0439441_020105 Ga0439441_020105_391_861 146
173 3300042122 Ga0450920_075957 Ga0450920_075957_82_552 146
174 3300042136 Ga0450900_030125 Ga0450900_030125_262_732 146
175 3300044658 Ga0466972_0349262 Ga0466972_0349262_107_580 146
176 3300044683 Ga0466965_0639355 Ga0466965_0639355_24_503 146
177 3300044694 Ga0466963_0063381 Ga0466963_0063381_402_881 146
178 3300044901 Ga0466960_0004691 Ga0466960_0004691_3828_4301 146
179 3300044901 Ga0466960_0294064 Ga0466960_0294064_122_595 146
180 3300044901 Ga0466960_0465772 Ga0466960_0465772_158_631 146
181 3300046462 Ga0495651_0249511 Ga0495651_0249511_138_578 146
182 3300046463 Ga0495653_0185486 Ga0495653_0185486_829_1269 146
183 3300046491 Ga0495584_0455404 Ga0495584_0455404_23_463 146
184 3300046516 Ga0495628_0295493 Ga0495628_0295493_380_820 146
185 3300046538 Ga0495609_0264673 Ga0495609_0264673_137_607 146
186 3300046559 Ga0495667_0923994 Ga0495667_0923994_22_462 146
187 3300048906 Ga0496103_0284430 Ga0496103_0284430_500_970 146
188 3300048909 Ga0496106_0105282 Ga0496106_0105282_1486_1956 146
189 3300048910 Ga0496107_0166757 Ga0496107_0166757_1048_1518 146
190 3300048911 Ga0496108_0118350 Ga0496108_0118350_631_1110 146
191 3300048911 Ga0496108_0280656 Ga0496108_0280656_551_1012 146
192 3300048912 Ga0496109_0028614 Ga0496109_0028614_355_909 146
193 3300048912 Ga0496109_0363252 Ga0496109_0363252_648_1118 146
194 3300048913 Ga0496110_0030008 Ga0496110_0030008_3308_3775 146
195 3300048913 Ga0496110_0069761 Ga0496110_0069761_2458_2928 146
196 3300048913 Ga0496110_0126943 Ga0496110_0126943_1658_2119 146
197 3300048914 Ga0496111_0567328 Ga0496111_0567328_14_493 146
198 3300048916 Ga0496113_0056160 Ga0496113_0056160_116_583 146
199 3300048916 Ga0496113_1240084 Ga0496113_1240084_13_492 146
200 3300049570 Ga0501033_0165670 Ga0501033_0165670_39_509 146
201 3300049572 Ga0501036_0008854 Ga0501036_0008854_2696_3166 146
202 3300049576 Ga0501040_0100507 Ga0501040_0100507_1138_1608 146
203 3300049577 Ga0501041_0018025 Ga0501041_0018025_1850_2320 146
204 3300049578 Ga0501042_0142573 Ga0501042_0142573_1159_1629 146
205 3300049579 Ga0501043_0341529 Ga0501043_0341529_387_857 146
206 3300049580 Ga0501046_0101922 Ga0501046_0101922_813_1283 146
207 3300049582 Ga0501048_0045861 Ga0501048_0045861_1874_2344 146
208 3300049583 Ga0501067_0013630 Ga0501067_0013630_224_694 146
209 3300049585 Ga0501069_0020581 Ga0501069_0020581_1995_2465 146
210 3300049585 Ga0501069_0124770 Ga0501069_0124770_783_1253 146
211 3300049586 Ga0501070_0085415 Ga0501070_0085415_396_866 146
212 3300049586 Ga0501070_0110754 Ga0501070_0110754_1270_1740 146
213 3300049587 Ga0501071_0181034 Ga0501071_0181034_375_845 146
214 3300049588 Ga0501072_0023928 Ga0501072_0023928_3347_3817 146
215 3300049590 Ga0501074_0406536 Ga0501074_0406536_157_627 146
216 3300049591 Ga0501075_0522963 Ga0501075_0522963_190_660 146
217 3300049592 Ga0501076_0136488 Ga0501076_0136488_450_920 146
218 3300049593 Ga0501077_0069575 Ga0501077_0069575_343_813 146
219 3300049741 Ga0501079_0149516 Ga0501079_0149516_271_741 146
220 3300049742 Ga0501080_0046229 Ga0501080_0046229_360_830 146
221 3300049743 Ga0501081_0357845 Ga0501081_0357845_527_997 146
222 3300049822 Ga0501035_0065039 Ga0501035_0065039_208_678 146
223 3300049824 Ga0501045_0021180 Ga0501045_0021180_3899_4369 146
224 3300050507 nmdc:mga05p37_728781_c1 nmdc:mga05p37_728781_c1_125_595 146
225 3300050508 nmdc:mga09592_251899_c1 nmdc:mga09592_251899_c1_597_1067 146
226 3300050511 nmdc:mga08y16_598588_c1 nmdc:mga08y16_598588_c1_618_1085 146
227 3300054114 Ga0501084_0109891 Ga0501084_0109891_368_838 146
228 3300059426 Ga0590077_078370 Ga0590077_078370_112_582 146
229 3300060353 Ga0501082_0020772 Ga0501082_0020772_5107_5577 146
230 3300061734 Ga0530510_0043312 Ga0530510_0043312_2303_2773 146
231 3300061734 Ga0530510_0245227 Ga0530510_0245227_357_827 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

41

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r0x-assembly1.cif.gz_A-2 crystal structure of a putative flavin reductase (ycdh, hs_1225) from haemophilus somnus 129pt at 1.06 a resolution 0.9311 6 146
2qck-assembly1.cif.gz_A crystal structure of flavin reductase domain protein (yp_831077.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.9224 6 146
4l82-assembly2.cif.gz_D structure of a putative oxidoreductase from rickettsia felis 0.9133 1 146
2ed4-assembly1.cif.gz_B crystal structure of flavin reductase hpac complexed with fad and nad 0.912 3 146
3cb0-assembly2.cif.gz_B cobr 0.9111 6 146
ID Description Score Start End Superfamily
2r0xA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9236 6 146 2.30.110.10
2qckA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9206 6 144 2.30.110.10
4l82C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9121 1 146 2.30.110.10
3k88A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.912 6 146 2.30.110.10
2ed4A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9093 3 146 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7V9I6N2-F1-model_v4 Flavin reductase family protein 0.98 16 146 GO:0010181
GO:0042602
AF-A0A7V9I6N2-F1-model_v4 Flavin reductase family protein 0.9727 16 146 GO:0010181
GO:0042602
AF-A0A538LFM2-F1-model_v4 Flavin reductase 0.9607 4 146 GO:0010181
GO:0042602
AF-A0A7W1RSV5-F1-model_v4 Flavin reductase 0.9607 4 146 GO:0010181
GO:0042602
AF-A0A401MVI8-F1-model_v4 NADH-FMN oxidoreductase 0.9574 6 146 GO:0010181
GO:0042602

Feature Viewer

pLDDT pTM Quality
89.99 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map