F343587

General Info

Members Datasets Scaffolds Average Seq Length
230 182 172 283

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056207758|8056209139
Length 311
Sequence LTATSFTGGAPGRGLGRGCGYVFPVDDQQAALLGPADVRRLAEELDIRPTKKLGQNFVHDPNTVRRIVSSASVTADDVVLEIGPGLGSLTLALLPAAGAVTAVEIDPVLAARLPRTAAEFAPGLADRLTVIEADALRVRAEDFPAPPTALVANLPYNVAVPVVLHLLAELPSLEHGLVMVQAEVADRMSAQPGSRVYGVPSVKAAWYADVRRAGPVPRKVFWPVPNVDSGLVSFRRVEPPSSARREDVFRVVDAAFAQRRKALRGALSGWAGSAARAEELLRAAGVDPMTRGEQLRVADFARIAELAAEDR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
12 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
13 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
14 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
15 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
16 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
17 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
18 2855683550 Micromonospora sp. RP3T Isolate Unclassified
19 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
20 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
21 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
22 2858868258 Micromonospora sp. MH33 Isolate Unclassified
23 2858882152 Micromonospora noduli MED15 Isolate Nodule
24 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
25 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
26 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
27 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
28 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
29 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
30 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
31 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
32 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
33 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
34 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
35 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
36 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
37 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
38 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
39 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
40 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
41 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
42 2902582711 Micromonospora sp. AP08 Isolate Unclassified
43 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
44 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
45 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
46 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
94 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 649633069 Micromonospora sp. L5 Isolate Unclassified
171 8002775197 Frankia nepalensis CN7 Isolate Nodule
172 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
173 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
174 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
175 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
176 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
177 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
178 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
179 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
180 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
181 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
182 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.35
Metatranscriptomes 0.43
Isolates 25.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 3.04
Rhizoplane 3.04
Rhizosphere 62.17
Stem 0
Stem Tuber 0
Unclassified 27.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001180 3300003203 Bacteria 12296
2 Ga0070658_10017928 3300005327 Bacteria 5662
3 Ga0070658_10181137 3300005327 Bacteria 1773
4 Ga0070683_100026810 3300005329 Bacteria 5193
5 Ga0070683_100070773 3300005329 Bacteria 3254
6 Ga0070683_100085621 3300005329 Bacteria 2955
7 Ga0070666_10276052 3300005335 Bacteria 1194
8 Ga0070680_100110721 3300005336 Bacteria 2286
9 Ga0070661_100022336 3300005344 Bacteria 4529
10 Ga0070692_10075192 3300005345 Bacteria 1808
11 Ga0070668_100088937 3300005347 Bacteria 2432
12 Ga0070667_100022268 3300005367 Bacteria 5257
13 Ga0070667_100285697 3300005367 Bacteria 1482
14 Ga0070667_100679544 3300005367 Bacteria 952
15 Ga0070710_10000680 3300005437 Bacteria 16127
16 Ga0070663_100181164 3300005455 Bacteria 1634
17 Ga0070684_100032594 3300005535 Bacteria 4441
18 Ga0070684_100066591 3300005535 Bacteria 3162
19 Ga0068863_100011299 3300005841 Bacteria 8647
20 Ga0068863_100033676 3300005841 Bacteria 4880
21 Ga0081539_10000906 3300005985 Bacteria 56296
22 Ga0081539_10000907 3300005985 Bacteria 56125
23 Ga0081539_10004344 3300005985 Bacteria 15802
24 Ga0081539_10020523 3300005985 Bacteria 4461
25 Ga0081539_10155489 3300005985 Bacteria 1096
26 Ga0070717_10239774 3300006028 Bacteria 1598
27 Ga0075365_10004983 3300006038 Bacteria 7112
28 Ga0075368_10003658 3300006042 Bacteria 5154
29 Ga0075363_100008247 3300006048 Bacteria 4841
30 Ga0075367_10039147 3300006178 Bacteria 2763
31 Ga0075428_100253466 3300006844 Bacteria 1896
32 Ga0075428_100268830 3300006844 Bacteria 1835
33 Ga0075430_100098791 3300006846 Bacteria 2438
34 Ga0075430_100141938 3300006846 Bacteria 2000
35 Ga0075431_100013729 3300006847 Bacteria 8182
36 Ga0075429_100024627 3300006880 Bacteria 5223
37 Ga0075429_100288713 3300006880 Bacteria 1436
38 Ga0114129_10000011 3300009147 Bacteria 139000
39 Ga0114129_10020786 3300009147 Bacteria 9328
40 Ga0105248_10000076 3300009177 Bacteria 114070
41 Ga0157369_10000901 3300013105 Bacteria 37938
42 Ga0157369_10034251 3300013105 Bacteria 5575
43 Ga0163163_10140616 3300014325 Bacteria 2456
44 Ga0157379_10001442 3300014968 Bacteria 19518
45 Ga0206356_10486987 3300020070 Bacteria 1929
46 Ga0207692_10015166 3300025898 Bacteria 3385
47 Ga0207688_10005737 3300025901 Bacteria 6753
48 Ga0207705_10142212 3300025909 Bacteria 1792
49 Ga0207660_10110526 3300025917 Bacteria 2068
50 Ga0207649_10011262 3300025920 Bacteria 4926
51 Ga0207681_10367401 3300025923 Bacteria 1155
52 Ga0207690_10202688 3300025932 Bacteria 1508
53 Ga0207711_10000604 3300025941 Bacteria 36283
54 Ga0207661_10020334 3300025944 Bacteria 4961
55 Ga0207661_10055455 3300025944 Bacteria 3179
56 Ga0207667_10161219 3300025949 Bacteria 2307
57 Ga0207658_10351385 3300025986 Bacteria 1284
58 Ga0207678_10449077 3300026067 Bacteria 1120
59 Ga0207641_10163262 3300026088 Bacteria 2027
60 Ga0207676_10022967 3300026095 Bacteria 4594
61 Ga0207676_10488913 3300026095 Bacteria 1167
62 Ga0209813_10003030 3300027866 Bacteria 3901
63 Ga0268264_10027465 3300028381 Bacteria 4651
64 Ga0307515_10000088 3300028794 Bacteria 215810
65 Ga0307515_10020466 3300028794 Bacteria 11801
66 Ga0307515_10119031 3300028794 Bacteria 3008
67 Ga0307515_10141644 3300028794 Bacteria 2574
68 Ga0307515_10291971 3300028794 Bacteria 1325
69 Ga0307512_10003816 3300030522 Bacteria 17006
70 Ga0307512_10041440 3300030522 Bacteria 3826
71 Ga0307512_10122644 3300030522 Bacteria 1662
72 Ga0316177_1012019 3300030731 Bacteria 3878
73 Ga0316176_1185349 3300030732 Bacteria 6221
74 Ga0314311_1019512 3300030733 Bacteria 17159
75 Ga0316180_1040525 3300030736 Bacteria 2677
76 Ga0307513_10004762 3300031456 Bacteria 18017
77 Ga0307513_10007863 3300031456 Bacteria 13749
78 Ga0307513_10041237 3300031456 Bacteria 5098
79 Ga0307513_10168019 3300031456 Bacteria 2075
80 Ga0307509_10014768 3300031507 Bacteria 9156
81 Ga0307509_10220051 3300031507 Bacteria 1713
82 Ga0307509_10230943 3300031507 Bacteria 1653
83 Ga0307508_10003391 3300031616 Bacteria 16152
84 Ga0307508_10004502 3300031616 Bacteria 13594
85 Ga0307508_10043964 3300031616 Bacteria 3999
86 Ga0307508_10140440 3300031616 Bacteria 2019
87 Ga0307516_10007558 3300031730 Bacteria 12466
88 Ga0307516_10084343 3300031730 Bacteria 3016
89 Ga0307405_10160871 3300031731 Bacteria 1590
90 Ga0307413_10061683 3300031824 Bacteria 2315
91 Ga0307413_10102499 3300031824 Bacteria 1895
92 Ga0307410_10085595 3300031852 Bacteria 2225
93 Ga0307410_10111150 3300031852 Bacteria 1983
94 Ga0307409_100031247 3300031995 Bacteria 3840
95 Ga0307416_101015180 3300032002 Bacteria 933
96 Ga0307415_100113672 3300032126 Bacteria 2014
97 Ga0307507_10022675 3300033179 Bacteria 6924
98 Ga0373940_0068365 3300035088 Bacteria 1029
99 Ga0373951_0000024 3300035091 Bacteria 60660
100 Ga0373960_0075843 3300035121 Bacteria 1049
101 Ga0373942_0000049 3300035207 Bacteria 23697
102 Ga0373962_0005447 3300035242 Bacteria 3081
103 Ga0373931_0030327 3300035691 Bacteria 2783
104 Ga0373935_0012457 3300035692 Bacteria 5115
105 Ga0395900_0018926 3300037418 Bacteria 7023
106 Ga0395900_0056431 3300037418 Bacteria 4043
107 Ga0395898_0034634 3300037466 Bacteria 5029
108 Ga0395905_0067880 3300037471 Bacteria 3340
109 Ga0395901_0022314 3300038443 Bacteria 6487
110 Ga0395901_0418507 3300038443 Bacteria 1374
111 Ga0451853_0840858 3300041512 Bacteria 3217
112 Ga0439449_0045726 3300042007 Bacteria 1622
113 Ga0466972_0001280 3300044658 Bacteria 12139
114 Ga0466972_0004720 3300044658 Bacteria 6823
115 Ga0466965_0000634 3300044683 Bacteria 12857
116 Ga0466965_0001241 3300044683 Bacteria 10103
117 Ga0466965_0033340 3300044683 Bacteria 2516
118 Ga0466963_0274418 3300044694 Bacteria 1185
119 Ga0466971_0072412 3300044719 Bacteria 1566
120 Ga0466968_0106236 3300044735 Bacteria 1258
121 Ga0466970_0013683 3300044765 Bacteria 4163
122 Ga0466970_0024179 3300044765 Bacteria 3176
123 Ga0466957_0018781 3300044842 Bacteria 4063
124 Ga0466958_0060323 3300045836 Bacteria 2309
125 Ga0466967_0356955 3300045976 Bacteria 1415
126 Ga0466967_0406715 3300045976 Bacteria 1325
127 Ga0495629_0081155 3300046459 Bacteria 2264
128 Ga0495641_0013289 3300046461 Bacteria 4534
129 Ga0495606_0002664 3300046507 Bacteria 20310
130 Ga0495618_0089270 3300046514 Bacteria 1971
131 Ga0495668_0000169 3300046616 Bacteria 97150
132 Ga0495625_0002610 3300046660 Bacteria 19286
133 Ga0495599_0067547 3300046678 Unclassified 2233
134 Ga0495646_0111410 3300046680 Unclassified 1558
135 Ga0495683_0047651 3300047323 Bacteria 2150
136 Ga0495626_0001289 3300048091 Bacteria 20450
137 Ga0496100_0007548 3300048903 Bacteria 6008
138 Ga0496101_0048048 3300048904 Bacteria 3065
139 Ga0496102_0000048 3300048905 Bacteria 179713
140 Ga0496103_0000018 3300048906 Bacteria 239585
141 Ga0496105_0231248 3300048908 Bacteria 1503
142 Ga0496108_0000019 3300048911 Bacteria 234657
143 Ga0496112_0077510 3300048915 Bacteria 3287
144 Ga0496116_0000197 3300048919 Bacteria 120256
145 Ga0496117_0000879 3300048920 Bacteria 46401
146 Ga0496118_0000172 3300048921 Bacteria 116150
147 Ga0496119_0004392 3300048922 Bacteria 14069
148 Ga0496120_0007630 3300048923 Bacteria 8017
149 Ga0496121_0030908 3300048924 Bacteria 4908
150 Ga0496124_0024542 3300048927 Bacteria 5478
151 Ga0496126_0000869 3300048929 Bacteria 53155
152 Ga0501034_0257844 3300049571 Bacteria 1687
153 Ga0501070_0002550 3300049586 Bacteria 15955
154 Ga0501074_0062067 3300049590 Bacteria 2692
155 Ga0501079_0006538 3300049741 Bacteria 8761
156 Ga0501080_0057199 3300049742 Bacteria 3631
157 Ga0501044_0130532 3300049823 Bacteria 2507
158 Ga0501044_0344904 3300049823 Bacteria 1410
159 nmdc:mga03n38_6139_c1 3300050490 Bacteria 4150
160 nmdc:mga05p37_1057_c1 3300050507 Bacteria 31447
161 nmdc:mga09592_110762_c1 3300050508 Bacteria 2355
162 nmdc:mga09592_33927_c1 3300050508 Bacteria 4265
163 nmdc:mga0qj67_134839_c1 3300050509 Bacteria 2000
164 nmdc:mga0qj67_58243_c1 3300050509 Bacteria 3063
165 nmdc:mga06r32_301730_c1 3300050510 Bacteria 1588
166 nmdc:mga06r32_365535_c1 3300050510 Bacteria 1426
167 nmdc:mga06r32_44_c4 3300050510 Bacteria 11694
168 nmdc:mga06r32_6728_c1 3300050510 Bacteria 10327
169 Ga0495601_0018471 3300053077 Bacteria 4245
170 Ga0500641_0009498 3300053096 Bacteria 3500
171 Ga0500652_088509 3300053131 Bacteria 1292
172 Ga0500577_0057586 3300053142 Bacteria 1484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10075192 Ga0070692_100751921 223
2 3300005455 Ga0070663_100181164 Ga0070663_1001811641 223
3 3300025901 Ga0207688_10005737 Ga0207688_100057372 223
4 3300005329 Ga0070683_100085621 Ga0070683_1000856212 224
5 3300005535 Ga0070684_100032594 Ga0070684_1000325942 224
6 3300025944 Ga0207661_10055455 Ga0207661_100554553 224
7 iso_pu_bacteria 8003830390 8003833873 226
8 3300049823 Ga0501044_0344904 Ga0501044_0344904_39_1205 228
9 3300046461 Ga0495641_0013289 Ga0495641_0013289_1092_1850 229
10 3300046514 Ga0495618_0089270 Ga0495618_0089270_538_1296 229
11 3300046678 Ga0495599_0067547 Ga0495599_0067547_979_1737 229
12 3300046680 Ga0495646_0111410 Ga0495646_0111410_428_1186 229
13 3300053077 Ga0495601_0018471 Ga0495601_0018471_650_1408 229
14 3300046507 Ga0495606_0002664 Ga0495606_0002664_13903_14760 234
15 3300046616 Ga0495668_0000169 Ga0495668_0000169_39290_40147 234
16 3300046660 Ga0495625_0002610 Ga0495625_0002610_13919_14776 234
17 3300047323 Ga0495683_0047651 Ga0495683_0047651_1099_1956 234
18 3300048091 Ga0495626_0001289 Ga0495626_0001289_5656_6513 234
19 3300033179 Ga0307507_10022675 Ga0307507_100226754 235
20 3300005367 Ga0070667_100285697 Ga0070667_1002856971 236
21 3300050510 nmdc:mga06r32_44_c4 nmdc:mga06r32_44_c4_4138_5079 236
22 3300025986 Ga0207658_10351385 Ga0207658_103513852 237
23 3300044765 Ga0466970_0024179 Ga0466970_0024179_1535_2437 237
24 3300049742 Ga0501080_0057199 Ga0501080_0057199_2138_2998 237
25 3300050510 nmdc:mga06r32_365535_c1 nmdc:mga06r32_365535_c1_493_1380 237
26 3300005329 Ga0070683_100026810 Ga0070683_1000268103 238
27 3300005535 Ga0070684_100066591 Ga0070684_1000665912 238
28 3300025944 Ga0207661_10020334 Ga0207661_100203344 238
29 3300026095 Ga0207676_10488913 Ga0207676_104889132 238
30 3300031456 Ga0307513_10004762 Ga0307513_100047629 239
31 3300013105 Ga0157369_10000901 Ga0157369_100009013 242
32 3300006844 Ga0075428_100253466 Ga0075428_1002534662 244
33 3300006846 Ga0075430_100141938 Ga0075430_1001419382 244
34 3300050509 nmdc:mga0qj67_134839_c1 nmdc:mga0qj67_134839_c1_452_1339 244
35 3300006880 Ga0075429_100288713 Ga0075429_1002887131 245
36 3300035088 Ga0373940_0068365 Ga0373940_0068365_79_921 247
37 3300048927 Ga0496124_0024542 Ga0496124_0024542_636_1592 247
38 3300049586 Ga0501070_0002550 Ga0501070_0002550_33_830 248
39 3300037418 Ga0395900_0056431 Ga0395900_0056431_1871_2725 249
40 3300005985 Ga0081539_10155489 Ga0081539_101554891 251
41 3300045976 Ga0466967_0356955 Ga0466967_0356955_316_1179 253
42 3300009147 Ga0114129_10000011 Ga0114129_1000001119 254
43 3300031616 Ga0307508_10043964 Ga0307508_100439644 254
44 3300050507 nmdc:mga05p37_1057_c1 nmdc:mga05p37_1057_c1_23714_24568 254
45 3300009177 Ga0105248_10000076 Ga0105248_1000007654 255
46 3300025941 Ga0207711_10000604 Ga0207711_1000060413 255
47 iso_pu_bacteria 2870782633 2870791167 255
48 3300030522 Ga0307512_10122644 Ga0307512_101226442 256
49 3300031852 Ga0307410_10085595 Ga0307410_100855953 257
50 iso_pu_bacteria 2751185782 2753270590 258
51 3300006847 Ga0075431_100013729 Ga0075431_1000137296 259
52 3300042007 Ga0439449_0045726 Ga0439449_0045726_201_1103 259
53 3300050510 nmdc:mga06r32_6728_c1 nmdc:mga06r32_6728_c1_1956_2789 259
54 3300006042 Ga0075368_10003658 Ga0075368_100036583 260
55 3300006048 Ga0075363_100008247 Ga0075363_1000082473 260
56 3300006178 Ga0075367_10039147 Ga0075367_100391472 260
57 3300027866 Ga0209813_10003030 Ga0209813_100030303 260
58 3300005437 Ga0070710_10000680 Ga0070710_1000068011 261
59 3300030731 Ga0316177_1012019 Ga0316177_10120193 261
60 3300030732 Ga0316176_1185349 Ga0316176_11853492 261
61 3300030733 Ga0314311_1019512 Ga0314311_10195129 261
62 3300030736 Ga0316180_1040525 Ga0316180_10405252 261
63 3300044658 Ga0466972_0001280 Ga0466972_0001280_7733_8572 261
64 3300044683 Ga0466965_0001241 Ga0466965_0001241_7587_8426 261
65 3300044683 Ga0466965_0033340 Ga0466965_0033340_144_983 261
66 3300044735 Ga0466968_0106236 Ga0466968_0106236_223_1062 261
67 3300005335 Ga0070666_10276052 Ga0070666_102760522 262
68 3300005367 Ga0070667_100022268 Ga0070667_1000222686 262
69 3300005367 Ga0070667_100679544 Ga0070667_1006795441 262
70 3300005841 Ga0068863_100033676 Ga0068863_1000336762 262
71 3300005985 Ga0081539_10000906 Ga0081539_100009067 262
72 3300005985 Ga0081539_10004344 Ga0081539_1000434411 262
73 3300005985 Ga0081539_10020523 Ga0081539_100205233 262
74 3300006028 Ga0070717_10239774 Ga0070717_102397742 262
75 3300026088 Ga0207641_10163262 Ga0207641_101632623 262
76 3300028381 Ga0268264_10027465 Ga0268264_100274653 262
77 3300028794 Ga0307515_10020466 Ga0307515_100204668 262
78 3300028794 Ga0307515_10141644 Ga0307515_101416443 262
79 3300030522 Ga0307512_10003816 Ga0307512_100038168 262
80 3300030522 Ga0307512_10041440 Ga0307512_100414401 262
81 3300031456 Ga0307513_10007863 Ga0307513_100078636 262
82 3300031507 Ga0307509_10014768 Ga0307509_100147684 262
83 3300031507 Ga0307509_10220051 Ga0307509_102200512 262
84 3300031616 Ga0307508_10003391 Ga0307508_100033918 262
85 3300031616 Ga0307508_10004502 Ga0307508_100045026 262
86 3300031616 Ga0307508_10140440 Ga0307508_101404403 262
87 3300031730 Ga0307516_10084343 Ga0307516_100843433 262
88 3300031731 Ga0307405_10160871 Ga0307405_101608712 262
89 3300031824 Ga0307413_10061683 Ga0307413_100616833 262
90 3300031824 Ga0307413_10102499 Ga0307413_101024992 262
91 3300031852 Ga0307410_10111150 Ga0307410_101111502 262
92 3300031995 Ga0307409_100031247 Ga0307409_1000312473 262
93 3300032126 Ga0307415_100113672 Ga0307415_1001136722 262
94 3300035121 Ga0373960_0075843 Ga0373960_0075843_78_980 262
95 3300035207 Ga0373942_0000049 Ga0373942_0000049_21461_22348 262
96 3300035242 Ga0373962_0005447 Ga0373962_0005447_116_961 262
97 3300035692 Ga0373935_0012457 Ga0373935_0012457_1673_2563 262
98 3300037418 Ga0395900_0018926 Ga0395900_0018926_73_960 262
99 3300038443 Ga0395901_0418507 Ga0395901_0418507_152_1039 262
100 3300041512 Ga0451853_0840858 Ga0451853_0840858_2073_2960 262
101 3300045976 Ga0466967_0406715 Ga0466967_0406715_138_1022 262
102 3300048911 Ga0496108_0000019 Ga0496108_0000019_127333_128220 262
103 3300053096 Ga0500641_0009498 Ga0500641_0009498_176_1063 262
104 3300053131 Ga0500652_088509 Ga0500652_088509_378_1265 262
105 3300053142 Ga0500577_0057586 Ga0500577_0057586_196_1083 262
106 3300005347 Ga0070668_100088937 Ga0070668_1000889372 263
107 3300005841 Ga0068863_100011299 Ga0068863_1000112995 263
108 3300014325 Ga0163163_10140616 Ga0163163_101406162 263
109 3300014968 Ga0157379_10001442 Ga0157379_100014422 263
110 3300026095 Ga0207676_10022967 Ga0207676_100229673 263
111 3300031456 Ga0307513_10041237 Ga0307513_100412372 263
112 3300044694 Ga0466963_0274418 Ga0466963_0274418_149_991 263
113 3300045836 Ga0466958_0060323 Ga0466958_0060323_244_1086 263
114 3300048903 Ga0496100_0007548 Ga0496100_0007548_2884_3738 263
115 3300048904 Ga0496101_0048048 Ga0496101_0048048_795_1649 263
116 3300048905 Ga0496102_0000048 Ga0496102_0000048_147294_148148 263
117 3300048906 Ga0496103_0000018 Ga0496103_0000018_173132_173986 263
118 3300048908 Ga0496105_0231248 Ga0496105_0231248_145_999 263
119 3300048919 Ga0496116_0000197 Ga0496116_0000197_87855_88709 263
120 3300048920 Ga0496117_0000879 Ga0496117_0000879_14004_14858 263
121 3300048921 Ga0496118_0000172 Ga0496118_0000172_65602_66456 263
122 3300048922 Ga0496119_0004392 Ga0496119_0004392_4632_5486 263
123 3300048923 Ga0496120_0007630 Ga0496120_0007630_2529_3383 263
124 3300048924 Ga0496121_0030908 Ga0496121_0030908_1650_2504 263
125 3300048929 Ga0496126_0000869 Ga0496126_0000869_49704_50558 263
126 iso_pu_bacteria 2501939600 2501944725 263
127 iso_pu_bacteria 2515154088 2515493854 263
128 iso_pu_bacteria 2515154129 2515720664 263
129 iso_pu_bacteria 2515154137 2515755245 263
130 iso_pu_bacteria 2515154202 2516085593 263
131 iso_pu_bacteria 2515154203 2516087613 263
132 iso_pu_bacteria 2622736626 2623586487 263
133 iso_pu_bacteria 2772190715 2772641718 263
134 iso_pu_bacteria 2855670206 2855672272 263
135 iso_pu_bacteria 2855676851 2855678914 263
136 iso_pu_bacteria 2855683550 2855684174 263
137 iso_pu_bacteria 2856858025 2856860410 263
138 iso_pu_bacteria 2857288857 2857290008 263
139 iso_pu_bacteria 2858848962 2858849840 263
140 iso_pu_bacteria 2858868258 2858872481 263
141 iso_pu_bacteria 2858882152 2858888581 263
142 iso_pu_bacteria 2858888857 2858890711 263
143 iso_pu_bacteria 2858895516 2858898607 263
144 iso_pu_bacteria 2858902515 2858908756 263
145 iso_pu_bacteria 2867302475 2867303864 263
146 iso_pu_bacteria 2867312974 2867313295 263
147 iso_pu_bacteria 2867319477 2867325736 263
148 iso_pu_bacteria 2869048445 2869050686 263
149 iso_pu_bacteria 2869068681 2869072851 263
150 iso_pu_bacteria 2880489317 2880493701 263
151 iso_pu_bacteria 2880495981 2880498622 263
152 iso_pu_bacteria 2887478801 2887483745 263
153 iso_pu_bacteria 2891326441 2891328056 263
154 iso_pu_bacteria 2902582711 2902586331 263
155 iso_pu_bacteria 2929219909 2929220617 263
156 iso_pu_bacteria 2929226422 2929227200 263
157 iso_pu_bacteria 649633069 649811149 263
158 iso_pu_bacteria 8003856774 8003861747 263
159 iso_pu_bacteria 8003870546 8003872379 263
160 iso_pu_bacteria 8047710418 8047715291 263
161 iso_pu_bacteria 8054472261 8054478933 263
162 iso_pu_bacteria 8054704163 8054708132 263
163 iso_pu_bacteria 8054727385 8054730943 263
164 iso_pu_bacteria 8054734606 8054735074 263
165 iso_pu_bacteria 8055172936 8055174820 263
166 3300006846 Ga0075430_100098791 Ga0075430_1000987912 264
167 3300006880 Ga0075429_100024627 Ga0075429_1000246274 264
168 3300025898 Ga0207692_10015166 Ga0207692_100151662 264
169 3300044658 Ga0466972_0004720 Ga0466972_0004720_3579_4436 264
170 3300044683 Ga0466965_0000634 Ga0466965_0000634_3252_4109 264
171 3300044719 Ga0466971_0072412 Ga0466971_0072412_206_1063 264
172 3300044765 Ga0466970_0013683 Ga0466970_0013683_662_1519 264
173 3300044842 Ga0466957_0018781 Ga0466957_0018781_495_1352 264
174 iso_pu_bacteria 2831935698 2831940389 264
175 iso_pu_bacteria 2832004796 2832007405 264
176 iso_pu_bacteria 2866065130 2866067154 264
177 iso_pu_bacteria 2867507094 2867509374 264
178 3300009147 Ga0114129_10020786 Ga0114129_100207868 265
179 3300050490 nmdc:mga03n38_6139_c1 nmdc:mga03n38_6139_c1_1451_2320 265
180 3300050508 nmdc:mga09592_33927_c1 nmdc:mga09592_33927_c1_75_926 265
181 3300050509 nmdc:mga0qj67_58243_c1 nmdc:mga0qj67_58243_c1_586_1437 265
182 3300050510 nmdc:mga06r32_301730_c1 nmdc:mga06r32_301730_c1_635_1486 265
183 3300025923 Ga0207681_10367401 Ga0207681_103674012 266
184 3300026067 Ga0207678_10449077 Ga0207678_104490772 266
185 3300028794 Ga0307515_10000088 Ga0307515_10000088153 266
186 3300028794 Ga0307515_10119031 Ga0307515_101190312 266
187 3300028794 Ga0307515_10291971 Ga0307515_102919712 266
188 3300031507 Ga0307509_10230943 Ga0307509_102309432 266
189 3300031730 Ga0307516_10007558 Ga0307516_100075585 266
190 3300035091 Ga0373951_0000024 Ga0373951_0000024_25247_26149 266
191 iso_pu_bacteria 2751185734 2753074475 266
192 iso_pu_bacteria 2870721527 2870728930 266
193 3300006038 Ga0075365_10004983 Ga0075365_100049836 267
194 3300006844 Ga0075428_100268830 Ga0075428_1002688302 267
195 3300035691 Ga0373931_0030327 Ga0373931_0030327_623_1477 267
196 3300032002 Ga0307416_101015180 Ga0307416_1010151801 268
197 3300049571 Ga0501034_0257844 Ga0501034_0257844_334_1191 268
198 3300049590 Ga0501074_0062067 Ga0501074_0062067_1037_1894 268
199 3300049741 Ga0501079_0006538 Ga0501079_0006538_3644_4501 268
200 3300049823 Ga0501044_0130532 Ga0501044_0130532_919_1776 268
201 iso_pu_bacteria 2775506925 2776374089 268
202 iso_pu_bacteria 2863067949 2863069119 268
203 iso_pu_bacteria 2866552031 2866552927 268
204 3300037466 Ga0395898_0034634 Ga0395898_0034634_401_1276 269
205 3300037471 Ga0395905_0067880 Ga0395905_0067880_538_1413 269
206 3300038443 Ga0395901_0022314 Ga0395901_0022314_4666_5541 269
207 3300046459 Ga0495629_0081155 Ga0495629_0081155_514_1383 269
208 3300050508 nmdc:mga09592_110762_c1 nmdc:mga09592_110762_c1_1405_2331 269
209 3300005327 Ga0070658_10017928 Ga0070658_100179283 270
210 3300005329 Ga0070683_100070773 Ga0070683_1000707733 270
211 3300005336 Ga0070680_100110721 Ga0070680_1001107212 270
212 3300005344 Ga0070661_100022336 Ga0070661_1000223362 270
213 3300013105 Ga0157369_10034251 Ga0157369_100342516 270
214 3300020070 Ga0206356_10486987 Ga0206356_104869872 270
215 3300025909 Ga0207705_10142212 Ga0207705_101422122 270
216 3300025917 Ga0207660_10110526 Ga0207660_101105263 270
217 3300025920 Ga0207649_10011262 Ga0207649_100112622 270
218 3300025932 Ga0207690_10202688 Ga0207690_102026882 270
219 3300025949 Ga0207667_10161219 Ga0207667_101612192 270
220 3300031456 Ga0307513_10168019 Ga0307513_101680192 270
221 3300048915 Ga0496112_0077510 Ga0496112_0077510_1583_2470 270
222 iso_pu_bacteria 2996221748 2996227299 270
223 iso_pu_bacteria 2842888712 2842891117 272
224 iso_pu_bacteria 8055412473 8055415362 272
225 iso_pu_bacteria 8056207758 8056209139 272
226 3300005327 Ga0070658_10181137 Ga0070658_101811372 273
227 iso_pu_bacteria 2791354901 2791914347 273
228 iso_pu_bacteria 8002775197 8002781986 281
229 3300003203 JGI25406J46586_10001180 JGI25406J46586_100011806 287
230 3300005985 Ga0081539_10000907 Ga0081539_1000090728 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

48

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8apo-assembly1.cif.gz_Bm structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.872 234 284
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.8325 32 280
7nhn-assembly1.cif.gz_n vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.8312 234 286
3fuu-assembly1.cif.gz_A t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in complex with adenosine in space group p212121 0.8269 11 282
3fut-assembly2.cif.gz_B apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p21212 0.8252 8 282
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.917 48 112 3.40.50.150
af_P9WH07_6_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9026 3 216 3.40.50.150
af_P9WH07_6_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8904 3 216 3.40.50.150
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8815 234 285 1.10.8.50
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8777 234 285 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A6J6DZR8-F1-model_v4 Unannotated protein 0.9884 168 282 GO:0000179
GO:0003723
GO:0005829
AF-A0A4Y8XY53-F1-model_v4 deleted 0.9595 7 106
AF-A0A2R7M125-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9576 7 203 GO:0000179
GO:0003723
GO:0005829
AF-A0A1H4A881-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9573 6 285 GO:0003723
GO:0005829
GO:0052908
AF-A0A3C1DIA6-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9563 170 285 GO:0000179
GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
89.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map