F343454

General Info

Members Datasets Scaffolds Average Seq Length
230 159 460 183

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0110515|Ga0501067_0110515_175_783
Length 202
Sequence MRAAAPKPVNPDAACEGHGMIPEGHALQTFFLDLVRTHYSRDIGLRDEQVSAYVANMLTEFTEMERLQAIQNSAGRRLDDVGEMLLEADPVFGEAPSFDRERQVRKHIGDYTLFFTGMFPEAINHSRLRRSRLENLVDFIRAGKESYYIVSKFEYFEYAKVAPLFAKLAAHFEECVYGLNQIKNELAERQHPIMRETREFIM

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
67 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
68 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
69 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 7.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.04
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 29.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0110515 3300049583 Bacteria 1528
2 Ga0058859_10549653 3300004798 Bacteria 772
3 Ga0070670_100021405 3300005331 Bacteria 5563
4 Ga0068869_100000542 3300005334 Bacteria 21123
5 Ga0070666_10492430 3300005335 Bacteria 888
6 Ga0070680_100109756 3300005336 Bacteria 2296
7 Ga0068868_100051123 3300005338 Bacteria 3249
8 Ga0068868_100067101 3300005338 Bacteria 2854
9 Ga0070669_100286405 3300005353 Bacteria 1321
10 Ga0070709_10054671 3300005434 Unclassified 2518
11 Ga0070714_100000186 3300005435 Bacteria 49870
12 Ga0070714_100140385 3300005435 Bacteria 2168
13 Ga0070713_100106006 3300005436 Bacteria 2443
14 Ga0070713_100133622 3300005436 Bacteria 2190
15 Ga0070710_10001214 3300005437 Bacteria 12197
16 Ga0070710_10126928 3300005437 Bacteria 1551
17 Ga0070711_100033831 3300005439 Bacteria 3405
18 Ga0070711_100048221 3300005439 Unclassified 2911
19 Ga0070708_100176095 3300005445 Bacteria 1999
20 Ga0070708_100476726 3300005445 Unclassified 1177
21 Ga0068867_100109687 3300005459 Bacteria 2119
22 Ga0070707_100178008 3300005468 Bacteria 2073
23 Ga0070707_100582951 3300005468 Bacteria 1081
24 Ga0070698_100186863 3300005471 Bacteria 2010
25 Ga0070679_100016406 3300005530 Bacteria 7142
26 Ga0070679_100298647 3300005530 Bacteria 1561
27 Ga0070697_100012550 3300005536 Bacteria 6637
28 Ga0070672_100741099 3300005543 Bacteria 862
29 Ga0070695_100311280 3300005545 Unclassified 1167
30 Ga0070696_100055703 3300005546 Unclassified 2757
31 Ga0070665_100134254 3300005548 Bacteria 2477
32 Ga0068857_100230108 3300005577 Unclassified 1695
33 Ga0068856_100520035 3300005614 Bacteria 1211
34 Ga0068856_100726670 3300005614 Unclassified 1013
35 Ga0068859_100009906 3300005617 Bacteria 9626
36 Ga0068866_10020785 3300005718 Unclassified 3013
37 Ga0068863_100028617 3300005841 Bacteria 5320
38 Ga0068863_100071852 3300005841 Bacteria 3274
39 Ga0068863_100266985 3300005841 Bacteria 1655
40 Ga0068858_100983592 3300005842 Unclassified 826
41 Ga0068860_100042278 3300005843 Unclassified 4353
42 Ga0068860_100308370 3300005843 Unclassified 1552
43 Ga0068862_100128857 3300005844 Bacteria 2236
44 Ga0068862_100248954 3300005844 Bacteria 1619
45 Ga0081540_1108904 3300005983 Unclassified 1176
46 Ga0070717_10192849 3300006028 Bacteria 1781
47 Ga0070717_10500112 3300006028 Unclassified 1099
48 Ga0070715_10084949 3300006163 Bacteria 1445
49 Ga0070716_100102702 3300006173 Unclassified 1756
50 Ga0070716_100542225 3300006173 Bacteria 866
51 Ga0070712_100152634 3300006175 Unclassified 1775
52 Ga0097621_100763785 3300006237 Bacteria 893
53 Ga0075433_10046156 3300006852 Bacteria 3788
54 Ga0075434_100000462 3300006871 Bacteria 30392
55 Ga0068865_100449868 3300006881 Bacteria 1065
56 Ga0075436_100108015 3300006914 Bacteria 1941
57 Ga0075436_100234843 3300006914 Unclassified 1303
58 Ga0097620_100009906 3300006931 Bacteria 9626
59 Ga0075435_100089429 3300007076 Bacteria 2539
60 Ga0099795_10065455 3300007788 Bacteria 1359
61 Ga0099795_10080579 3300007788 Bacteria 1245
62 Ga0099795_10087315 3300007788 Unclassified 1204
63 Ga0105240_10032351 3300009093 Bacteria 6773
64 Ga0105245_10029389 3300009098 Bacteria 4854
65 Ga0114129_10171915 3300009147 Unclassified 2953
66 Ga0105248_10054588 3300009177 Unclassified 4481
67 Ga0105237_10083723 3300009545 Unclassified 3180
68 Ga0105237_10280571 3300009545 Unclassified 1668
69 Ga0105249_10193681 3300009553 Unclassified 1985
70 Ga0105246_10891093 3300011119 Unclassified 797
71 Ga0157370_10125978 3300013104 Bacteria 2390
72 Ga0157370_10750395 3300013104 Unclassified 889
73 Ga0157369_10017495 3300013105 Bacteria 8056
74 Ga0157374_10028468 3300013296 Bacteria 5047
75 Ga0157374_10110715 3300013296 Bacteria 2641
76 Ga0157374_10226284 3300013296 Unclassified 1837
77 Ga0157378_10032626 3300013297 Bacteria 4602
78 Ga0157372_10118263 3300013307 Unclassified 3041
79 Ga0157372_10516336 3300013307 Viruses 1393
80 Ga0157375_10025708 3300013308 Bacteria 5477
81 Ga0157375_10471553 3300013308 Bacteria 1420
82 Ga0182008_10056963 3300014497 Bacteria 1930
83 Ga0157379_10647932 3300014968 Unclassified 989
84 Ga0157376_10083493 3300014969 Bacteria 2748
85 Ga0182007_10005524 3300015262 Bacteria 5538
86 Ga0213873_10090183 3300021358 Unclassified 870
87 Ga0213872_10002006 3300021361 Bacteria 12386
88 Ga0213872_10032786 3300021361 Bacteria 2380
89 Ga0213872_10038565 3300021361 Bacteria 2180
90 Ga0213871_10000177 3300021441 Bacteria 7051
91 Ga0224712_10219149 3300022467 Unclassified 870
92 Ga0224712_10278407 3300022467 Unclassified 778
93 Ga0224712_10363585 3300022467 Bacteria 685
94 Ga0224570_100665 3300022730 Bacteria 2720
95 Ga0224569_100071 3300022732 Bacteria 6586
96 Ga0224569_101850 3300022732 Bacteria 1750
97 Ga0224571_100635 3300022734 Unclassified 2010
98 Ga0224572_1003826 3300024225 Bacteria 2569
99 Ga0224572_1026755 3300024225 Unclassified 1105
100 Ga0224572_1045552 3300024225 Bacteria 822
101 Ga0228598_1000447 3300024227 Bacteria 8399
102 Ga0228598_1000914 3300024227 Bacteria 6392
103 Ga0228598_1007458 3300024227 Bacteria 2226
104 Ga0207692_10000654 3300025898 Bacteria 12205
105 Ga0207692_10005569 3300025898 Bacteria 5055
106 Ga0207642_10139899 3300025899 Bacteria 1275
107 Ga0207647_10000813 3300025904 Bacteria 24219
108 Ga0207699_10130428 3300025906 Bacteria 1639
109 Ga0207699_10385034 3300025906 Unclassified 996
110 Ga0207695_10134752 3300025913 Bacteria 2424
111 Ga0207693_10089580 3300025915 Unclassified 2411
112 Ga0207693_10176228 3300025915 Unclassified 1682
113 Ga0207663_10002967 3300025916 Bacteria 8205
114 Ga0207660_10362781 3300025917 Unclassified 1162
115 Ga0207649_10001140 3300025920 Bacteria 16078
116 Ga0207652_10125432 3300025921 Bacteria 2286
117 Ga0207652_10221987 3300025921 Bacteria 1703
118 Ga0207646_10154765 3300025922 Bacteria 2068
119 Ga0207646_10375149 3300025922 Bacteria 1285
120 Ga0207650_10329964 3300025925 Unclassified 1251
121 Ga0207687_10087231 3300025927 Unclassified 2267
122 Ga0207700_10039450 3300025928 Bacteria 3438
123 Ga0207700_10122943 3300025928 Bacteria 2107
124 Ga0207700_10272541 3300025928 Bacteria 1453
125 Ga0207700_10757756 3300025928 Unclassified 868
126 Ga0207664_10000086 3300025929 Bacteria 89769
127 Ga0207664_10021753 3300025929 Bacteria 4777
128 Ga0207664_10246481 3300025929 Bacteria 1557
129 Ga0207665_10151296 3300025939 Unclassified 1662
130 Ga0207711_10236012 3300025941 Bacteria 1676
131 Ga0207689_10003567 3300025942 Bacteria 14224
132 Ga0207712_10097709 3300025961 Unclassified 2176
133 Ga0207677_10150798 3300026023 Bacteria 1793
134 Ga0207703_10004444 3300026035 Bacteria 11519
135 Ga0207708_10520664 3300026075 Bacteria 999
136 Ga0207702_10516426 3300026078 Bacteria 1166
137 Ga0207641_10022531 3300026088 Bacteria 5184
138 Ga0207641_10062164 3300026088 Bacteria 3186
139 Ga0207648_10107830 3300026089 Bacteria 2445
140 Ga0207675_100151788 3300026118 Bacteria 2205
141 Ga0265356_1000415 3300028017 Bacteria 7719
142 Ga0268265_10310714 3300028380 Bacteria 1423
143 Ga0265338_10004865 3300028800 Bacteria 17895
144 Ga0265338_10024280 3300028800 Bacteria 6197
145 Ga0265762_1001172 3300030760 Bacteria 4744
146 Ga0265762_1006465 3300030760 Bacteria 2096
147 Ga0265765_1008019 3300030879 Unclassified 1145
148 Ga0265760_10000214 3300031090 Bacteria 15581
149 Ga0265332_10021977 3300031238 Unclassified 2816
150 Ga0265339_10006590 3300031249 Bacteria 7605
151 Ga0265339_10021695 3300031249 Bacteria 3731
152 Ga0265331_10060764 3300031250 Bacteria 1785
153 Ga0265314_10009517 3300031711 Bacteria 8191
154 Ga0316212_1034791 3300033547 Unclassified 710
155 Ga0373923_0056408 3300035111 Bacteria 1658
156 Ga0373936_0001376 3300035113 Bacteria 8824
157 Ga0373945_0002193 3300035116 Bacteria 6100
158 Ga0373953_0005730 3300035117 Unclassified 4050
159 Ga0373954_0125726 3300035118 Bacteria 1246
160 Ga0373943_0002431 3300035170 Bacteria 8457
161 Ga0373943_0052046 3300035170 Unclassified 2018
162 Ga0373946_0005302 3300035171 Bacteria 4647
163 Ga0373931_0328676 3300035691 Unclassified 952
164 Ga0373935_0013182 3300035692 Unclassified 4984
165 Ga0373927_0001136 3300035695 Bacteria 20149
166 Ga0373947_0001191 3300035725 Bacteria 16011
167 Ga0373925_0002873 3300037068 Bacteria 13598
168 Ga0395900_0820603 3300037418 Unclassified 857
169 Ga0395898_0031738 3300037466 Bacteria 5276
170 Ga0395905_0027208 3300037471 Bacteria 5393
171 Ga0395905_0284215 3300037471 Bacteria 1541
172 Ga0436360_0815529 3300039438 Bacteria 1606
173 Ga0436360_0866188 3300039438 Unclassified 759
174 Ga0436360_0891799 3300039438 Bacteria 1290
175 Ga0436360_1142222 3300039438 Bacteria 19799
176 Ga0436360_1293199 3300039438 Unclassified 729
177 Ga0436361_0139312 3300039447 Bacteria 12177
178 Ga0436361_0159168 3300039447 Bacteria 35585
179 Ga0436361_0554668 3300039447 Bacteria 6385
180 Ga0436361_0853939 3300039447 Unclassified 1191
181 Ga0436361_0926784 3300039447 Bacteria 10725
182 Ga0436361_1079820 3300039447 Bacteria 1737
183 Ga0436362_0992005 3300039453 Bacteria 1340
184 Ga0436362_1132599 3300039453 Bacteria 1950
185 Ga0451577_0266879 3300042876 Bacteria 1550
186 Ga0466963_0015609 3300044694 Unclassified 4708
187 Ga0453684_0549127 3300044712 Bacteria 1273
188 Ga0466957_0087249 3300044842 Unclassified 1951
189 Ga0466957_0270402 3300044842 Unclassified 1135
190 Ga0466959_0034587 3300045049 Bacteria 3738
191 Ga0451576_0239234 3300045051 Bacteria 1896
192 Ga0466958_0079366 3300045836 Unclassified 2018
193 Ga0466958_0409280 3300045836 Unclassified 876
194 Ga0466967_0000580 3300045976 Bacteria 18037
195 Ga0466967_0131971 3300045976 Unclassified 2320
196 Ga0466967_0676193 3300045976 Bacteria 1022
197 Ga0495580_0014032 3300046472 Bacteria 6093
198 Ga0495580_0125635 3300046472 Bacteria 1780
199 Ga0495580_0768906 3300046472 Unclassified 626
200 Ga0495664_0033280 3300046477 Bacteria 3029
201 Ga0495656_0073595 3300046615 Bacteria 1524
202 Ga0495659_0017900 3300046664 Unclassified 2355
203 Ga0495599_0547536 3300046678 Unclassified 678
204 Ga0495674_0023638 3300047319 Bacteria 5660
205 Ga0495676_0274881 3300047321 Bacteria 1142
206 Ga0495602_0151404 3300048088 Bacteria 1823
207 Ga0496102_0069436 3300048905 Bacteria 3234
208 Ga0496103_0263558 3300048906 Unclassified 1109
209 Ga0496110_0414301 3300048913 Bacteria 1228
210 Ga0496112_0069774 3300048915 Bacteria 3471
211 Ga0496112_0099946 3300048915 Bacteria 2871
212 Ga0496112_0888881 3300048915 Unclassified 813
213 Ga0496113_0690903 3300048916 Unclassified 815
214 Ga0501073_0008566 3300049589 Bacteria 7585
215 nmdc:mga0n895_1746_c1 3300050512 Bacteria 16448
216 nmdc:mga0rr50_44823_c1 3300050513 Bacteria 3246
217 nmdc:mga08x19_10009_c1 3300050514 Bacteria 5684
218 nmdc:mga08x19_103847_c1 3300050514 Bacteria 1888
219 nmdc:mga08x19_385434_c1 3300050514 Bacteria 982
220 nmdc:mga0a205_56432_c1 3300050515 Bacteria 3792
221 Ga0495619_0480992 3300053085 Unclassified 855
222 Ga0587070_088541 3300059491 Bacteria 692
223 Ga0587073_0094602 3300059492 Unclassified 766
224 Ga0587080_021672 3300059503 Bacteria 1058
225 Ga0587083_0098601 3300059505 Bacteria 724
226 Ga0587083_0122776 3300059505 Bacteria 673
227 Ga0587085_051431 3300059506 Unclassified 752
228 Ga0587085_073084 3300059506 Bacteria 675
229 Ga0587068_066927 3300059641 Bacteria 702
230 Ga0587076_052340 3300059645 Bacteria 800
231 Ga0501067_0110515
232 Ga0058859_10549653
233 Ga0070670_100021405
234 Ga0068869_100000542
235 Ga0070666_10492430
236 Ga0070680_100109756
237 Ga0068868_100051123
238 Ga0068868_100067101
239 Ga0070669_100286405
240 Ga0070709_10054671
241 Ga0070714_100000186
242 Ga0070714_100140385
243 Ga0070713_100106006
244 Ga0070713_100133622
245 Ga0070710_10001214
246 Ga0070710_10126928
247 Ga0070711_100033831
248 Ga0070711_100048221
249 Ga0070708_100176095
250 Ga0070708_100476726
251 Ga0068867_100109687
252 Ga0070707_100178008
253 Ga0070707_100582951
254 Ga0070698_100186863
255 Ga0070679_100016406
256 Ga0070679_100298647
257 Ga0070697_100012550
258 Ga0070672_100741099
259 Ga0070695_100311280
260 Ga0070696_100055703
261 Ga0070665_100134254
262 Ga0068857_100230108
263 Ga0068856_100520035
264 Ga0068856_100726670
265 Ga0068859_100009906
266 Ga0068866_10020785
267 Ga0068863_100028617
268 Ga0068863_100071852
269 Ga0068863_100266985
270 Ga0068858_100983592
271 Ga0068860_100042278
272 Ga0068860_100308370
273 Ga0068862_100128857
274 Ga0068862_100248954
275 Ga0081540_1108904
276 Ga0070717_10192849
277 Ga0070717_10500112
278 Ga0070715_10084949
279 Ga0070716_100102702
280 Ga0070716_100542225
281 Ga0070712_100152634
282 Ga0097621_100763785
283 Ga0075433_10046156
284 Ga0075434_100000462
285 Ga0068865_100449868
286 Ga0075436_100108015
287 Ga0075436_100234843
288 Ga0097620_100009906
289 Ga0075435_100089429
290 Ga0099795_10065455
291 Ga0099795_10080579
292 Ga0099795_10087315
293 Ga0105240_10032351
294 Ga0105245_10029389
295 Ga0114129_10171915
296 Ga0105248_10054588
297 Ga0105237_10083723
298 Ga0105237_10280571
299 Ga0105249_10193681
300 Ga0105246_10891093
301 Ga0157370_10125978
302 Ga0157370_10750395
303 Ga0157369_10017495
304 Ga0157374_10028468
305 Ga0157374_10110715
306 Ga0157374_10226284
307 Ga0157378_10032626
308 Ga0157372_10118263
309 Ga0157372_10516336
310 Ga0157375_10025708
311 Ga0157375_10471553
312 Ga0182008_10056963
313 Ga0157379_10647932
314 Ga0157376_10083493
315 Ga0182007_10005524
316 Ga0213873_10090183
317 Ga0213872_10002006
318 Ga0213872_10032786
319 Ga0213872_10038565
320 Ga0213871_10000177
321 Ga0224712_10219149
322 Ga0224712_10278407
323 Ga0224712_10363585
324 Ga0224570_100665
325 Ga0224569_100071
326 Ga0224569_101850
327 Ga0224571_100635
328 Ga0224572_1003826
329 Ga0224572_1026755
330 Ga0224572_1045552
331 Ga0228598_1000447
332 Ga0228598_1000914
333 Ga0228598_1007458
334 Ga0207692_10000654
335 Ga0207692_10005569
336 Ga0207642_10139899
337 Ga0207647_10000813
338 Ga0207699_10130428
339 Ga0207699_10385034
340 Ga0207695_10134752
341 Ga0207693_10089580
342 Ga0207693_10176228
343 Ga0207663_10002967
344 Ga0207660_10362781
345 Ga0207649_10001140
346 Ga0207652_10125432
347 Ga0207652_10221987
348 Ga0207646_10154765
349 Ga0207646_10375149
350 Ga0207650_10329964
351 Ga0207687_10087231
352 Ga0207700_10039450
353 Ga0207700_10122943
354 Ga0207700_10272541
355 Ga0207700_10757756
356 Ga0207664_10000086
357 Ga0207664_10021753
358 Ga0207664_10246481
359 Ga0207665_10151296
360 Ga0207711_10236012
361 Ga0207689_10003567
362 Ga0207712_10097709
363 Ga0207677_10150798
364 Ga0207703_10004444
365 Ga0207708_10520664
366 Ga0207702_10516426
367 Ga0207641_10022531
368 Ga0207641_10062164
369 Ga0207648_10107830
370 Ga0207675_100151788
371 Ga0265356_1000415
372 Ga0268265_10310714
373 Ga0265338_10004865
374 Ga0265338_10024280
375 Ga0265762_1001172
376 Ga0265762_1006465
377 Ga0265765_1008019
378 Ga0265760_10000214
379 Ga0265332_10021977
380 Ga0265339_10006590
381 Ga0265339_10021695
382 Ga0265331_10060764
383 Ga0265314_10009517
384 Ga0316212_1034791
385 Ga0373923_0056408
386 Ga0373936_0001376
387 Ga0373945_0002193
388 Ga0373953_0005730
389 Ga0373954_0125726
390 Ga0373943_0002431
391 Ga0373943_0052046
392 Ga0373946_0005302
393 Ga0373931_0328676
394 Ga0373935_0013182
395 Ga0373927_0001136
396 Ga0373947_0001191
397 Ga0373925_0002873
398 Ga0395900_0820603
399 Ga0395898_0031738
400 Ga0395905_0027208
401 Ga0395905_0284215
402 Ga0436360_0815529
403 Ga0436360_0866188
404 Ga0436360_0891799
405 Ga0436360_1142222
406 Ga0436360_1293199
407 Ga0436361_0139312
408 Ga0436361_0159168
409 Ga0436361_0554668
410 Ga0436361_0853939
411 Ga0436361_0926784
412 Ga0436361_1079820
413 Ga0436362_0992005
414 Ga0436362_1132599
415 Ga0451577_0266879
416 Ga0466963_0015609
417 Ga0453684_0549127
418 Ga0466957_0087249
419 Ga0466957_0270402
420 Ga0466959_0034587
421 Ga0451576_0239234
422 Ga0466958_0079366
423 Ga0466958_0409280
424 Ga0466967_0000580
425 Ga0466967_0131971
426 Ga0466967_0676193
427 Ga0495580_0014032
428 Ga0495580_0125635
429 Ga0495580_0768906
430 Ga0495664_0033280
431 Ga0495656_0073595
432 Ga0495659_0017900
433 Ga0495599_0547536
434 Ga0495674_0023638
435 Ga0495676_0274881
436 Ga0495602_0151404
437 Ga0496102_0069436
438 Ga0496103_0263558
439 Ga0496110_0414301
440 Ga0496112_0069774
441 Ga0496112_0099946
442 Ga0496112_0888881
443 Ga0496113_0690903
444 Ga0501073_0008566
445 nmdc:mga0n895_1746_c1
446 nmdc:mga0rr50_44823_c1
447 nmdc:mga08x19_10009_c1
448 nmdc:mga08x19_103847_c1
449 nmdc:mga08x19_385434_c1
450 nmdc:mga0a205_56432_c1
451 Ga0495619_0480992
452 Ga0587070_088541
453 Ga0587073_0094602
454 Ga0587080_021672
455 Ga0587083_0098601
456 Ga0587083_0122776
457 Ga0587085_051431
458 Ga0587085_073084
459 Ga0587068_066927
460 Ga0587076_052340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ory-assembly1.cif.gz_A flagellar export chaperone in complex with its cognate binding partner 0.485 78 181
6gow-assembly1.cif.gz_E crystal structure of the flagellin-flis complex from bacillus subtilis crystallized in spacegroup p22121 0.452 70 181
1ory-assembly1.cif.gz_A flagellar export chaperone in complex with its cognate binding partner 0.4279 78 181
6gow-assembly1.cif.gz_E crystal structure of the flagellin-flis complex from bacillus subtilis crystallized in spacegroup p22121 0.4269 70 181
1orj-assembly2.cif.gz_B flagellar export chaperone 0.3901 83 181
ID Description Score Start End Superfamily
1oryA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.485 78 181 1.20.120.340
af_Q2V4B2_71_187_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.4563 72 182 1.20.120.290
af_I1KBS3_176_275_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4409 83 171 1.20.58.160
af_B6SZD1_1_154_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4303 2 171 1.25.40.10
1oryA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.4279 78 181 1.20.120.340
ID Description Score Start End GO Terms
AF-A0A2V9U610-F1-model_v4 Uncharacterized protein 0.944 1 129
AF-A0A3M1U5Z6-F1-model_v4 Uncharacterized protein 0.9349 2 169
AF-A0A7C3S6A7-F1-model_v4 Uncharacterized protein 0.9296 2 173
AF-A0A2V9RXC1-F1-model_v4 Uncharacterized protein 0.9247 1 183
AF-A0A321L9V1-F1-model_v4 Uncharacterized protein 0.9227 25 183

Map