F343141

General Info

Members Datasets Scaffolds Average Seq Length
230 185 460 131

Family's Representative Sequence

Representative Sequence 3300030878|Ga0265770_1093567|Ga0265770_10935672
Length 142
Sequence MVSTQRSVLRTVEVGAMAEQIPLVDYLVLGSQPHLTAHQCTSCGARFFDRRNAADFTLVDIPTDGEGRAFTIVAFAAPGIPTPYVAAMVDCAGTSVRANLINVPPDPEHVTLGMKVQLATQAIGTDDNGTEAIGFGFEPSGG

Samples

Sample ID Description Type Environment
1 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2508501039 Frankia saprophytica CN3 Isolate Nodule
174 2517572101 Frankia sp. DC12 Isolate Nodule
175 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
176 2619618881 Frankia sp. ACN1ag Isolate Unclassified
177 2619619003 Frankia sp. CpI1-P Isolate Nodule
178 2626541554 Frankia sp. AvcI.1 Isolate Nodule
179 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
180 2687453737 Frankia sp. BMG5.36 Isolate Nodule
181 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
182 8002775197 Frankia nepalensis CN7 Isolate Nodule
183 8002784119 Frankia sp. AgB1.9 Isolate Nodule
184 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
185 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.83
Metatranscriptomes 6.52
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.26
Nodule 4.78
Rhizoplane 5.22
Rhizosphere 76.09
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265770_1093567 3300030878 Bacteria 603
2 Ga0058859_11568320 3300004798 Bacteria 707
3 Ga0058860_11977475 3300004801 Bacteria 804
4 Ga0070668_100148297 3300005347 Bacteria 1895
5 Ga0070674_102012481 3300005356 Bacteria 526
6 Ga0070673_100538575 3300005364 Bacteria 1059
7 Ga0070709_10673644 3300005434 Bacteria 803
8 Ga0070714_100902680 3300005435 Bacteria 858
9 Ga0070714_100946898 3300005435 Bacteria 837
10 Ga0070713_100854989 3300005436 Bacteria 874
11 Ga0070694_101591929 3300005444 Bacteria 554
12 Ga0070678_101777608 3300005456 Bacteria 581
13 Ga0070678_101827601 3300005456 Bacteria 573
14 Ga0068867_100582793 3300005459 Bacteria 973
15 Ga0068867_100656549 3300005459 Bacteria 921
16 Ga0070684_101164462 3300005535 Bacteria 725
17 Ga0070684_101171206 3300005535 Bacteria 723
18 Ga0070686_101612355 3300005544 Unclassified 549
19 Ga0070696_101154078 3300005546 Bacteria 653
20 Ga0070665_101888865 3300005548 Bacteria 603
21 Ga0070704_100540584 3300005549 Bacteria 1017
22 Ga0070704_100608739 3300005549 Bacteria 961
23 Ga0068854_100648979 3300005578 Unclassified 906
24 Ga0068859_100014531 3300005617 Bacteria 7907
25 Ga0068859_100389066 3300005617 Bacteria 1490
26 Ga0068859_100499016 3300005617 Bacteria 1312
27 Ga0068864_100570991 3300005618 Bacteria 1095
28 Ga0068861_100064802 3300005719 Bacteria 2812
29 Ga0068851_10419292 3300005834 Bacteria 790
30 Ga0068858_100017924 3300005842 Bacteria 6631
31 Ga0068860_100040713 3300005843 Bacteria 4440
32 Ga0068860_100286797 3300005843 Bacteria 1610
33 Ga0068862_101163525 3300005844 Bacteria 769
34 Ga0075365_10031066 3300006038 Bacteria 3424
35 Ga0075365_10054664 3300006038 Bacteria 2648
36 Ga0075364_10483223 3300006051 Bacteria 847
37 Ga0070712_101506655 3300006175 Bacteria 588
38 Ga0075367_10056497 3300006178 Bacteria 2332
39 Ga0075436_101550248 3300006914 Bacteria 503
40 Ga0097620_100000054 3300006931 Bacteria 123173
41 Ga0097620_100014532 3300006931 Bacteria 7907
42 Ga0097620_100389086 3300006931 Bacteria 1490
43 Ga0097620_100499044 3300006931 Bacteria 1312
44 Ga0075435_100172140 3300007076 Bacteria 1827
45 Ga0105245_10953838 3300009098 Bacteria 901
46 Ga0105247_10218196 3300009101 Bacteria 1290
47 Ga0105248_11677374 3300009177 Bacteria 720
48 Ga0105237_10483016 3300009545 Bacteria 1245
49 Ga0105238_10666233 3300009551 Bacteria 1051
50 Ga0105239_10325490 3300010375 Bacteria 1734
51 Ga0105239_10389772 3300010375 Bacteria 1576
52 Ga0157378_10184972 3300013297 Bacteria 1962
53 Ga0163162_11029566 3300013306 Bacteria 931
54 Ga0157380_10278446 3300014326 Bacteria 1529
55 Ga0157380_10866809 3300014326 Bacteria 926
56 Ga0157380_12110695 3300014326 Bacteria 626
57 Ga0163161_10957330 3300017792 Bacteria 728
58 Ga0197907_10417670 3300020069 Bacteria 644
59 Ga0206356_10443739 3300020070 Bacteria 669
60 Ga0206352_11005813 3300020078 Bacteria 1506
61 Ga0206350_10698519 3300020080 Bacteria 668
62 Ga0206354_10176086 3300020081 Bacteria 1578
63 Ga0206354_11414698 3300020081 Bacteria 777
64 Ga0206353_10923506 3300020082 Bacteria 549
65 Ga0206353_11551702 3300020082 Bacteria 738
66 Ga0154015_1515655 3300020610 Bacteria 569
67 Ga0154015_1570833 3300020610 Bacteria 614
68 Ga0213873_10002103 3300021358 Bacteria 3406
69 Ga0213876_10341170 3300021384 Bacteria 797
70 Ga0224572_1015744 3300024225 Bacteria 1450
71 Ga0207710_10409825 3300025900 Bacteria 696
72 Ga0207680_10810780 3300025903 Bacteria 671
73 Ga0207699_10457889 3300025906 Bacteria 916
74 Ga0207681_11064868 3300025923 Bacteria 679
75 Ga0207694_10497117 3300025924 Bacteria 1021
76 Ga0207700_10804115 3300025928 Bacteria 841
77 Ga0207664_10949136 3300025929 Bacteria 771
78 Ga0207706_10155961 3300025933 Bacteria 2008
79 Ga0207670_10415228 3300025936 Bacteria 1079
80 Ga0207661_10841629 3300025944 Bacteria 845
81 Ga0207679_11005038 3300025945 Unclassified 764
82 Ga0207712_10069225 3300025961 Bacteria 2531
83 Ga0207640_11476530 3300025981 Unclassified 610
84 Ga0207703_10007952 3300026035 Bacteria 8382
85 Ga0207702_10369115 3300026078 Bacteria 1377
86 Ga0207675_100109446 3300026118 Bacteria 2607
87 Ga0207683_11719249 3300026121 Bacteria 577
88 Ga0207698_10560585 3300026142 Bacteria 1121
89 Ga0268265_10635561 3300028380 Bacteria 1024
90 Ga0268264_10017508 3300028381 Bacteria 5868
91 Ga0268264_10089142 3300028381 Bacteria 2656
92 Ga0265762_1040326 3300030760 Bacteria 912
93 Ga0307408_100446627 3300031548 Bacteria 1121
94 Ga0307405_10775340 3300031731 Bacteria 801
95 Ga0307413_10040614 3300031824 Bacteria 2716
96 Ga0307410_10021056 3300031852 Bacteria 4004
97 Ga0307407_10003128 3300031903 Bacteria 6699
98 Ga0307409_100019006 3300031995 Bacteria 4640
99 Ga0307416_100039548 3300032002 Bacteria 3653
100 Ga0307411_10023775 3300032005 Bacteria 3638
101 Ga0307415_100015206 3300032126 Bacteria 4549
102 Ga0373933_0471220 3300035724 Unclassified 822
103 Ga0373937_0123624 3300036401 Bacteria 2413
104 Ga0400485_11540 3300038735 Bacteria 9559
105 Ga0436365_0235890 3300039437 Bacteria 3967
106 Ga0436362_0518279 3300039453 Bacteria 3747
107 Ga0436362_0960849 3300039453 Bacteria 3326
108 Ga0439439_0070148 3300041406 Bacteria 938
109 Ga0451789_1325328 3300041443 Bacteria 925
110 Ga0451791_0876303 3300041451 Bacteria 797
111 Ga0451802_1906084 3300041460 Unclassified 980
112 Ga0451839_0859384 3300041496 Unclassified 622
113 Ga0451839_1344937 3300041496 Unclassified 590
114 Ga0451843_0390365 3300041509 Bacteria 756
115 Ga0451853_3834357 3300041512 Bacteria 543
116 Ga0451853_4035175 3300041512 Bacteria 1150
117 Ga0439431_0069650 3300041997 Bacteria 936
118 Ga0450923_038923 3300042125 Bacteria 994
119 Ga0451577_0224655 3300042876 Bacteria 1698
120 Ga0439440_0142396 3300042993 Bacteria 682
121 Ga0466965_0224397 3300044683 Bacteria 1002
122 Ga0453684_1163317 3300044712 Bacteria 812
123 Ga0466960_0553647 3300044901 Bacteria 679
124 Ga0495592_0153869 3300046454 Bacteria 1588
125 Ga0495653_0094875 3300046463 Bacteria 2173
126 Ga0495653_0106838 3300046463 Bacteria 2018
127 Ga0495582_0155177 3300046473 Bacteria 1301
128 Ga0495639_0699855 3300046475 Bacteria 523
129 Ga0495662_0409210 3300046476 Bacteria 666
130 Ga0495608_0402831 3300046511 Unclassified 836
131 Ga0495628_0935663 3300046516 Bacteria 600
132 Ga0495652_0996301 3300046529 Unclassified 548
133 Ga0495587_0060191 3300046536 Bacteria 2228
134 Ga0495621_0221932 3300046539 Bacteria 765
135 Ga0495645_0527064 3300046543 Bacteria 735
136 Ga0495667_0182969 3300046559 Bacteria 1344
137 Ga0495667_0210662 3300046559 Bacteria 1242
138 Ga0495634_0320693 3300046642 Bacteria 933
139 Ga0495657_0205718 3300046675 Bacteria 1198
140 Ga0495657_0461448 3300046675 Bacteria 743
141 Ga0495599_0124800 3300046678 Bacteria 1600
142 Ga0495599_0300596 3300046678 Bacteria 969
143 Ga0495624_0162979 3300046690 Bacteria 1362
144 Ga0495600_0562087 3300046809 Bacteria 696
145 Ga0495604_0275126 3300047317 Bacteria 1139
146 Ga0495676_0503066 3300047321 Bacteria 795
147 Ga0495680_0194878 3300047322 Bacteria 1456
148 Ga0495685_230487 3300047447 Bacteria 590
149 Ga0495684_0075428 3300047471 Bacteria 2562
150 Ga0495593_0132841 3300047673 Bacteria 1263
151 Ga0495602_0408419 3300048088 Bacteria 967
152 Ga0496100_0832081 3300048903 Bacteria 724
153 Ga0496101_0295455 3300048904 Bacteria 1268
154 Ga0496102_1299558 3300048905 Bacteria 646
155 Ga0496102_1954705 3300048905 Bacteria 503
156 Ga0496105_0399699 3300048908 Bacteria 1091
157 Ga0496108_0410591 3300048911 Bacteria 1183
158 Ga0496109_1855856 3300048912 Unclassified 535
159 Ga0496111_0132044 3300048914 Bacteria 1848
160 Ga0496114_1052148 3300048917 Bacteria 698
161 Ga0496118_0092785 3300048921 Bacteria 2071
162 Ga0501033_0394426 3300049570 Bacteria 966
163 Ga0501034_0000290 3300049571 Bacteria 89870
164 Ga0501036_0179196 3300049572 Bacteria 1784
165 Ga0501038_0061572 3300049574 Bacteria 3209
166 Ga0501039_0129770 3300049575 Bacteria 1978
167 Ga0501040_0029881 3300049576 Bacteria 3678
168 Ga0501041_0071228 3300049577 Bacteria 2134
169 Ga0501042_0425621 3300049578 Bacteria 962
170 Ga0501046_0181432 3300049580 Bacteria 1574
171 Ga0501048_0101559 3300049582 Bacteria 2029
172 Ga0501068_0006405 3300049584 Bacteria 6489
173 Ga0501068_0340101 3300049584 Bacteria 964
174 Ga0501069_0310193 3300049585 Bacteria 926
175 Ga0501071_0581025 3300049587 Bacteria 861
176 Ga0501072_0014009 3300049588 Bacteria 6145
177 Ga0501072_0062619 3300049588 Bacteria 2934
178 Ga0501073_0008750 3300049589 Bacteria 7494
179 Ga0501073_0766768 3300049589 Bacteria 665
180 Ga0501074_0003552 3300049590 Bacteria 11058
181 Ga0501074_0119693 3300049590 Bacteria 1883
182 Ga0501075_0075796 3300049591 Bacteria 2543
183 Ga0501076_0014723 3300049592 Bacteria 5897
184 Ga0501076_0079554 3300049592 Bacteria 2630
185 Ga0501076_1678354 3300049592 Bacteria 521
186 Ga0501077_0082054 3300049593 Bacteria 2043
187 Ga0501079_0017596 3300049741 Bacteria 5459
188 Ga0501080_0086781 3300049742 Bacteria 2908
189 Ga0501080_0099439 3300049742 Bacteria 2699
190 Ga0501080_0890823 3300049742 Bacteria 776
191 Ga0501083_0024058 3300049744 Bacteria 4223
192 Ga0501083_0307795 3300049744 Bacteria 1030
193 Ga0501045_0071189 3300049824 Bacteria 2559
194 nmdc:mga03683_159021_c1 3300050489 Bacteria 1022
195 nmdc:mga03n38_260282_c1 3300050490 Bacteria 919
196 nmdc:mga03n38_442501_c1 3300050490 Bacteria 722
197 nmdc:mga03n38_751642_c1 3300050490 Bacteria 565
198 nmdc:mga00v17_219677_c1 3300050491 Bacteria 1230
199 nmdc:mga00v17_485245_c1 3300050491 Bacteria 801
200 nmdc:mga00v17_67428_c1 3300050491 Bacteria 2211
201 nmdc:mga0yw44_1033924_c1 3300050492 Bacteria 556
202 nmdc:mga0yw44_305792_c1 3300050492 Bacteria 1066
203 nmdc:mga0yw44_513190_c1 3300050492 Bacteria 813
204 nmdc:mga0yw44_607204_c1 3300050492 Bacteria 743
205 nmdc:mga06z11_66662_c1 3300050494 Bacteria 1893
206 nmdc:mga07m45_357568_c1 3300050496 Unclassified 848
207 nmdc:mga0rr50_159852_c1 3300050513 Bacteria 1828
208 Ga0495601_0618537 3300053077 Unclassified 694
209 Ga0495601_0951579 3300053077 Bacteria 541
210 Ga0500583_0264369 3300053092 Bacteria 847
211 Ga0500616_0095576 3300053153 Bacteria 1462
212 Ga0501084_0190082 3300054114 Bacteria 1732
213 Ga0590074_027343 3300059423 Bacteria 999
214 Ga0587125_057577 3300059607 Bacteria 561
215 Ga0501082_0022534 3300060353 Bacteria 5425
216 Ga0530510_0198264 3300061734 Bacteria 1491
217 Ga0530510_1149991 3300061734 Bacteria 595
218 2508674241 2508501039 Bacteria 9978592
219 2517763159 2517572101 Bacteria 6884336
220 2579852345 2579778521 Bacteria 7624758
221 2619855654 2619618881 Bacteria 7521104
222 2620348183 2619619003 Bacteria 7619552
223 2626635064 2626541554 Bacteria 7741902
224 2676203057 2675902999 Bacteria 9438463
225 2689959915 2687453737 Bacteria 11203906
226 2774847633 2773857921 Bacteria 9435764
227 8002777787 8002775197 Bacteria 10728764
228 8002788854 8002784119 Bacteria 9788632
229 8054919032 8054913762 Bacteria 7713009
230 8054922453 8054920844 Bacteria 7068637
231 Ga0265770_1093567
232 Ga0058859_11568320
233 Ga0058860_11977475
234 Ga0070668_100148297
235 Ga0070674_102012481
236 Ga0070673_100538575
237 Ga0070709_10673644
238 Ga0070714_100902680
239 Ga0070714_100946898
240 Ga0070713_100854989
241 Ga0070694_101591929
242 Ga0070678_101777608
243 Ga0070678_101827601
244 Ga0068867_100582793
245 Ga0068867_100656549
246 Ga0070684_101164462
247 Ga0070684_101171206
248 Ga0070686_101612355
249 Ga0070696_101154078
250 Ga0070665_101888865
251 Ga0070704_100540584
252 Ga0070704_100608739
253 Ga0068854_100648979
254 Ga0068859_100014531
255 Ga0068859_100389066
256 Ga0068859_100499016
257 Ga0068864_100570991
258 Ga0068861_100064802
259 Ga0068851_10419292
260 Ga0068858_100017924
261 Ga0068860_100040713
262 Ga0068860_100286797
263 Ga0068862_101163525
264 Ga0075365_10031066
265 Ga0075365_10054664
266 Ga0075364_10483223
267 Ga0070712_101506655
268 Ga0075367_10056497
269 Ga0075436_101550248
270 Ga0097620_100000054
271 Ga0097620_100014532
272 Ga0097620_100389086
273 Ga0097620_100499044
274 Ga0075435_100172140
275 Ga0105245_10953838
276 Ga0105247_10218196
277 Ga0105248_11677374
278 Ga0105237_10483016
279 Ga0105238_10666233
280 Ga0105239_10325490
281 Ga0105239_10389772
282 Ga0157378_10184972
283 Ga0163162_11029566
284 Ga0157380_10278446
285 Ga0157380_10866809
286 Ga0157380_12110695
287 Ga0163161_10957330
288 Ga0197907_10417670
289 Ga0206356_10443739
290 Ga0206352_11005813
291 Ga0206350_10698519
292 Ga0206354_10176086
293 Ga0206354_11414698
294 Ga0206353_10923506
295 Ga0206353_11551702
296 Ga0154015_1515655
297 Ga0154015_1570833
298 Ga0213873_10002103
299 Ga0213876_10341170
300 Ga0224572_1015744
301 Ga0207710_10409825
302 Ga0207680_10810780
303 Ga0207699_10457889
304 Ga0207681_11064868
305 Ga0207694_10497117
306 Ga0207700_10804115
307 Ga0207664_10949136
308 Ga0207706_10155961
309 Ga0207670_10415228
310 Ga0207661_10841629
311 Ga0207679_11005038
312 Ga0207712_10069225
313 Ga0207640_11476530
314 Ga0207703_10007952
315 Ga0207702_10369115
316 Ga0207675_100109446
317 Ga0207683_11719249
318 Ga0207698_10560585
319 Ga0268265_10635561
320 Ga0268264_10017508
321 Ga0268264_10089142
322 Ga0265762_1040326
323 Ga0307408_100446627
324 Ga0307405_10775340
325 Ga0307413_10040614
326 Ga0307410_10021056
327 Ga0307407_10003128
328 Ga0307409_100019006
329 Ga0307416_100039548
330 Ga0307411_10023775
331 Ga0307415_100015206
332 Ga0373933_0471220
333 Ga0373937_0123624
334 Ga0400485_11540
335 Ga0436365_0235890
336 Ga0436362_0518279
337 Ga0436362_0960849
338 Ga0439439_0070148
339 Ga0451789_1325328
340 Ga0451791_0876303
341 Ga0451802_1906084
342 Ga0451839_0859384
343 Ga0451839_1344937
344 Ga0451843_0390365
345 Ga0451853_3834357
346 Ga0451853_4035175
347 Ga0439431_0069650
348 Ga0450923_038923
349 Ga0451577_0224655
350 Ga0439440_0142396
351 Ga0466965_0224397
352 Ga0453684_1163317
353 Ga0466960_0553647
354 Ga0495592_0153869
355 Ga0495653_0094875
356 Ga0495653_0106838
357 Ga0495582_0155177
358 Ga0495639_0699855
359 Ga0495662_0409210
360 Ga0495608_0402831
361 Ga0495628_0935663
362 Ga0495652_0996301
363 Ga0495587_0060191
364 Ga0495621_0221932
365 Ga0495645_0527064
366 Ga0495667_0182969
367 Ga0495667_0210662
368 Ga0495634_0320693
369 Ga0495657_0205718
370 Ga0495657_0461448
371 Ga0495599_0124800
372 Ga0495599_0300596
373 Ga0495624_0162979
374 Ga0495600_0562087
375 Ga0495604_0275126
376 Ga0495676_0503066
377 Ga0495680_0194878
378 Ga0495685_230487
379 Ga0495684_0075428
380 Ga0495593_0132841
381 Ga0495602_0408419
382 Ga0496100_0832081
383 Ga0496101_0295455
384 Ga0496102_1299558
385 Ga0496102_1954705
386 Ga0496105_0399699
387 Ga0496108_0410591
388 Ga0496109_1855856
389 Ga0496111_0132044
390 Ga0496114_1052148
391 Ga0496118_0092785
392 Ga0501033_0394426
393 Ga0501034_0000290
394 Ga0501036_0179196
395 Ga0501038_0061572
396 Ga0501039_0129770
397 Ga0501040_0029881
398 Ga0501041_0071228
399 Ga0501042_0425621
400 Ga0501046_0181432
401 Ga0501048_0101559
402 Ga0501068_0006405
403 Ga0501068_0340101
404 Ga0501069_0310193
405 Ga0501071_0581025
406 Ga0501072_0014009
407 Ga0501072_0062619
408 Ga0501073_0008750
409 Ga0501073_0766768
410 Ga0501074_0003552
411 Ga0501074_0119693
412 Ga0501075_0075796
413 Ga0501076_0014723
414 Ga0501076_0079554
415 Ga0501076_1678354
416 Ga0501077_0082054
417 Ga0501079_0017596
418 Ga0501080_0086781
419 Ga0501080_0099439
420 Ga0501080_0890823
421 Ga0501083_0024058
422 Ga0501083_0307795
423 Ga0501045_0071189
424 nmdc:mga03683_159021_c1
425 nmdc:mga03n38_260282_c1
426 nmdc:mga03n38_442501_c1
427 nmdc:mga03n38_751642_c1
428 nmdc:mga00v17_219677_c1
429 nmdc:mga00v17_485245_c1
430 nmdc:mga00v17_67428_c1
431 nmdc:mga0yw44_1033924_c1
432 nmdc:mga0yw44_305792_c1
433 nmdc:mga0yw44_513190_c1
434 nmdc:mga0yw44_607204_c1
435 nmdc:mga06z11_66662_c1
436 nmdc:mga07m45_357568_c1
437 nmdc:mga0rr50_159852_c1
438 Ga0495601_0618537
439 Ga0495601_0951579
440 Ga0500583_0264369
441 Ga0500616_0095576
442 Ga0501084_0190082
443 Ga0590074_027343
444 Ga0587125_057577
445 Ga0501082_0022534
446 Ga0530510_0198264
447 Ga0530510_1149991
448 2508674241
449 2517763159
450 2579852345
451 2619855654
452 2620348183
453 2626635064
454 2676203057
455 2689959915
456 2774847633
457 8002777787
458 8002788854
459 8054919032
460 8054922453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

58

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pyt-assembly1.cif.gz_A benzoylsuccinyl-coa thiolase with coenzyme a 0.7748 9 122
6et9-assembly1.cif.gz_F structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.7652 18 122
5m3k-assembly1.cif.gz_E a multi-component acyltransferase phlabc from pseudomonas protegens 0.7618 20 120
7pyt-assembly1.cif.gz_A benzoylsuccinyl-coa thiolase with coenzyme a 0.7176 9 122
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.7132 18 122
ID Description Score Start End Superfamily
af_P37009_273_344_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7165 43 96 2.40.50.140
af_Q57653_1_80_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6943 43 98 2.30.30.140
3f6gA01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6469 48 80 3.30.160.740
3irbB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6325 46 120 2.40.50.140
af_Q54D33_66_196_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6293 46 80 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A7X6AST1-F1-model_v4 DUF35 domain-containing protein 0.9429 7 120
AF-A0A7K1Z9L4-F1-model_v4 DUF35 domain-containing protein 0.9323 7 120
AF-A0A3M2HCM3-F1-model_v4 DUF35 domain-containing protein 0.9292 7 121
AF-A0A0Q6JG89-F1-model_v4 DUF35 domain-containing protein 0.9273 7 120
AF-A0A6I3DHV5-F1-model_v4 DUF35 domain-containing protein 0.9242 36 122

Map