F343079

General Info

Members Datasets Scaffolds Average Seq Length
230 147 460 239

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10667957|Ga0207681_106679571
Length 229
Sequence MLEMHNVTKIYRTGLVETRALRDFTLTVEPGEFVTITGPSGSGKTSFLNVAGLLDSFEQGTYKLDGLDVSRLSDRQMSRIRNEKIGFIFQSFNLIPDLDVADNVDVPLRYRGLSAKERSARMRHLPSQLSGGQQQRVAIARVLAGDPKLILADEPTGNLDSAMAREIMELLDQINEAGTSIIMVTHNPEHAARAHRQLHIADGRMVDIERIAPMPLNQRVVAHPSAARA

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
145 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 0.87
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10667957 3300025923 Bacteria 862
2 Ga0065704_10006189 3300005289 Bacteria 4739
3 Ga0065707_10111881 3300005295 Bacteria 2380
4 Ga0065707_10278295 3300005295 Bacteria 1054
5 Ga0070676_10420647 3300005328 Bacteria 934
6 Ga0070683_100077000 3300005329 Bacteria 3119
7 Ga0070677_10038169 3300005333 Bacteria 1878
8 Ga0068868_100000129 3300005338 Bacteria 48568
9 Ga0070689_100010799 3300005340 Bacteria 6525
10 Ga0070689_100076515 3300005340 Bacteria 2622
11 Ga0070692_10147713 3300005345 Bacteria 1336
12 Ga0070668_100007229 3300005347 Bacteria 8233
13 Ga0070669_100000011 3300005353 Bacteria 216544
14 Ga0070675_100000002 3300005354 Bacteria 435215
15 Ga0070675_100823795 3300005354 Bacteria 849
16 Ga0070671_100000615 3300005355 Bacteria 25452
17 Ga0070673_100117800 3300005364 Bacteria 2211
18 Ga0070667_100057672 3300005367 Bacteria 3283
19 Ga0070700_100000089 3300005441 Bacteria 61717
20 Ga0070700_100051401 3300005441 Bacteria 2565
21 Ga0070708_100001914 3300005445 Bacteria 16026
22 Ga0070708_100019645 3300005445 Bacteria 5682
23 Ga0070708_100058014 3300005445 Bacteria 3449
24 Ga0070708_100066527 3300005445 Bacteria 3235
25 Ga0070708_100640328 3300005445 Bacteria 1002
26 Ga0070662_100001866 3300005457 Bacteria 12913
27 Ga0068867_100081567 3300005459 Bacteria 2438
28 Ga0070685_10032651 3300005466 Bacteria 2917
29 Ga0070706_100009987 3300005467 Bacteria 8814
30 Ga0070706_100046601 3300005467 Bacteria 4002
31 Ga0070707_100012603 3300005468 Bacteria 7897
32 Ga0070707_100022088 3300005468 Bacteria 6015
33 Ga0070698_100007359 3300005471 Bacteria 11919
34 Ga0070698_100033410 3300005471 Bacteria 5328
35 Ga0070698_100112256 3300005471 Bacteria 2691
36 Ga0070698_100683702 3300005471 Bacteria 968
37 Ga0070699_100002075 3300005518 Bacteria 18133
38 Ga0070697_100005423 3300005536 Bacteria 9825
39 Ga0070697_100051150 3300005536 Bacteria 3357
40 Ga0070697_100056981 3300005536 Bacteria 3180
41 Ga0070672_100001261 3300005543 Bacteria 15551
42 Ga0070695_100136840 3300005545 Bacteria 1694
43 Ga0070695_100353139 3300005545 Bacteria 1102
44 Ga0070696_100091856 3300005546 Bacteria 2162
45 Ga0070665_100001480 3300005548 Bacteria 27489
46 Ga0070704_100005949 3300005549 Bacteria 7149
47 Ga0070704_100171854 3300005549 Bacteria 1724
48 Ga0070704_100175016 3300005549 Bacteria 1711
49 Ga0070704_100402745 3300005549 Bacteria 1168
50 Ga0070704_100626258 3300005549 Bacteria 948
51 Ga0070702_100672118 3300005615 Bacteria 786
52 Ga0068859_100000040 3300005617 Bacteria 162782
53 Ga0068861_100004245 3300005719 Bacteria 9606
54 Ga0068861_100085755 3300005719 Bacteria 2474
55 Ga0068861_100379334 3300005719 Bacteria 1249
56 Ga0068858_100000834 3300005842 Bacteria 32088
57 Ga0068862_100000397 3300005844 Bacteria 47021
58 Ga0068862_100001853 3300005844 Bacteria 19160
59 Ga0075367_10359124 3300006178 Bacteria 920
60 Ga0097621_100323178 3300006237 Bacteria 1367
61 Ga0075428_100022061 3300006844 Bacteria 7049
62 Ga0075428_100072868 3300006844 Bacteria 3751
63 Ga0075428_100089730 3300006844 Bacteria 3353
64 Ga0075428_100355865 3300006844 Bacteria 1571
65 Ga0075428_100426101 3300006844 Bacteria 1422
66 Ga0075430_100312815 3300006846 Bacteria 1299
67 Ga0075431_100002308 3300006847 Bacteria 18323
68 Ga0075433_10001133 3300006852 Bacteria 19292
69 Ga0075433_10171575 3300006852 Bacteria 1930
70 Ga0075434_100071941 3300006871 Bacteria 3450
71 Ga0075429_100011348 3300006880 Bacteria 7714
72 Ga0075429_100087526 3300006880 Bacteria 2715
73 Ga0097620_100000040 3300006931 Bacteria 162782
74 Ga0075435_100297497 3300007076 Bacteria 1380
75 Ga0105244_10049628 3300009036 Bacteria 2144
76 Ga0105240_10009352 3300009093 Bacteria 13890
77 Ga0111539_10000024 3300009094 Bacteria 197871
78 Ga0111539_10060660 3300009094 Bacteria 4482
79 Ga0105245_10000190 3300009098 Bacteria 57837
80 Ga0105245_10063501 3300009098 Bacteria 3335
81 Ga0105245_10262465 3300009098 Bacteria 1681
82 Ga0114129_10029231 3300009147 Bacteria 7805
83 Ga0114129_10031233 3300009147 Bacteria 7532
84 Ga0114129_10035982 3300009147 Bacteria 6993
85 Ga0114129_10075588 3300009147 Bacteria 4690
86 Ga0114129_10108624 3300009147 Bacteria 3830
87 Ga0114129_10175222 3300009147 Bacteria 2921
88 Ga0114129_10350596 3300009147 Bacteria 1956
89 Ga0105242_10007613 3300009176 Bacteria 8338
90 Ga0105238_10000001 3300009551 Bacteria 2036163
91 Ga0105249_10005396 3300009553 Bacteria 11034
92 Ga0105239_10069238 3300010375 Bacteria 3877
93 Ga0157374_10000010 3300013296 Bacteria 505635
94 Ga0157378_10064457 3300013297 Bacteria 3278
95 Ga0157375_10002454 3300013308 Bacteria 16054
96 Ga0157380_10003252 3300014326 Bacteria 11123
97 Ga0157380_10057777 3300014326 Bacteria 3091
98 Ga0157380_10093781 3300014326 Bacteria 2483
99 Ga0157377_10000015 3300014745 Bacteria 190735
100 Ga0157377_10259796 3300014745 Bacteria 1129
101 Ga0213873_10000005 3300021358 Bacteria 416778
102 Ga0213874_10001456 3300021377 Bacteria 4903
103 Ga0213876_10000010 3300021384 Bacteria 492549
104 Ga0213876_10000014 3300021384 Bacteria 310412
105 Ga0213876_10028494 3300021384 Bacteria 2945
106 Ga0213876_10049789 3300021384 Bacteria 2214
107 Ga0213876_10174561 3300021384 Bacteria 1143
108 Ga0209257_1038027 3300025304 Bacteria 1462
109 Ga0207655_1082728 3300025728 Bacteria 1153
110 Ga0207682_10041409 3300025893 Bacteria 1880
111 Ga0207643_10022578 3300025908 Bacteria 3465
112 Ga0207705_10218896 3300025909 Bacteria 1446
113 Ga0207684_10002038 3300025910 Bacteria 20809
114 Ga0207684_10019064 3300025910 Bacteria 5869
115 Ga0207684_10324159 3300025910 Bacteria 1327
116 Ga0207695_10015967 3300025913 Bacteria 8814
117 Ga0207649_10229124 3300025920 Bacteria 1328
118 Ga0207646_10015693 3300025922 Bacteria 7139
119 Ga0207646_10121625 3300025922 Bacteria 2345
120 Ga0207681_10000012 3300025923 Bacteria 361565
121 Ga0207681_10003519 3300025923 Bacteria 9751
122 Ga0207694_10000001 3300025924 Bacteria 4078485
123 Ga0207659_10000031 3300025926 Bacteria 121432
124 Ga0207687_10000400 3300025927 Bacteria 29450
125 Ga0207687_10047505 3300025927 Bacteria 2976
126 Ga0207644_10000143 3300025931 Bacteria 51107
127 Ga0207706_10001385 3300025933 Bacteria 24183
128 Ga0207686_10108128 3300025934 Bacteria 1870
129 Ga0207670_10002323 3300025936 Bacteria 9965
130 Ga0207691_10003195 3300025940 Bacteria 16006
131 Ga0207689_10062085 3300025942 Bacteria 3073
132 Ga0207661_10057548 3300025944 Bacteria 3126
133 Ga0207651_10132911 3300025960 Bacteria 1908
134 Ga0207651_10623653 3300025960 Bacteria 945
135 Ga0207712_10007325 3300025961 Bacteria 6964
136 Ga0207712_10081199 3300025961 Bacteria 2360
137 Ga0207668_10004798 3300025972 Bacteria 7959
138 Ga0207640_10097511 3300025981 Bacteria 2052
139 Ga0207640_10462275 3300025981 Bacteria 1048
140 Ga0207658_10365996 3300025986 Bacteria 1259
141 Ga0207677_10000001 3300026023 Bacteria 534789
142 Ga0207703_10000219 3300026035 Bacteria 66018
143 Ga0207639_10000133 3300026041 Bacteria 54565
144 Ga0207708_10000001 3300026075 Bacteria 467100
145 Ga0207708_10037804 3300026075 Bacteria 3677
146 Ga0207675_100003846 3300026118 Bacteria 14597
147 Ga0209970_1010876 3300027614 Bacteria 1493
148 Ga0209971_1024288 3300027682 Bacteria 1447
149 Ga0209998_10004880 3300027717 Bacteria 2822
150 Ga0209974_10006919 3300027876 Bacteria 3930
151 Ga0207428_10000044 3300027907 Bacteria 198046
152 Ga0207428_10081218 3300027907 Bacteria 2531
153 Ga0207428_10127436 3300027907 Bacteria 1949
154 Ga0207428_10259661 3300027907 Bacteria 1294
155 Ga0268266_10002449 3300028379 Bacteria 19902
156 Ga0268265_10000313 3300028380 Bacteria 53636
157 Ga0268265_10000426 3300028380 Bacteria 45123
158 Ga0268264_10794369 3300028381 Bacteria 945
159 Ga0307408_100657398 3300031548 Bacteria 938
160 Ga0316576_10404304 3300031727 Bacteria 1012
161 Ga0307409_100151306 3300031995 Bacteria 2015
162 Ga0373929_0000001 3300035085 Bacteria 956023
163 Ga0373932_0000257 3300035112 Bacteria 16179
164 Ga0373943_0322838 3300035170 Bacteria 880
165 Ga0373961_0002307 3300035241 Bacteria 4986
166 Ga0436365_0224195 3300039437 Bacteria 60206
167 Ga0436365_0575070 3300039437 Bacteria 8658
168 Ga0436365_0703337 3300039437 Bacteria 1867
169 Ga0436365_0893622 3300039437 Bacteria 92486
170 Ga0436365_1833765 3300039437 Bacteria 2173
171 Ga0436363_0681711 3300039450 Bacteria 9541
172 Ga0436363_0698936 3300039450 Bacteria 777
173 Ga0436362_0273161 3300039453 Bacteria 561309
174 Ga0439431_0076027 3300041997 Bacteria 901
175 Ga0439445_0040170 3300042004 Bacteria 1241
176 Ga0451577_0112823 3300042876 Bacteria 2433
177 Ga0451577_0237171 3300042876 Bacteria 1650
178 Ga0453684_0019509 3300044712 Bacteria 10315
179 Ga0466958_0163415 3300045836 Bacteria 1408
180 Ga0495580_0015496 3300046472 Bacteria 5748
181 Ga0495620_0004564 3300046515 Bacteria 7793
182 Ga0495636_0177084 3300047318 Bacteria 966
183 Ga0495684_0005456 3300047471 Bacteria 9897
184 Ga0495602_0049881 3300048088 Bacteria 3745
185 Ga0496104_0320343 3300048907 Bacteria 1463
186 Ga0496114_0000013 3300048917 Bacteria 317623
187 Ga0501040_0180077 3300049576 Bacteria 1498
188 Ga0501042_0509811 3300049578 Bacteria 874
189 Ga0501067_0158517 3300049583 Bacteria 1260
190 Ga0501068_0017135 3300049584 Bacteria 4187
191 Ga0501072_0503377 3300049588 Bacteria 958
192 Ga0501073_0001663 3300049589 Bacteria 16483
193 Ga0501075_0001254 3300049591 Bacteria 16452
194 Ga0501075_0105995 3300049591 Bacteria 2136
195 Ga0501076_0053335 3300049592 Bacteria 3204
196 Ga0501076_0063511 3300049592 Bacteria 2942
197 Ga0501077_0000136 3300049593 Bacteria 40352
198 Ga0501079_0080821 3300049741 Bacteria 2513
199 Ga0501079_0106062 3300049741 Bacteria 2180
200 Ga0501080_0372559 3300049742 Bacteria 1287
201 Ga0501081_0039254 3300049743 Bacteria 3239
202 Ga0501083_0000571 3300049744 Bacteria 23629
203 Ga0501045_0161633 3300049824 Bacteria 1667
204 nmdc:mga0k408_521103_c1 3300050493 Bacteria 704
205 nmdc:mga05p37_181140_c1 3300050507 Bacteria 2563
206 nmdc:mga05p37_218323_c1 3300050507 Bacteria 2302
207 nmdc:mga05p37_40561_c1 3300050507 Bacteria 5717
208 nmdc:mga05p37_528211_c1 3300050507 Bacteria 1348
209 nmdc:mga05p37_60791_c1 3300050507 Bacteria 4651
210 nmdc:mga05p37_88784_c1 3300050507 Bacteria 3810
211 nmdc:mga09592_67377_c1 3300050508 Bacteria 3036
212 nmdc:mga06r32_1348_c1 3300050510 Bacteria 22148
213 nmdc:mga08y16_144006_c1 3300050511 Bacteria 2477
214 nmdc:mga08y16_19233_c1 3300050511 Bacteria 7197
215 nmdc:mga08y16_24559_c1 3300050511 Bacteria 6360
216 nmdc:mga08y16_29_c1 3300050511 Bacteria 198046
217 nmdc:mga08y16_406153_c1 3300050511 Bacteria 1393
218 nmdc:mga08y16_60506_c1 3300050511 Bacteria 3955
219 nmdc:mga0n895_331558_c1 3300050512 Bacteria 1542
220 nmdc:mga0n895_59437_c1 3300050512 Bacteria 3771
221 nmdc:mga0rr50_109220_c1 3300050513 Bacteria 2186
222 nmdc:mga0rr50_321789_c1 3300050513 Bacteria 1297
223 nmdc:mga0rr50_368431_c1 3300050513 Bacteria 1210
224 nmdc:mga0a205_155339_c2 3300050515 Bacteria 1365
225 nmdc:mga0a205_591386_c1 3300050515 Bacteria 963
226 Ga0500617_010808 3300053124 Bacteria 3789
227 Ga0500588_0000973 3300053146 Bacteria 5125
228 Ga0501082_0000026 3300060353 Bacteria 101000
229 Ga0501082_0158054 3300060353 Bacteria 1969
230 Ga0530510_0172143 3300061734 Bacteria 1604
231 Ga0207681_10667957
232 Ga0065704_10006189
233 Ga0065707_10111881
234 Ga0065707_10278295
235 Ga0070676_10420647
236 Ga0070683_100077000
237 Ga0070677_10038169
238 Ga0068868_100000129
239 Ga0070689_100010799
240 Ga0070689_100076515
241 Ga0070692_10147713
242 Ga0070668_100007229
243 Ga0070669_100000011
244 Ga0070675_100000002
245 Ga0070675_100823795
246 Ga0070671_100000615
247 Ga0070673_100117800
248 Ga0070667_100057672
249 Ga0070700_100000089
250 Ga0070700_100051401
251 Ga0070708_100001914
252 Ga0070708_100019645
253 Ga0070708_100058014
254 Ga0070708_100066527
255 Ga0070708_100640328
256 Ga0070662_100001866
257 Ga0068867_100081567
258 Ga0070685_10032651
259 Ga0070706_100009987
260 Ga0070706_100046601
261 Ga0070707_100012603
262 Ga0070707_100022088
263 Ga0070698_100007359
264 Ga0070698_100033410
265 Ga0070698_100112256
266 Ga0070698_100683702
267 Ga0070699_100002075
268 Ga0070697_100005423
269 Ga0070697_100051150
270 Ga0070697_100056981
271 Ga0070672_100001261
272 Ga0070695_100136840
273 Ga0070695_100353139
274 Ga0070696_100091856
275 Ga0070665_100001480
276 Ga0070704_100005949
277 Ga0070704_100171854
278 Ga0070704_100175016
279 Ga0070704_100402745
280 Ga0070704_100626258
281 Ga0070702_100672118
282 Ga0068859_100000040
283 Ga0068861_100004245
284 Ga0068861_100085755
285 Ga0068861_100379334
286 Ga0068858_100000834
287 Ga0068862_100000397
288 Ga0068862_100001853
289 Ga0075367_10359124
290 Ga0097621_100323178
291 Ga0075428_100022061
292 Ga0075428_100072868
293 Ga0075428_100089730
294 Ga0075428_100355865
295 Ga0075428_100426101
296 Ga0075430_100312815
297 Ga0075431_100002308
298 Ga0075433_10001133
299 Ga0075433_10171575
300 Ga0075434_100071941
301 Ga0075429_100011348
302 Ga0075429_100087526
303 Ga0097620_100000040
304 Ga0075435_100297497
305 Ga0105244_10049628
306 Ga0105240_10009352
307 Ga0111539_10000024
308 Ga0111539_10060660
309 Ga0105245_10000190
310 Ga0105245_10063501
311 Ga0105245_10262465
312 Ga0114129_10029231
313 Ga0114129_10031233
314 Ga0114129_10035982
315 Ga0114129_10075588
316 Ga0114129_10108624
317 Ga0114129_10175222
318 Ga0114129_10350596
319 Ga0105242_10007613
320 Ga0105238_10000001
321 Ga0105249_10005396
322 Ga0105239_10069238
323 Ga0157374_10000010
324 Ga0157378_10064457
325 Ga0157375_10002454
326 Ga0157380_10003252
327 Ga0157380_10057777
328 Ga0157380_10093781
329 Ga0157377_10000015
330 Ga0157377_10259796
331 Ga0213873_10000005
332 Ga0213874_10001456
333 Ga0213876_10000010
334 Ga0213876_10000014
335 Ga0213876_10028494
336 Ga0213876_10049789
337 Ga0213876_10174561
338 Ga0209257_1038027
339 Ga0207655_1082728
340 Ga0207682_10041409
341 Ga0207643_10022578
342 Ga0207705_10218896
343 Ga0207684_10002038
344 Ga0207684_10019064
345 Ga0207684_10324159
346 Ga0207695_10015967
347 Ga0207649_10229124
348 Ga0207646_10015693
349 Ga0207646_10121625
350 Ga0207681_10000012
351 Ga0207681_10003519
352 Ga0207694_10000001
353 Ga0207659_10000031
354 Ga0207687_10000400
355 Ga0207687_10047505
356 Ga0207644_10000143
357 Ga0207706_10001385
358 Ga0207686_10108128
359 Ga0207670_10002323
360 Ga0207691_10003195
361 Ga0207689_10062085
362 Ga0207661_10057548
363 Ga0207651_10132911
364 Ga0207651_10623653
365 Ga0207712_10007325
366 Ga0207712_10081199
367 Ga0207668_10004798
368 Ga0207640_10097511
369 Ga0207640_10462275
370 Ga0207658_10365996
371 Ga0207677_10000001
372 Ga0207703_10000219
373 Ga0207639_10000133
374 Ga0207708_10000001
375 Ga0207708_10037804
376 Ga0207675_100003846
377 Ga0209970_1010876
378 Ga0209971_1024288
379 Ga0209998_10004880
380 Ga0209974_10006919
381 Ga0207428_10000044
382 Ga0207428_10081218
383 Ga0207428_10127436
384 Ga0207428_10259661
385 Ga0268266_10002449
386 Ga0268265_10000313
387 Ga0268265_10000426
388 Ga0268264_10794369
389 Ga0307408_100657398
390 Ga0316576_10404304
391 Ga0307409_100151306
392 Ga0373929_0000001
393 Ga0373932_0000257
394 Ga0373943_0322838
395 Ga0373961_0002307
396 Ga0436365_0224195
397 Ga0436365_0575070
398 Ga0436365_0703337
399 Ga0436365_0893622
400 Ga0436365_1833765
401 Ga0436363_0681711
402 Ga0436363_0698936
403 Ga0436362_0273161
404 Ga0439431_0076027
405 Ga0439445_0040170
406 Ga0451577_0112823
407 Ga0451577_0237171
408 Ga0453684_0019509
409 Ga0466958_0163415
410 Ga0495580_0015496
411 Ga0495620_0004564
412 Ga0495636_0177084
413 Ga0495684_0005456
414 Ga0495602_0049881
415 Ga0496104_0320343
416 Ga0496114_0000013
417 Ga0501040_0180077
418 Ga0501042_0509811
419 Ga0501067_0158517
420 Ga0501068_0017135
421 Ga0501072_0503377
422 Ga0501073_0001663
423 Ga0501075_0001254
424 Ga0501075_0105995
425 Ga0501076_0053335
426 Ga0501076_0063511
427 Ga0501077_0000136
428 Ga0501079_0080821
429 Ga0501079_0106062
430 Ga0501080_0372559
431 Ga0501081_0039254
432 Ga0501083_0000571
433 Ga0501045_0161633
434 nmdc:mga0k408_521103_c1
435 nmdc:mga05p37_181140_c1
436 nmdc:mga05p37_218323_c1
437 nmdc:mga05p37_40561_c1
438 nmdc:mga05p37_528211_c1
439 nmdc:mga05p37_60791_c1
440 nmdc:mga05p37_88784_c1
441 nmdc:mga09592_67377_c1
442 nmdc:mga06r32_1348_c1
443 nmdc:mga08y16_144006_c1
444 nmdc:mga08y16_19233_c1
445 nmdc:mga08y16_24559_c1
446 nmdc:mga08y16_29_c1
447 nmdc:mga08y16_406153_c1
448 nmdc:mga08y16_60506_c1
449 nmdc:mga0n895_331558_c1
450 nmdc:mga0n895_59437_c1
451 nmdc:mga0rr50_109220_c1
452 nmdc:mga0rr50_321789_c1
453 nmdc:mga0rr50_368431_c1
454 nmdc:mga0a205_155339_c2
455 nmdc:mga0a205_591386_c1
456 Ga0500617_010808
457 Ga0500588_0000973
458 Ga0501082_0000026
459 Ga0501082_0158054
460 Ga0530510_0172143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

157

0.85

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

63

190

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9767 1 217
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.968 2 218
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9641 1 217
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9637 2 216
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9561 1 217
ID Description Score Start End Superfamily
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 1 222 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9641 1 217 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9608 1 216 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9603 2 218 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9576 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C0VQU0-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9781 2 171 GO:0005524
GO:0016887
AF-A0A7C1E355-F1-model_v4 ABC transporter ATP-binding protein 0.9764 2 217 GO:0005524
GO:0016887
AF-A0A1G1W5G6-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9746 1 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3N5FSY3-F1-model_v4 ABC transporter ATP-binding protein 0.9741 2 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0D7KEI4-F1-model_v4 ABC transporter domain-containing protein 0.9733 100 218 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map