F343035

General Info

Members Datasets Scaffolds Average Seq Length
230 158 460 235

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10004634|Ga0157380_100046343
Length 262
Sequence VFFANWRALLQRIYTRHSRELLAFAARMETTKPRILVVEDEAAIRDGLADVLVYHGFRVDAVGDGRDGMHKALSGQYDLLLLDVMLPGCDGFAICDAVRKIDRDQPIIMLTAKTTDEDIVNGLSLGADDYIAKPFSIAQLVLRVKAVLRRSKTTAAAAAQIKLAGDVEIDTRNLSGRRGSAPLTFTRREMEILEYLQRNSERPVSRDELLTRVWGYDRSAEIETRTVDIHIAKLRRKIEPDAKEPRNLITVRGTGYRLVVSA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
100 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
112 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
113 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
114 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
115 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
118 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
119 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
155 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 3.48
Rhizosphere 89.57
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10004634 3300014326 Bacteria 9557
2 Ga0065707_10458688 3300005295 Bacteria 793
3 Ga0070670_100203257 3300005331 Bacteria 1721
4 Ga0068869_100160426 3300005334 Bacteria 1750
5 Ga0070666_10019694 3300005335 Bacteria 4359
6 Ga0070680_100369509 3300005336 Bacteria 1220
7 Ga0070682_100043434 3300005337 Bacteria 2779
8 Ga0070689_100011953 3300005340 Bacteria 6235
9 Ga0070689_100074793 3300005340 Bacteria 2651
10 Ga0070691_10054814 3300005341 Bacteria 1909
11 Ga0070687_100058361 3300005343 Bacteria 2027
12 Ga0070692_10035914 3300005345 Bacteria 2512
13 Ga0070668_100554256 3300005347 Bacteria 1001
14 Ga0070675_100257301 3300005354 Bacteria 1529
15 Ga0070675_100418473 3300005354 Bacteria 1198
16 Ga0070688_100306466 3300005365 Bacteria 1149
17 Ga0070667_100158146 3300005367 Bacteria 1994
18 Ga0070701_10010627 3300005438 Bacteria 4079
19 Ga0070694_100060873 3300005444 Bacteria 2576
20 Ga0070708_100547051 3300005445 Bacteria 1092
21 Ga0070678_100063548 3300005456 Bacteria 2732
22 Ga0070662_100670133 3300005457 Bacteria 876
23 Ga0068867_100025383 3300005459 Bacteria 4252
24 Ga0068867_100374192 3300005459 Bacteria 1195
25 Ga0070685_10177149 3300005466 Bacteria 1370
26 Ga0070679_100392053 3300005530 Bacteria 1335
27 Ga0070684_100012566 3300005535 Bacteria 6792
28 Ga0070672_100404052 3300005543 Bacteria 1171
29 Ga0070696_100289383 3300005546 Bacteria 1251
30 Ga0070665_100702168 3300005548 Bacteria 1025
31 Ga0070704_100025912 3300005549 Bacteria 3866
32 Ga0070704_100350481 3300005549 Bacteria 1246
33 Ga0068856_100675243 3300005614 Bacteria 1054
34 Ga0068859_100153358 3300005617 Bacteria 2380
35 Ga0068859_100333658 3300005617 Bacteria 1611
36 Ga0068859_100865041 3300005617 Bacteria 990
37 Ga0068864_100059953 3300005618 Bacteria 3294
38 Ga0068864_100067160 3300005618 Bacteria 3113
39 Ga0068861_100033525 3300005719 Bacteria 3789
40 Ga0068861_100437955 3300005719 Bacteria 1168
41 Ga0068870_10377491 3300005840 Bacteria 917
42 Ga0068863_100005852 3300005841 Bacteria 12048
43 Ga0068863_100049889 3300005841 Bacteria 3968
44 Ga0068863_100131488 3300005841 Bacteria 2390
45 Ga0068863_100306626 3300005841 Bacteria 1540
46 Ga0068858_100024429 3300005842 Bacteria 5630
47 Ga0068860_100067627 3300005843 Bacteria 3394
48 Ga0068860_100208467 3300005843 Bacteria 1895
49 Ga0068860_100392393 3300005843 Bacteria 1372
50 Ga0068860_100707263 3300005843 Bacteria 1017
51 Ga0068862_100331066 3300005844 Bacteria 1408
52 Ga0068862_100371031 3300005844 Bacteria 1332
53 Ga0070715_10013276 3300006163 Bacteria 3021
54 Ga0097621_100029435 3300006237 Bacteria 4337
55 Ga0068871_100697772 3300006358 Bacteria 930
56 Ga0075431_100001136 3300006847 Bacteria 23886
57 Ga0075434_100702349 3300006871 Bacteria 1029
58 Ga0075429_100098527 3300006880 Bacteria 2550
59 Ga0075436_100442072 3300006914 Bacteria 946
60 Ga0097620_100153358 3300006931 Bacteria 2380
61 Ga0097620_100333661 3300006931 Bacteria 1611
62 Ga0097620_100865058 3300006931 Bacteria 990
63 Ga0075435_100107612 3300007076 Bacteria 2316
64 Ga0105240_10383294 3300009093 Bacteria 1587
65 Ga0111539_10031667 3300009094 Bacteria 6424
66 Ga0111539_10043519 3300009094 Bacteria 5382
67 Ga0105245_10004141 3300009098 Bacteria 12883
68 Ga0114129_10879100 3300009147 Bacteria 1137
69 Ga0105242_10480150 3300009176 Bacteria 1178
70 Ga0105248_10026155 3300009177 Bacteria 6493
71 Ga0105238_10001930 3300009551 Bacteria 20828
72 Ga0105249_10003070 3300009553 Bacteria 14419
73 Ga0105249_10820944 3300009553 Bacteria 994
74 Ga0105246_10003608 3300011119 Bacteria 9361
75 Ga0105246_10223709 3300011119 Bacteria 1477
76 Ga0157374_10584841 3300013296 Bacteria 1126
77 Ga0157378_10000389 3300013297 Bacteria 43375
78 Ga0157378_10080829 3300013297 Bacteria 2937
79 Ga0157378_10178668 3300013297 Bacteria 1995
80 Ga0157375_10070419 3300013308 Bacteria 3507
81 Ga0157375_10243731 3300013308 Bacteria 1957
82 Ga0157375_11220155 3300013308 Bacteria 883
83 Ga0163163_10000041 3300014325 Bacteria 142066
84 Ga0163163_10017277 3300014325 Bacteria 6726
85 Ga0163163_10036417 3300014325 Bacteria 4780
86 Ga0163163_10106208 3300014325 Bacteria 2834
87 Ga0157380_10519606 3300014326 Bacteria 1161
88 Ga0157379_10027118 3300014968 Bacteria 5099
89 Ga0157376_10022760 3300014969 Bacteria 4892
90 Ga0207656_10073497 3300025321 Bacteria 1524
91 Ga0207680_10064391 3300025903 Bacteria 2247
92 Ga0207694_10024773 3300025924 Bacteria 4558
93 Ga0207694_10190143 3300025924 Bacteria 1667
94 Ga0207659_10341611 3300025926 Bacteria 1240
95 Ga0207706_10313985 3300025933 Bacteria 1365
96 Ga0207709_10020153 3300025935 Bacteria 3758
97 Ga0207670_10067565 3300025936 Bacteria 2460
98 Ga0207691_10230316 3300025940 Bacteria 1605
99 Ga0207689_10130344 3300025942 Bacteria 2069
100 Ga0207689_10181617 3300025942 Bacteria 1735
101 Ga0207679_10206785 3300025945 Bacteria 1643
102 Ga0207651_10427442 3300025960 Bacteria 1132
103 Ga0207677_10113505 3300026023 Bacteria 2022
104 Ga0207703_10043731 3300026035 Bacteria 3596
105 Ga0207708_10081101 3300026075 Bacteria 2493
106 Ga0207708_10147418 3300026075 Bacteria 1850
107 Ga0207641_10032001 3300026088 Bacteria 4365
108 Ga0207641_10060625 3300026088 Bacteria 3225
109 Ga0207641_10084310 3300026088 Bacteria 2766
110 Ga0207641_10287523 3300026088 Bacteria 1549
111 Ga0207648_10063905 3300026089 Bacteria 3208
112 Ga0207648_10229292 3300026089 Bacteria 1652
113 Ga0207648_10530961 3300026089 Bacteria 1079
114 Ga0207676_10112121 3300026095 Bacteria 2284
115 Ga0207676_10884442 3300026095 Bacteria 875
116 Ga0207675_100003705 3300026118 Bacteria 14886
117 Ga0207675_100280920 3300026118 Bacteria 1618
118 Ga0207683_10403050 3300026121 Bacteria 1258
119 Ga0207428_10175372 3300027907 Bacteria 1622
120 Ga0268266_10165339 3300028379 Bacteria 2004
121 Ga0268265_10003835 3300028380 Bacteria 10644
122 Ga0268265_10031638 3300028380 Bacteria 3823
123 Ga0268265_10148997 3300028380 Bacteria 1971
124 Ga0268265_11161390 3300028380 Bacteria 768
125 Ga0268264_10089629 3300028381 Bacteria 2649
126 Ga0268264_10267828 3300028381 Bacteria 1595
127 Ga0268264_10478363 3300028381 Bacteria 1211
128 Ga0265328_10105419 3300031239 Bacteria 1046
129 Ga0265327_10001777 3300031251 Bacteria 25409
130 Ga0265316_10001679 3300031344 Bacteria 23522
131 Ga0307408_100420386 3300031548 Bacteria 1152
132 Ga0316575_10002472 3300031665 Bacteria 6220
133 Ga0316575_10062993 3300031665 Bacteria 1483
134 Ga0316579_10001354 3300031691 Bacteria 8870
135 Ga0316579_10027159 3300031691 Bacteria 2597
136 Ga0316579_10108244 3300031691 Bacteria 1333
137 Ga0316579_10109692 3300031691 Bacteria 1324
138 Ga0316579_10116690 3300031691 Bacteria 1281
139 Ga0316576_10010978 3300031727 Bacteria 5908
140 Ga0316576_10053108 3300031727 Bacteria 2952
141 Ga0316576_10096227 3300031727 Bacteria 2209
142 Ga0316578_10012262 3300031728 Bacteria 4516
143 Ga0316578_10013946 3300031728 Bacteria 4274
144 Ga0316578_10038571 3300031728 Bacteria 2755
145 Ga0316577_10010791 3300031733 Bacteria 4938
146 Ga0316577_10024393 3300031733 Bacteria 3362
147 Ga0316577_10068821 3300031733 Bacteria 1977
148 Ga0307413_10580749 3300031824 Bacteria 914
149 Ga0307416_100112514 3300032002 Bacteria 2402
150 Ga0307411_10113105 3300032005 Bacteria 1947
151 Ga0307415_100213026 3300032126 Bacteria 1543
152 Ga0316583_10029789 3300032133 Bacteria 1945
153 Ga0316583_10095724 3300032133 Bacteria 1035
154 Ga0316585_10000317 3300032137 Bacteria 10828
155 Ga0316580_10001767 3300032139 Bacteria 5784
156 Ga0316580_10006698 3300032139 Bacteria 3405
157 Ga0307507_10117107 3300033179 Bacteria 2149
158 Ga0373939_0076388 3300035114 Bacteria 1103
159 Ga0373941_0125039 3300035115 Bacteria 921
160 Ga0373953_0089159 3300035117 Bacteria 1289
161 Ga0316574_0001200 3300035398 Bacteria 12022
162 Ga0316574_0010488 3300035398 Bacteria 5240
163 Ga0316574_0038759 3300035398 Bacteria 2927
164 Ga0316574_0109136 3300035398 Bacteria 1773
165 Ga0316574_0601152 3300035398 Bacteria 680
166 Ga0373931_0076652 3300035691 Bacteria 1837
167 Ga0373927_0074563 3300035695 Bacteria 2197
168 Ga0373937_0040812 3300036401 Bacteria 4231
169 Ga0373937_0334542 3300036401 Bacteria 1433
170 Ga0316582_0004539 3300036647 Bacteria 7030
171 Ga0316582_0259758 3300036647 Bacteria 1191
172 Ga0316584_0021571 3300036712 Bacteria 4683
173 Ga0316584_0062968 3300036712 Bacteria 2777
174 Ga0316584_0328682 3300036712 Bacteria 1101
175 Ga0316584_0346067 3300036712 Bacteria 1068
176 Ga0316581_0028054 3300037588 Bacteria 1686
177 Ga0316581_0068963 3300037588 Bacteria 1086
178 Ga0400484_22208 3300038725 Bacteria 7376
179 Ga0400485_19713 3300038735 Bacteria 12685
180 Ga0400485_19970 3300038735 Bacteria 64038
181 Ga0400488_24597 3300038741 Bacteria 6430
182 Ga0400488_49302 3300038741 Bacteria 3097
183 Ga0400486_05307 3300038742 Bacteria 38711
184 Ga0400486_20846 3300038742 Bacteria 16732
185 Ga0400483_001640 3300039062 Bacteria 75917
186 Ga0400489_31687 3300039093 Bacteria 1140
187 Ga0400487_26356 3300039110 Bacteria 36232
188 Ga0451849_0152751 3300041505 Bacteria 1983
189 Ga0451853_0708364 3300041512 Bacteria 3156
190 Ga0453684_0412252 3300044712 Bacteria 1511
191 Ga0451576_0487082 3300045051 Bacteria 1295
192 Ga0495603_0166947 3300046455 Bacteria 1275
193 Ga0495641_0097490 3300046461 Bacteria 1312
194 Ga0495586_0089509 3300046535 Bacteria 1699
195 Ga0495587_0150553 3300046536 Bacteria 1326
196 Ga0495588_0319178 3300046674 Bacteria 817
197 Ga0495647_0090733 3300046681 Bacteria 1252
198 Ga0495613_0141560 3300046689 Bacteria 1719
199 Ga0495680_0277297 3300047322 Bacteria 1182
200 Ga0496100_0055184 3300048903 Bacteria 2595
201 Ga0496104_0561205 3300048907 Bacteria 1052
202 Ga0496105_0213065 3300048908 Bacteria 1574
203 Ga0496109_0522162 3300048912 Bacteria 1121
204 Ga0496112_0155904 3300048915 Bacteria 2250
205 Ga0496113_0104217 3300048916 Bacteria 2201
206 Ga0496114_0006793 3300048917 Bacteria 9010
207 Ga0496115_0049623 3300048918 Bacteria 3360
208 Ga0501036_0433321 3300049572 Bacteria 1096
209 Ga0501042_0096528 3300049578 Bacteria 2124
210 Ga0501071_0061045 3300049587 Bacteria 2730
211 Ga0501074_0079757 3300049590 Bacteria 2349
212 Ga0501075_0305984 3300049591 Unclassified 1211
213 Ga0501076_0298956 3300049592 Unclassified 1319
214 Ga0501077_0245003 3300049593 Bacteria 1139
215 Ga0501077_0392347 3300049593 Bacteria 887
216 Ga0501079_0371559 3300049741 Unclassified 1121
217 Ga0501081_0136999 3300049743 Unclassified 1753
218 nmdc:mga09592_53701_c1 3300050508 Bacteria 3403
219 nmdc:mga06r32_4250_c1 3300050510 Bacteria 12827
220 nmdc:mga08y16_461195_c1 3300050511 Bacteria 1295
221 nmdc:mga0n895_559634_c1 3300050512 Bacteria 1149
222 nmdc:mga0rr50_125325_c1 3300050513 Bacteria 2050
223 nmdc:mga0rr50_329775_c1 3300050513 Bacteria 1281
224 Ga0495601_0011933 3300053077 Bacteria 5208
225 Ga0495601_0199957 3300053077 Bacteria 1306
226 Ga0500641_0095006 3300053096 Bacteria 1275
227 Ga0500555_049730 3300053103 Unclassified 1149
228 Ga0501082_0795657 3300060353 Bacteria 827
229 Ga0530510_0224962 3300061734 Unclassified 1395
230 8001523702 8001522603 Bacteria 4726425
231 Ga0157380_10004634
232 Ga0065707_10458688
233 Ga0070670_100203257
234 Ga0068869_100160426
235 Ga0070666_10019694
236 Ga0070680_100369509
237 Ga0070682_100043434
238 Ga0070689_100011953
239 Ga0070689_100074793
240 Ga0070691_10054814
241 Ga0070687_100058361
242 Ga0070692_10035914
243 Ga0070668_100554256
244 Ga0070675_100257301
245 Ga0070675_100418473
246 Ga0070688_100306466
247 Ga0070667_100158146
248 Ga0070701_10010627
249 Ga0070694_100060873
250 Ga0070708_100547051
251 Ga0070678_100063548
252 Ga0070662_100670133
253 Ga0068867_100025383
254 Ga0068867_100374192
255 Ga0070685_10177149
256 Ga0070679_100392053
257 Ga0070684_100012566
258 Ga0070672_100404052
259 Ga0070696_100289383
260 Ga0070665_100702168
261 Ga0070704_100025912
262 Ga0070704_100350481
263 Ga0068856_100675243
264 Ga0068859_100153358
265 Ga0068859_100333658
266 Ga0068859_100865041
267 Ga0068864_100059953
268 Ga0068864_100067160
269 Ga0068861_100033525
270 Ga0068861_100437955
271 Ga0068870_10377491
272 Ga0068863_100005852
273 Ga0068863_100049889
274 Ga0068863_100131488
275 Ga0068863_100306626
276 Ga0068858_100024429
277 Ga0068860_100067627
278 Ga0068860_100208467
279 Ga0068860_100392393
280 Ga0068860_100707263
281 Ga0068862_100331066
282 Ga0068862_100371031
283 Ga0070715_10013276
284 Ga0097621_100029435
285 Ga0068871_100697772
286 Ga0075431_100001136
287 Ga0075434_100702349
288 Ga0075429_100098527
289 Ga0075436_100442072
290 Ga0097620_100153358
291 Ga0097620_100333661
292 Ga0097620_100865058
293 Ga0075435_100107612
294 Ga0105240_10383294
295 Ga0111539_10031667
296 Ga0111539_10043519
297 Ga0105245_10004141
298 Ga0114129_10879100
299 Ga0105242_10480150
300 Ga0105248_10026155
301 Ga0105238_10001930
302 Ga0105249_10003070
303 Ga0105249_10820944
304 Ga0105246_10003608
305 Ga0105246_10223709
306 Ga0157374_10584841
307 Ga0157378_10000389
308 Ga0157378_10080829
309 Ga0157378_10178668
310 Ga0157375_10070419
311 Ga0157375_10243731
312 Ga0157375_11220155
313 Ga0163163_10000041
314 Ga0163163_10017277
315 Ga0163163_10036417
316 Ga0163163_10106208
317 Ga0157380_10519606
318 Ga0157379_10027118
319 Ga0157376_10022760
320 Ga0207656_10073497
321 Ga0207680_10064391
322 Ga0207694_10024773
323 Ga0207694_10190143
324 Ga0207659_10341611
325 Ga0207706_10313985
326 Ga0207709_10020153
327 Ga0207670_10067565
328 Ga0207691_10230316
329 Ga0207689_10130344
330 Ga0207689_10181617
331 Ga0207679_10206785
332 Ga0207651_10427442
333 Ga0207677_10113505
334 Ga0207703_10043731
335 Ga0207708_10081101
336 Ga0207708_10147418
337 Ga0207641_10032001
338 Ga0207641_10060625
339 Ga0207641_10084310
340 Ga0207641_10287523
341 Ga0207648_10063905
342 Ga0207648_10229292
343 Ga0207648_10530961
344 Ga0207676_10112121
345 Ga0207676_10884442
346 Ga0207675_100003705
347 Ga0207675_100280920
348 Ga0207683_10403050
349 Ga0207428_10175372
350 Ga0268266_10165339
351 Ga0268265_10003835
352 Ga0268265_10031638
353 Ga0268265_10148997
354 Ga0268265_11161390
355 Ga0268264_10089629
356 Ga0268264_10267828
357 Ga0268264_10478363
358 Ga0265328_10105419
359 Ga0265327_10001777
360 Ga0265316_10001679
361 Ga0307408_100420386
362 Ga0316575_10002472
363 Ga0316575_10062993
364 Ga0316579_10001354
365 Ga0316579_10027159
366 Ga0316579_10108244
367 Ga0316579_10109692
368 Ga0316579_10116690
369 Ga0316576_10010978
370 Ga0316576_10053108
371 Ga0316576_10096227
372 Ga0316578_10012262
373 Ga0316578_10013946
374 Ga0316578_10038571
375 Ga0316577_10010791
376 Ga0316577_10024393
377 Ga0316577_10068821
378 Ga0307413_10580749
379 Ga0307416_100112514
380 Ga0307411_10113105
381 Ga0307415_100213026
382 Ga0316583_10029789
383 Ga0316583_10095724
384 Ga0316585_10000317
385 Ga0316580_10001767
386 Ga0316580_10006698
387 Ga0307507_10117107
388 Ga0373939_0076388
389 Ga0373941_0125039
390 Ga0373953_0089159
391 Ga0316574_0001200
392 Ga0316574_0010488
393 Ga0316574_0038759
394 Ga0316574_0109136
395 Ga0316574_0601152
396 Ga0373931_0076652
397 Ga0373927_0074563
398 Ga0373937_0040812
399 Ga0373937_0334542
400 Ga0316582_0004539
401 Ga0316582_0259758
402 Ga0316584_0021571
403 Ga0316584_0062968
404 Ga0316584_0328682
405 Ga0316584_0346067
406 Ga0316581_0028054
407 Ga0316581_0068963
408 Ga0400484_22208
409 Ga0400485_19713
410 Ga0400485_19970
411 Ga0400488_24597
412 Ga0400488_49302
413 Ga0400486_05307
414 Ga0400486_20846
415 Ga0400483_001640
416 Ga0400489_31687
417 Ga0400487_26356
418 Ga0451849_0152751
419 Ga0451853_0708364
420 Ga0453684_0412252
421 Ga0451576_0487082
422 Ga0495603_0166947
423 Ga0495641_0097490
424 Ga0495586_0089509
425 Ga0495587_0150553
426 Ga0495588_0319178
427 Ga0495647_0090733
428 Ga0495613_0141560
429 Ga0495680_0277297
430 Ga0496100_0055184
431 Ga0496104_0561205
432 Ga0496105_0213065
433 Ga0496109_0522162
434 Ga0496112_0155904
435 Ga0496113_0104217
436 Ga0496114_0006793
437 Ga0496115_0049623
438 Ga0501036_0433321
439 Ga0501042_0096528
440 Ga0501071_0061045
441 Ga0501074_0079757
442 Ga0501075_0305984
443 Ga0501076_0298956
444 Ga0501077_0245003
445 Ga0501077_0392347
446 Ga0501079_0371559
447 Ga0501081_0136999
448 nmdc:mga09592_53701_c1
449 nmdc:mga06r32_4250_c1
450 nmdc:mga08y16_461195_c1
451 nmdc:mga0n895_559634_c1
452 nmdc:mga0rr50_125325_c1
453 nmdc:mga0rr50_329775_c1
454 Ga0495601_0011933
455 Ga0495601_0199957
456 Ga0500641_0095006
457 Ga0500555_049730
458 Ga0501082_0795657
459 Ga0530510_0224962
460 8001523702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

145

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

180

258

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.976 3 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9664 6 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9659 5 125
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9658 6 122
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9649 6 122
ID Description Score Start End Superfamily
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9873 5 84 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.974 5 84 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9689 6 88 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.964 4 123 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9631 5 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1V5JWS4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9721 4 124 GO:0000155
GO:0005524
GO:0006355
AF-A0A3C0Z4C2-F1-model_v4 DNA-binding response regulator 0.9703 5 125 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A496YIU8-F1-model_v4 deleted 0.9692 5 124
AF-E1R266-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9686 2 123 GO:0000160
GO:0016301
AF-A0A7Y1XLC9-F1-model_v4 Response regulator 0.9644 1 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map