F343027

General Info

Members Datasets Scaffolds Average Seq Length
230 142 460 580

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10012114|Ga0157372_100121142
Length 616
Sequence MKIINNLSALSFITYRLYLKIISLRLYQQKNFVLMKAQRKIASIIVTILFIGLLVSTLIASHTGRFNGNSFTTVQKETALKKYGFYLEPVNKEANINFKHTCPEVDAKLNNIKMQIASMGAAVSICDYDNDGWNDIYFTNSGTGSKNALYHNLHNGKFEDVADEMGLANVNKKGTGASMGAVWGDYDNDGYKDLLLYKWGKPELFKNIDGKKFQNVTEGSGLPAWVNSNGGYYNENFHLDSLNTTKIMPESFRYANNGGRKYLLKNIGNGKFKDVTAEYGLTSTKWVLAAAAADFNGDGYPDLYVADDYNVDELYINEGGKKFTEQGKQAGIGHIPKSGMNVSLGDINNEGALGIFTTNITEQGILIQGNNYWQPKNENPNDLSFVNLAQISGIENAGWSYGAQFGDLNNDGFIDLYVANGFISAKKNTSYWYDYSKVTGGNSTIIGDAKNWPDMQGKSQSGYEEDKIWLNNSDGIFEDVSGKVCPPVTYDGRAVAMADLWNRGVLDVIVANQNNIPVIYKNDAENNNHWIDFDLRGTISNADAVGAKVEIQWDDKKQMQIVTDGIGFSSQNQHRLHFGIGKSNKIDKVTIYWPSGHIDKIENPQTDKLHIIKETK

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
105 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 2.17
Rhizosphere 92.17
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10012114 3300013307 Bacteria 9185
2 JGI25406J46586_10000511 3300003203 Bacteria 18139
3 JGI25406J46586_10002017 3300003203 Bacteria 9590
4 rootH2_10000256 3300003320 Bacteria 54479
5 Ga0065712_10001744 3300005290 Bacteria 9323
6 Ga0065707_10090416 3300005295 Bacteria 4129
7 Ga0070658_10000010 3300005327 Bacteria 297212
8 Ga0070658_10011428 3300005327 Bacteria 7120
9 Ga0070676_10014681 3300005328 Bacteria 4307
10 Ga0070683_100003263 3300005329 Bacteria 13109
11 Ga0070670_100008196 3300005331 Bacteria 8896
12 Ga0070670_100011702 3300005331 Bacteria 7504
13 Ga0068869_100029866 3300005334 Unclassified 3822
14 Ga0068869_100089166 3300005334 Bacteria 2316
15 Ga0068869_100112341 3300005334 Bacteria 2074
16 Ga0070680_100003087 3300005336 Bacteria 12363
17 Ga0070680_100004577 3300005336 Bacteria 10398
18 Ga0068868_100084783 3300005338 Bacteria 2545
19 Ga0070660_100002140 3300005339 Bacteria 13636
20 Ga0070660_100002730 3300005339 Bacteria 12125
21 Ga0070660_100010865 3300005339 Bacteria 6443
22 Ga0070668_100090621 3300005347 Bacteria 2409
23 Ga0070669_100069305 3300005353 Bacteria 2605
24 Ga0070675_100005510 3300005354 Bacteria 9685
25 Ga0070675_100009232 3300005354 Bacteria 7659
26 Ga0070675_100058525 3300005354 Bacteria 3179
27 Ga0070674_100018762 3300005356 Bacteria 4382
28 Ga0070659_100005900 3300005366 Bacteria 8824
29 Ga0070663_100000889 3300005455 Bacteria 16234
30 Ga0070663_100033198 3300005455 Bacteria 3564
31 Ga0070681_10002580 3300005458 Bacteria 16614
32 Ga0070681_10043685 3300005458 Bacteria 4488
33 Ga0070699_100014544 3300005518 Bacteria 6770
34 Ga0070679_100025763 3300005530 Bacteria 5771
35 Ga0070679_100040774 3300005530 Bacteria 4619
36 Ga0070679_100120838 3300005530 Bacteria 2604
37 Ga0070684_100005663 3300005535 Bacteria 9596
38 Ga0068853_100000122 3300005539 Bacteria 52521
39 Ga0068853_100016401 3300005539 Bacteria 6096
40 Ga0070686_100036418 3300005544 Bacteria 3047
41 Ga0070695_100034348 3300005545 Bacteria 3178
42 Ga0070693_100055844 3300005547 Unclassified 2277
43 Ga0070665_100013646 3300005548 Bacteria 8173
44 Ga0070665_100030066 3300005548 Bacteria 5466
45 Ga0068855_100001291 3300005563 Bacteria 31050
46 Ga0068855_100004824 3300005563 Bacteria 16466
47 Ga0068855_100018571 3300005563 Bacteria 8362
48 Ga0068855_100078512 3300005563 Bacteria 3829
49 Ga0070664_100010528 3300005564 Bacteria 7496
50 Ga0070664_100031639 3300005564 Bacteria 4423
51 Ga0068857_100020660 3300005577 Bacteria 5795
52 Ga0068854_100000070 3300005578 Bacteria 73848
53 Ga0068854_100004965 3300005578 Bacteria 8385
54 Ga0068856_100029940 3300005614 Bacteria 5320
55 Ga0068852_100000021 3300005616 Bacteria 126061
56 Ga0068859_100017110 3300005617 Bacteria 7280
57 Ga0068864_100044198 3300005618 Bacteria 3817
58 Ga0068864_100065795 3300005618 Bacteria 3144
59 Ga0068864_100080860 3300005618 Bacteria 2848
60 Ga0081540_1018240 3300005983 Bacteria 4313
61 Ga0081539_10000013 3300005985 Bacteria 432395
62 Ga0081539_10000280 3300005985 Bacteria 115290
63 Ga0081539_10055292 3300005985 Bacteria 2209
64 Ga0068871_100005230 3300006358 Bacteria 9079
65 Ga0075430_100030499 3300006846 Bacteria 4580
66 Ga0075431_100097465 3300006847 Bacteria 3036
67 Ga0075433_10000454 3300006852 Bacteria 26571
68 Ga0075433_10013482 3300006852 Bacteria 6645
69 Ga0075433_10016335 3300006852 Bacteria 6113
70 Ga0075434_100002920 3300006871 Bacteria 15187
71 Ga0075434_100014006 3300006871 Bacteria 7654
72 Ga0105240_10005678 3300009093 Bacteria 18519
73 Ga0105240_10006828 3300009093 Bacteria 16695
74 Ga0105240_10008149 3300009093 Bacteria 15027
75 Ga0105240_10018698 3300009093 Bacteria 9285
76 Ga0111539_10001224 3300009094 Bacteria 34188
77 Ga0111539_10012324 3300009094 Bacteria 10713
78 Ga0111539_10015880 3300009094 Bacteria 9352
79 Ga0111539_10146724 3300009094 Bacteria 2762
80 Ga0111539_10258593 3300009094 Bacteria 2027
81 Ga0105245_10014673 3300009098 Bacteria 6822
82 Ga0114129_10012493 3300009147 Bacteria 12091
83 Ga0114129_10030366 3300009147 Bacteria 7647
84 Ga0114129_10041256 3300009147 Bacteria 6504
85 Ga0105241_10076034 3300009174 Unclassified 2617
86 Ga0105242_10004713 3300009176 Bacteria 10559
87 Ga0105237_10026313 3300009545 Bacteria 5946
88 Ga0105238_10009017 3300009551 Bacteria 9979
89 Ga0105238_10045386 3300009551 Bacteria 4439
90 Ga0157370_10000067 3300013104 Bacteria 113351
91 Ga0157370_10008740 3300013104 Bacteria 10892
92 Ga0157370_10009432 3300013104 Bacteria 10428
93 Ga0157370_10028379 3300013104 Bacteria 5504
94 Ga0157369_10000066 3300013105 Bacteria 144815
95 Ga0157369_10017416 3300013105 Bacteria 8074
96 Ga0157369_10028431 3300013105 Bacteria 6187
97 Ga0157369_10046701 3300013105 Bacteria 4706
98 Ga0157372_10000038 3300013307 Bacteria 167357
99 Ga0157372_10003265 3300013307 Bacteria 17524
100 Ga0157372_10021422 3300013307 Bacteria 6983
101 Ga0157372_10038621 3300013307 Bacteria 5268
102 Ga0157372_10064074 3300013307 Bacteria 4123
103 Ga0157372_10127446 3300013307 Bacteria 2927
104 Ga0157375_10093118 3300013308 Bacteria 3079
105 Ga0163163_10107154 3300014325 Bacteria 2821
106 Ga0213876_10025676 3300021384 Bacteria 3107
107 Ga0213875_10000006 3300021388 Bacteria 579005
108 Ga0213875_10000164 3300021388 Bacteria 69199
109 Ga0207647_10014239 3300025904 Bacteria 5487
110 Ga0207705_10000016 3300025909 Bacteria 377359
111 Ga0207705_10048406 3300025909 Bacteria 3058
112 Ga0207707_10005460 3300025912 Bacteria 11113
113 Ga0207707_10024300 3300025912 Bacteria 5304
114 Ga0207707_10055066 3300025912 Bacteria 3461
115 Ga0207695_10000026 3300025913 Bacteria 624558
116 Ga0207695_10005508 3300025913 Bacteria 16760
117 Ga0207695_10010768 3300025913 Bacteria 11153
118 Ga0207695_10024044 3300025913 Bacteria 6867
119 Ga0207695_10033625 3300025913 Bacteria 5589
120 Ga0207660_10005548 3300025917 Bacteria 8195
121 Ga0207660_10042846 3300025917 Bacteria 3179
122 Ga0207657_10001389 3300025919 Bacteria 25831
123 Ga0207657_10003133 3300025919 Bacteria 17684
124 Ga0207657_10024872 3300025919 Bacteria 5535
125 Ga0207652_10004486 3300025921 Bacteria 11352
126 Ga0207652_10011057 3300025921 Bacteria 7275
127 Ga0207681_10034146 3300025923 Bacteria 3342
128 Ga0207694_10002463 3300025924 Bacteria 15085
129 Ga0207650_10007371 3300025925 Bacteria 7486
130 Ga0207690_10003686 3300025932 Bacteria 9117
131 Ga0207669_10028389 3300025937 Bacteria 3078
132 Ga0207704_10002894 3300025938 Bacteria 7764
133 Ga0207665_10066562 3300025939 Bacteria 2452
134 Ga0207691_10028860 3300025940 Bacteria 5192
135 Ga0207689_10110585 3300025942 Bacteria 2258
136 Ga0207679_10035309 3300025945 Bacteria 3536
137 Ga0207667_10002190 3300025949 Bacteria 24531
138 Ga0207667_10003210 3300025949 Bacteria 20191
139 Ga0207667_10005332 3300025949 Bacteria 15670
140 Ga0207667_10006032 3300025949 Bacteria 14744
141 Ga0207651_10015794 3300025960 Bacteria 4400
142 Ga0207640_10000080 3300025981 Bacteria 75177
143 Ga0207677_10068587 3300026023 Bacteria 2490
144 Ga0207639_10000082 3300026041 Bacteria 82368
145 Ga0207678_10000156 3300026067 Bacteria 56308
146 Ga0207678_10005250 3300026067 Bacteria 11603
147 Ga0207678_10024847 3300026067 Bacteria 5231
148 Ga0207674_10004180 3300026116 Bacteria 17446
149 Ga0207698_10000016 3300026142 Bacteria 183355
150 Ga0207428_10039122 3300027907 Bacteria 3850
151 Ga0268266_10010303 3300028379 Bacteria 8177
152 Ga0268266_10022318 3300028379 Bacteria 5395
153 Ga0307408_100032645 3300031548 Bacteria 3631
154 Ga0307413_10057640 3300031824 Bacteria 2376
155 Ga0307406_10009520 3300031901 Bacteria 5453
156 Ga0307407_10002479 3300031903 Bacteria 7237
157 Ga0307409_100003844 3300031995 Bacteria 8291
158 Ga0373943_0001998 3300035170 Bacteria 9236
159 Ga0373955_0001602 3300035172 Bacteria 9685
160 Ga0373924_0002746 3300035410 Bacteria 5945
161 Ga0373935_0002191 3300035692 Bacteria 11093
162 Ga0373925_0017990 3300037068 Bacteria 5132
163 Ga0395900_0111132 3300037418 Bacteria 2815
164 Ga0436364_0379917 3300037853 Bacteria 167058
165 Ga0436364_0478514 3300037853 Bacteria 578677
166 Ga0436364_1376404 3300037853 Unclassified 3063
167 Ga0436364_1381754 3300037853 Unclassified 2234
168 Ga0436364_1386291 3300037853 Bacteria 20302
169 Ga0436365_0642726 3300039437 Bacteria 2789
170 Ga0436365_1057628 3300039437 Bacteria 3635
171 Ga0453684_0000478 3300044712 Bacteria 158859
172 Ga0495592_0039809 3300046454 Bacteria 3530
173 Ga0495582_0033001 3300046473 Bacteria 2845
174 Ga0495608_0004182 3300046511 Bacteria 10352
175 Ga0495628_0108825 3300046516 Bacteria 2133
176 Ga0495630_0001006 3300046517 Bacteria 19532
177 Ga0495663_0000121 3300046525 Bacteria 32576
178 Ga0495598_0002080 3300046537 Bacteria 4084
179 Ga0495621_0000990 3300046539 Bacteria 7276
180 Ga0495659_0009847 3300046664 Bacteria 3057
181 Ga0495669_0000946 3300046684 Bacteria 12139
182 Ga0495613_0000643 3300046689 Bacteria 27730
183 Ga0495684_0000494 3300047471 Bacteria 32208
184 Ga0496100_0058816 3300048903 Bacteria 2524
185 Ga0496102_0013490 3300048905 Bacteria 7079
186 Ga0496104_0073524 3300048907 Bacteria 3252
187 Ga0496108_0062300 3300048911 Bacteria 3141
188 Ga0496114_0007211 3300048917 Bacteria 8777
189 Ga0501032_0002496 3300049569 Bacteria 14365
190 Ga0501034_0005827 3300049571 Bacteria 13403
191 Ga0501034_0085066 3300049571 Bacteria 3164
192 Ga0501036_0003072 3300049572 Bacteria 13312
193 Ga0501038_0003285 3300049574 Bacteria 15069
194 Ga0501038_0005723 3300049574 Bacteria 11527
195 Ga0501038_0061458 3300049574 Bacteria 3212
196 Ga0501046_0005219 3300049580 Bacteria 11617
197 Ga0501047_0002428 3300049581 Bacteria 17804
198 Ga0501047_0054671 3300049581 Bacteria 3862
199 Ga0501069_0054196 3300049585 Bacteria 2234
200 Ga0501073_0001002 3300049589 Bacteria 20360
201 Ga0501073_0024114 3300049589 Bacteria 4368
202 Ga0501079_0039994 3300049741 Unclassified 3618
203 Ga0501080_0003016 3300049742 Bacteria 14839
204 Ga0501083_0001746 3300049744 Bacteria 14819
205 Ga0501083_0026353 3300049744 Unclassified 4017
206 Ga0501035_0052909 3300049822 Bacteria 3632
207 Ga0501044_0005595 3300049823 Bacteria 13951
208 Ga0501044_0014124 3300049823 Bacteria 8621
209 Ga0501044_0081054 3300049823 Bacteria 3286
210 nmdc:mga05p37_14992_c2 3300050507 Bacteria 4641
211 nmdc:mga05p37_32277_c1 3300050507 Bacteria 6403
212 nmdc:mga05p37_94088_c1 3300050507 Unclassified 3692
213 nmdc:mga09592_88377_c1 3300050508 Unclassified 2647
214 nmdc:mga0qj67_8308_c1 3300050509 Bacteria 7694
215 nmdc:mga06r32_18284_c1 3300050510 Bacteria 6415
216 nmdc:mga08y16_27028_c1 3300050511 Bacteria 6047
217 nmdc:mga08y16_317_c1 3300050511 Bacteria 43677
218 nmdc:mga08y16_36877_c1 3300050511 Bacteria 5134
219 nmdc:mga0n895_1963_c1 3300050512 Bacteria 15774
220 nmdc:mga0n895_40220_c1 3300050512 Bacteria 4541
221 nmdc:mga0rr50_25252_c1 3300050513 Bacteria 4128
222 nmdc:mga08x19_20696_c1 3300050514 Bacteria 4053
223 nmdc:mga0a205_1124_c1 3300050515 Bacteria 22159
224 nmdc:mga0a205_717_c1 3300050515 Bacteria 26664
225 Ga0495601_0001227 3300053077 Bacteria 14076
226 Ga0500635_0008976 3300053080 Bacteria 2759
227 Ga0495619_0010511 3300053085 Bacteria 5825
228 Ga0495619_0060968 3300053085 Bacteria 2509
229 Ga0500641_0005323 3300053096 Bacteria 4553
230 Ga0501082_0020400 3300060353 Bacteria 5713
231 Ga0157372_10012114
232 JGI25406J46586_10000511
233 JGI25406J46586_10002017
234 rootH2_10000256
235 Ga0065712_10001744
236 Ga0065707_10090416
237 Ga0070658_10000010
238 Ga0070658_10011428
239 Ga0070676_10014681
240 Ga0070683_100003263
241 Ga0070670_100008196
242 Ga0070670_100011702
243 Ga0068869_100029866
244 Ga0068869_100089166
245 Ga0068869_100112341
246 Ga0070680_100003087
247 Ga0070680_100004577
248 Ga0068868_100084783
249 Ga0070660_100002140
250 Ga0070660_100002730
251 Ga0070660_100010865
252 Ga0070668_100090621
253 Ga0070669_100069305
254 Ga0070675_100005510
255 Ga0070675_100009232
256 Ga0070675_100058525
257 Ga0070674_100018762
258 Ga0070659_100005900
259 Ga0070663_100000889
260 Ga0070663_100033198
261 Ga0070681_10002580
262 Ga0070681_10043685
263 Ga0070699_100014544
264 Ga0070679_100025763
265 Ga0070679_100040774
266 Ga0070679_100120838
267 Ga0070684_100005663
268 Ga0068853_100000122
269 Ga0068853_100016401
270 Ga0070686_100036418
271 Ga0070695_100034348
272 Ga0070693_100055844
273 Ga0070665_100013646
274 Ga0070665_100030066
275 Ga0068855_100001291
276 Ga0068855_100004824
277 Ga0068855_100018571
278 Ga0068855_100078512
279 Ga0070664_100010528
280 Ga0070664_100031639
281 Ga0068857_100020660
282 Ga0068854_100000070
283 Ga0068854_100004965
284 Ga0068856_100029940
285 Ga0068852_100000021
286 Ga0068859_100017110
287 Ga0068864_100044198
288 Ga0068864_100065795
289 Ga0068864_100080860
290 Ga0081540_1018240
291 Ga0081539_10000013
292 Ga0081539_10000280
293 Ga0081539_10055292
294 Ga0068871_100005230
295 Ga0075430_100030499
296 Ga0075431_100097465
297 Ga0075433_10000454
298 Ga0075433_10013482
299 Ga0075433_10016335
300 Ga0075434_100002920
301 Ga0075434_100014006
302 Ga0105240_10005678
303 Ga0105240_10006828
304 Ga0105240_10008149
305 Ga0105240_10018698
306 Ga0111539_10001224
307 Ga0111539_10012324
308 Ga0111539_10015880
309 Ga0111539_10146724
310 Ga0111539_10258593
311 Ga0105245_10014673
312 Ga0114129_10012493
313 Ga0114129_10030366
314 Ga0114129_10041256
315 Ga0105241_10076034
316 Ga0105242_10004713
317 Ga0105237_10026313
318 Ga0105238_10009017
319 Ga0105238_10045386
320 Ga0157370_10000067
321 Ga0157370_10008740
322 Ga0157370_10009432
323 Ga0157370_10028379
324 Ga0157369_10000066
325 Ga0157369_10017416
326 Ga0157369_10028431
327 Ga0157369_10046701
328 Ga0157372_10000038
329 Ga0157372_10003265
330 Ga0157372_10021422
331 Ga0157372_10038621
332 Ga0157372_10064074
333 Ga0157372_10127446
334 Ga0157375_10093118
335 Ga0163163_10107154
336 Ga0213876_10025676
337 Ga0213875_10000006
338 Ga0213875_10000164
339 Ga0207647_10014239
340 Ga0207705_10000016
341 Ga0207705_10048406
342 Ga0207707_10005460
343 Ga0207707_10024300
344 Ga0207707_10055066
345 Ga0207695_10000026
346 Ga0207695_10005508
347 Ga0207695_10010768
348 Ga0207695_10024044
349 Ga0207695_10033625
350 Ga0207660_10005548
351 Ga0207660_10042846
352 Ga0207657_10001389
353 Ga0207657_10003133
354 Ga0207657_10024872
355 Ga0207652_10004486
356 Ga0207652_10011057
357 Ga0207681_10034146
358 Ga0207694_10002463
359 Ga0207650_10007371
360 Ga0207690_10003686
361 Ga0207669_10028389
362 Ga0207704_10002894
363 Ga0207665_10066562
364 Ga0207691_10028860
365 Ga0207689_10110585
366 Ga0207679_10035309
367 Ga0207667_10002190
368 Ga0207667_10003210
369 Ga0207667_10005332
370 Ga0207667_10006032
371 Ga0207651_10015794
372 Ga0207640_10000080
373 Ga0207677_10068587
374 Ga0207639_10000082
375 Ga0207678_10000156
376 Ga0207678_10005250
377 Ga0207678_10024847
378 Ga0207674_10004180
379 Ga0207698_10000016
380 Ga0207428_10039122
381 Ga0268266_10010303
382 Ga0268266_10022318
383 Ga0307408_100032645
384 Ga0307413_10057640
385 Ga0307406_10009520
386 Ga0307407_10002479
387 Ga0307409_100003844
388 Ga0373943_0001998
389 Ga0373955_0001602
390 Ga0373924_0002746
391 Ga0373935_0002191
392 Ga0373925_0017990
393 Ga0395900_0111132
394 Ga0436364_0379917
395 Ga0436364_0478514
396 Ga0436364_1376404
397 Ga0436364_1381754
398 Ga0436364_1386291
399 Ga0436365_0642726
400 Ga0436365_1057628
401 Ga0453684_0000478
402 Ga0495592_0039809
403 Ga0495582_0033001
404 Ga0495608_0004182
405 Ga0495628_0108825
406 Ga0495630_0001006
407 Ga0495663_0000121
408 Ga0495598_0002080
409 Ga0495621_0000990
410 Ga0495659_0009847
411 Ga0495669_0000946
412 Ga0495613_0000643
413 Ga0495684_0000494
414 Ga0496100_0058816
415 Ga0496102_0013490
416 Ga0496104_0073524
417 Ga0496108_0062300
418 Ga0496114_0007211
419 Ga0501032_0002496
420 Ga0501034_0005827
421 Ga0501034_0085066
422 Ga0501036_0003072
423 Ga0501038_0003285
424 Ga0501038_0005723
425 Ga0501038_0061458
426 Ga0501046_0005219
427 Ga0501047_0002428
428 Ga0501047_0054671
429 Ga0501069_0054196
430 Ga0501073_0001002
431 Ga0501073_0024114
432 Ga0501079_0039994
433 Ga0501080_0003016
434 Ga0501083_0001746
435 Ga0501083_0026353
436 Ga0501035_0052909
437 Ga0501044_0005595
438 Ga0501044_0014124
439 Ga0501044_0081054
440 nmdc:mga05p37_14992_c2
441 nmdc:mga05p37_32277_c1
442 nmdc:mga05p37_94088_c1
443 nmdc:mga09592_88377_c1
444 nmdc:mga0qj67_8308_c1
445 nmdc:mga06r32_18284_c1
446 nmdc:mga08y16_27028_c1
447 nmdc:mga08y16_317_c1
448 nmdc:mga08y16_36877_c1
449 nmdc:mga0n895_1963_c1
450 nmdc:mga0n895_40220_c1
451 nmdc:mga0rr50_25252_c1
452 nmdc:mga08x19_20696_c1
453 nmdc:mga0a205_1124_c1
454 nmdc:mga0a205_717_c1
455 Ga0495601_0001227
456 Ga0500635_0008976
457 Ga0495619_0010511
458 Ga0495619_0060968
459 Ga0500641_0005323
460 Ga0501082_0020400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07593

UnbV_ASPIC

ASPIC and UnbV

544

610

0.97

PF01839

FG-GAP

FG-GAP repeat

286

319

0.88

PF13517

FG-GAP_3

FG-GAP-like repeat

254

305

0.88

PF13517

FG-GAP_3

FG-GAP-like repeat

294

357

0.88

PF13517

FG-GAP_3

FG-GAP-like repeat

127

196

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y07-assembly3.cif.gz_D crystal structure of the superoxide reductase from treponema pallidum 0.7066 488 540
4l9o-assembly2.cif.gz_B crystal structure of the sec13-sec16 blade-inserted complex from pichia pastoris 0.6326 83 458
3bg0-assembly1.cif.gz_A architecture of a coat for the nuclear pore membrane 0.6259 97 415
4l9o-assembly2.cif.gz_B crystal structure of the sec13-sec16 blade-inserted complex from pichia pastoris 0.6236 83 458
4v0n-assembly4.cif.gz_F crystal structure of bbs1n in complex with arl6dn, soaked with mercury 0.62 61 461
ID Description Score Start End Superfamily
af_A1XF92_202_447_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.8023 205 454 2.130.10.130
af_I1LFD7_6_84_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.7714 224 299 3.50.70.10
1y07D02 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.7066 488 540 2.60.40.730
af_A0A368UH23_245_420_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7006 224 461 2.130.10.10
af_I1LFD7_6_84_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.6984 224 299 3.50.70.10
ID Description Score Start End GO Terms
AF-A0A386C7P3-F1-model_v4 ASPIC 0.942 217 318
AF-A0A2V9IQQ5-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9403 402 556
AF-A0A2V7QXP8-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9395 217 555
AF-A0A2V7QXP8-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9341 217 555
AF-A0A2V9M9I7-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9286 399 552

Map