F342991

General Info

Members Datasets Scaffolds Average Seq Length
230 151 460 274

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10348260|Ga0105248_103482602
Length 305
Sequence LTRERRCGEGWKTLDEDVKVAATGLGTVPHMPELPEMEAWRRQLDAPVSAFAIAKAGPAHIATLKTFDPPPAALVGRRFRGAERRAKRLLFPTDDGELVLLVHLMTAGRLKYLAPGEKGPAKPVFALEFFCCAKLVLTENAKKKRAGVWLLTPDDAQAELGHLGPEADTLDAAQLAEILRSDSRRLHAFLRDQRLIAGIGRAWANEILHTAKLSPYALSGDLDEEEIERLAAAIHSELERGLALREKGASDEKTYRVHRKLGEPCHVCGTPLAQVDFEEHTIFYCPTCQTGGRVLKDRRMSRLLR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
84 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
85 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
86 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
87 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
88 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
89 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
90 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.91
Rhizosphere 84.78
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10348260 3300009177 Unclassified 1668
2 Ga0070658_10021701 3300005327 Bacteria 5146
3 Ga0070683_100012309 3300005329 Bacteria 7431
4 Ga0070683_100042979 3300005329 Bacteria 4163
5 Ga0070680_100009292 3300005336 Bacteria 7547
6 Ga0070682_100003613 3300005337 Bacteria 8572
7 Ga0070674_100339357 3300005356 Bacteria 1210
8 Ga0070674_100388745 3300005356 Bacteria 1137
9 Ga0070659_100187751 3300005366 Bacteria 1698
10 Ga0070709_10017804 3300005434 Bacteria 4082
11 Ga0070714_100043919 3300005435 Bacteria 3782
12 Ga0070714_100056439 3300005435 Unclassified 3359
13 Ga0070714_100090176 3300005435 Bacteria 2684
14 Ga0070714_100166907 3300005435 Bacteria 1995
15 Ga0070713_100017920 3300005436 Bacteria 5373
16 Ga0070713_100019443 3300005436 Bacteria 5186
17 Ga0070711_100013488 3300005439 Bacteria 5132
18 Ga0070663_100342622 3300005455 Bacteria 1208
19 Ga0070678_100229184 3300005456 Bacteria 1548
20 Ga0070681_10011848 3300005458 Bacteria 8645
21 Ga0070681_10024660 3300005458 Bacteria 6052
22 Ga0070681_10032928 3300005458 Bacteria 5203
23 Ga0070698_100136992 3300005471 Bacteria 2402
24 Ga0070679_100000950 3300005530 Bacteria 25176
25 Ga0070679_100037561 3300005530 Bacteria 4812
26 Ga0070679_100158735 3300005530 Bacteria 2236
27 Ga0070684_100003591 3300005535 Bacteria 11673
28 Ga0070684_100321858 3300005535 Bacteria 1420
29 Ga0070684_100458955 3300005535 Unclassified 1178
30 Ga0068853_100362869 3300005539 Bacteria 1350
31 Ga0070693_100003304 3300005547 Bacteria 7493
32 Ga0068857_100350878 3300005577 Bacteria 1366
33 Ga0081455_10142092 3300005937 Bacteria 1863
34 Ga0081539_10111355 3300005985 Bacteria 1377
35 Ga0070716_100004854 3300006173 Bacteria 6464
36 Ga0070712_100166911 3300006175 Bacteria 1705
37 Ga0097621_100152518 3300006237 Bacteria 1982
38 Ga0075428_100002030 3300006844 Bacteria 21820
39 Ga0075428_100113962 3300006844 Unclassified 2946
40 Ga0075430_100001912 3300006846 Bacteria 17086
41 Ga0075431_100014768 3300006847 Bacteria 7907
42 Ga0075429_100010434 3300006880 Bacteria 8037
43 Ga0068865_100517864 3300006881 Bacteria 997
44 Ga0111539_10251131 3300009094 Bacteria 2059
45 Ga0105245_10038087 3300009098 Bacteria 4277
46 Ga0114129_10145220 3300009147 Bacteria 3250
47 Ga0105243_10014327 3300009148 Bacteria 6000
48 Ga0157373_10098625 3300013100 Bacteria 2056
49 Ga0157369_10019190 3300013105 Bacteria 7651
50 Ga0157369_10072784 3300013105 Bacteria 3688
51 Ga0157369_10137133 3300013105 Bacteria 2590
52 Ga0157374_10614121 3300013296 Unclassified 1098
53 Ga0157375_10042124 3300013308 Bacteria 4416
54 Ga0157380_10524717 3300014326 Bacteria 1156
55 Ga0182008_10002853 3300014497 Bacteria 10702
56 Ga0163161_10142622 3300017792 Unclassified 1815
57 Ga0206353_11858022 3300020082 Bacteria 7262
58 Ga0207692_10075964 3300025898 Bacteria 1783
59 Ga0207699_10007729 3300025906 Bacteria 5263
60 Ga0207707_10014342 3300025912 Bacteria 6901
61 Ga0207707_10031254 3300025912 Bacteria 4659
62 Ga0207707_10084485 3300025912 Bacteria 2772
63 Ga0207693_10137442 3300025915 Bacteria 1922
64 Ga0207663_10006636 3300025916 Bacteria 5945
65 Ga0207663_10222291 3300025916 Bacteria 1375
66 Ga0207660_10013548 3300025917 Bacteria 5345
67 Ga0207660_10105946 3300025917 Bacteria 2108
68 Ga0207657_10001500 3300025919 Bacteria 24976
69 Ga0207657_10011280 3300025919 Bacteria 8877
70 Ga0207652_10001000 3300025921 Bacteria 26079
71 Ga0207652_10126597 3300025921 Bacteria 2276
72 Ga0207659_10163307 3300025926 Bacteria 1751
73 Ga0207687_10012149 3300025927 Bacteria 5632
74 Ga0207700_10000001 3300025928 Bacteria 1122509
75 Ga0207700_10159496 3300025928 Unclassified 1872
76 Ga0207664_10000965 3300025929 Bacteria 19405
77 Ga0207664_10022297 3300025929 Bacteria 4726
78 Ga0207664_10061737 3300025929 Bacteria 2991
79 Ga0207664_10143096 3300025929 Bacteria 2025
80 Ga0207709_10026503 3300025935 Bacteria 3330
81 Ga0207665_10007439 3300025939 Bacteria 7242
82 Ga0207678_10128246 3300026067 Bacteria 2164
83 Ga0207648_10104886 3300026089 Bacteria 2480
84 Ga0207674_10569697 3300026116 Bacteria 1094
85 Ga0207675_100060406 3300026118 Bacteria 3539
86 Ga0207683_10093154 3300026121 Bacteria 2685
87 Ga0207698_10684529 3300026142 Bacteria 1019
88 Ga0207428_10002836 3300027907 Bacteria 17198
89 Ga0265337_1031038 3300028556 Bacteria 1589
90 Ga0265334_10054897 3300028573 Bacteria 1518
91 Ga0265336_10001244 3300028666 Bacteria 12061
92 Ga0265338_10021403 3300028800 Bacteria 6744
93 Ga0265338_10112747 3300028800 Bacteria 2186
94 Ga0265324_10011965 3300029957 Bacteria 3290
95 Ga0265327_10058394 3300031251 Bacteria 1980
96 Ga0265313_10008680 3300031595 Bacteria 6721
97 Ga0265314_10021188 3300031711 Bacteria 5005
98 Ga0316576_10055587 3300031727 Bacteria 2889
99 Ga0316576_10079640 3300031727 Bacteria 2428
100 Ga0316576_10464286 3300031727 Bacteria 934
101 Ga0316578_10108269 3300031728 Bacteria 1668
102 Ga0316577_10022906 3300031733 Bacteria 3469
103 Ga0373954_0058848 3300035118 Bacteria 1811
104 Ga0316574_0019978 3300035398 Bacteria 3960
105 Ga0316574_0066394 3300035398 Bacteria 2273
106 Ga0316574_0071540 3300035398 Bacteria 2191
107 Ga0373933_0271361 3300035724 Bacteria 1095
108 Ga0316584_0002560 3300036712 Bacteria 11538
109 Ga0395899_0047976 3300037312 Bacteria 3178
110 Ga0395898_0041472 3300037466 Bacteria 4546
111 Ga0395898_0604290 3300037466 Bacteria 1039
112 Ga0395905_0004368 3300037471 Bacteria 14716
113 Ga0395905_0085805 3300037471 Bacteria 2950
114 Ga0395901_0000944 3300038443 Bacteria 31637
115 Ga0451793_1748676 3300041452 Bacteria 1349
116 Ga0451798_0602317 3300041458 Unclassified 965
117 Ga0451849_0025055 3300041505 Bacteria 3311
118 Ga0451843_1668580 3300041509 Bacteria 2309
119 Ga0451855_1200198 3300041511 Bacteria 1138
120 Ga0439441_006702 3300042001 Bacteria 1835
121 Ga0450889_006037 3300042144 Bacteria 1213
122 Ga0450918_004217 3300042531 Bacteria 2634
123 Ga0466963_0014400 3300044694 Bacteria 4875
124 Ga0466963_0035410 3300044694 Bacteria 3252
125 Ga0466964_0169909 3300044706 Unclassified 1026
126 Ga0466968_0007597 3300044735 Bacteria 4128
127 Ga0466968_0016305 3300044735 Bacteria 2957
128 Ga0466957_0018123 3300044842 Bacteria 4130
129 Ga0466959_0065918 3300045049 Bacteria 2627
130 Ga0466958_0023450 3300045836 Bacteria 3623
131 Ga0466958_0300515 3300045836 Unclassified 1030
132 Ga0466967_0004566 3300045976 Bacteria 9379
133 Ga0466967_0005924 3300045976 Bacteria 8572
134 Ga0466967_0006654 3300045976 Bacteria 8217
135 Ga0466967_0012419 3300045976 Bacteria 6513
136 Ga0466967_0013186 3300045976 Bacteria 6372
137 Ga0466967_0030100 3300045976 Bacteria 4552
138 Ga0466967_0046748 3300045976 Bacteria 3770
139 Ga0466967_0052641 3300045976 Bacteria 3574
140 Ga0466967_0073895 3300045976 Bacteria 3060
141 Ga0466967_0082455 3300045976 Bacteria 2906
142 Ga0466967_0097788 3300045976 Unclassified 2679
143 Ga0466967_0156979 3300045976 Bacteria 2132
144 Ga0466967_0477242 3300045976 Bacteria 1221
145 Ga0466967_0525878 3300045976 Bacteria 1163
146 Ga0495653_0149963 3300046463 Bacteria 1630
147 Ga0495608_0013943 3300046511 Bacteria 5578
148 Ga0495608_0034695 3300046511 Bacteria 3405
149 Ga0495608_0267307 3300046511 Bacteria 1064
150 Ga0495630_0020573 3300046517 Bacteria 4866
151 Ga0495640_0024010 3300046533 Bacteria 4435
152 Ga0495586_0010543 3300046535 Bacteria 4916
153 Ga0495645_0326078 3300046543 Bacteria 996
154 Ga0495634_0008937 3300046642 Bacteria 7418
155 Ga0495634_0033870 3300046642 Bacteria 3508
156 Ga0495634_0180354 3300046642 Bacteria 1322
157 Ga0495635_0034074 3300046663 Bacteria 3533
158 Ga0495657_0018634 3300046675 Bacteria 5017
159 Ga0495647_0038330 3300046681 Bacteria 1812
160 Ga0495647_0062791 3300046681 Bacteria 1469
161 Ga0495658_0265320 3300046683 Bacteria 1081
162 Ga0495613_0006852 3300046689 Bacteria 8507
163 Ga0495674_0170927 3300047319 Bacteria 1814
164 Ga0495674_0208991 3300047319 Bacteria 1617
165 Ga0495676_0097925 3300047321 Bacteria 2177
166 Ga0495676_0113725 3300047321 Bacteria 1981
167 Ga0495680_0213919 3300047322 Bacteria 1379
168 Ga0495680_0291378 3300047322 Bacteria 1148
169 Ga0495684_0035046 3300047471 Bacteria 3850
170 Ga0495684_0439953 3300047471 Bacteria 908
171 Ga0495614_0099298 3300048089 Bacteria 1271
172 Ga0496100_0045326 3300048903 Bacteria 2822
173 Ga0496101_0049261 3300048904 Bacteria 3030
174 Ga0496101_0083641 3300048904 Bacteria 2363
175 Ga0496102_0008414 3300048905 Bacteria 8841
176 Ga0496103_0023809 3300048906 Bacteria 3693
177 Ga0496104_0010174 3300048907 Bacteria 8395
178 Ga0496104_0025683 3300048907 Bacteria 5433
179 Ga0496105_0000974 3300048908 Bacteria 19699
180 Ga0496106_0117217 3300048909 Bacteria 2078
181 Ga0496107_0012199 3300048910 Bacteria 5997
182 Ga0496108_0007607 3300048911 Bacteria 8773
183 Ga0496108_0152430 3300048911 Bacteria 1995
184 Ga0496108_0312999 3300048911 Bacteria 1368
185 Ga0496108_0313784 3300048911 Bacteria 1366
186 Ga0496109_0009853 3300048912 Bacteria 8156
187 Ga0496109_0195238 3300048912 Bacteria 1902
188 Ga0496110_0000283 3300048913 Bacteria 33130
189 Ga0496111_0063735 3300048914 Bacteria 2673
190 Ga0496111_0085053 3300048914 Bacteria 2312
191 Ga0496111_0140763 3300048914 Bacteria 1787
192 Ga0496112_0013770 3300048915 Bacteria 7480
193 Ga0496112_0032613 3300048915 Bacteria 5058
194 Ga0496112_0093734 3300048915 Bacteria 2973
195 Ga0496112_0121092 3300048915 Bacteria 2586
196 Ga0496114_0000639 3300048917 Bacteria 25783
197 Ga0496114_0000926 3300048917 Bacteria 21961
198 Ga0496114_0006300 3300048917 Bacteria 9338
199 Ga0496114_0041928 3300048917 Bacteria 3792
200 Ga0496114_0099868 3300048917 Bacteria 2476
201 Ga0496114_0154149 3300048917 Bacteria 1994
202 Ga0501031_0035706 3300049568 Bacteria 3243
203 Ga0501037_0140477 3300049573 Bacteria 1729
204 Ga0501039_0248039 3300049575 Unclassified 1400
205 Ga0501042_0065112 3300049578 Bacteria 2605
206 Ga0501046_0243706 3300049580 Bacteria 1325
207 Ga0501048_0022430 3300049582 Bacteria 4618
208 Ga0501067_0030185 3300049583 Bacteria 3006
209 Ga0501071_0224902 3300049587 Bacteria 1413
210 Ga0501072_0008989 3300049588 Bacteria 7596
211 Ga0501075_0029448 3300049591 Bacteria 4061
212 Ga0501076_0505107 3300049592 Bacteria 996
213 Ga0501077_0074930 3300049593 Bacteria 2143
214 Ga0501077_0110382 3300049593 Bacteria 1743
215 Ga0501079_0065217 3300049741 Bacteria 2809
216 Ga0501079_0072691 3300049741 Bacteria 2658
217 nmdc:mga09592_10398_c1 3300050508 Bacteria 7573
218 nmdc:mga0qj67_7406_c1 3300050509 Bacteria 8112
219 nmdc:mga08y16_55995_c1 3300050511 Bacteria 4122
220 nmdc:mga0n895_272407_c1 3300050512 Bacteria 1717
221 nmdc:mga08x19_448444_c1 3300050514 Bacteria 908
222 Ga0495601_0023384 3300053077 Bacteria 3797
223 Ga0495619_0009969 3300053085 Bacteria 5984
224 Ga0495619_0199402 3300053085 Bacteria 1385
225 Ga0495619_0427971 3300053085 Bacteria 913
226 Ga0501084_0059135 3300054114 Bacteria 3207
227 Ga0501082_0027750 3300060353 Bacteria 4874
228 Ga0501082_0336078 3300060353 Unclassified 1316
229 Ga0530510_0007963 3300061734 Bacteria 7394
230 Ga0530510_0227100 3300061734 Bacteria 1388
231 Ga0105248_10348260
232 Ga0070658_10021701
233 Ga0070683_100012309
234 Ga0070683_100042979
235 Ga0070680_100009292
236 Ga0070682_100003613
237 Ga0070674_100339357
238 Ga0070674_100388745
239 Ga0070659_100187751
240 Ga0070709_10017804
241 Ga0070714_100043919
242 Ga0070714_100056439
243 Ga0070714_100090176
244 Ga0070714_100166907
245 Ga0070713_100017920
246 Ga0070713_100019443
247 Ga0070711_100013488
248 Ga0070663_100342622
249 Ga0070678_100229184
250 Ga0070681_10011848
251 Ga0070681_10024660
252 Ga0070681_10032928
253 Ga0070698_100136992
254 Ga0070679_100000950
255 Ga0070679_100037561
256 Ga0070679_100158735
257 Ga0070684_100003591
258 Ga0070684_100321858
259 Ga0070684_100458955
260 Ga0068853_100362869
261 Ga0070693_100003304
262 Ga0068857_100350878
263 Ga0081455_10142092
264 Ga0081539_10111355
265 Ga0070716_100004854
266 Ga0070712_100166911
267 Ga0097621_100152518
268 Ga0075428_100002030
269 Ga0075428_100113962
270 Ga0075430_100001912
271 Ga0075431_100014768
272 Ga0075429_100010434
273 Ga0068865_100517864
274 Ga0111539_10251131
275 Ga0105245_10038087
276 Ga0114129_10145220
277 Ga0105243_10014327
278 Ga0157373_10098625
279 Ga0157369_10019190
280 Ga0157369_10072784
281 Ga0157369_10137133
282 Ga0157374_10614121
283 Ga0157375_10042124
284 Ga0157380_10524717
285 Ga0182008_10002853
286 Ga0163161_10142622
287 Ga0206353_11858022
288 Ga0207692_10075964
289 Ga0207699_10007729
290 Ga0207707_10014342
291 Ga0207707_10031254
292 Ga0207707_10084485
293 Ga0207693_10137442
294 Ga0207663_10006636
295 Ga0207663_10222291
296 Ga0207660_10013548
297 Ga0207660_10105946
298 Ga0207657_10001500
299 Ga0207657_10011280
300 Ga0207652_10001000
301 Ga0207652_10126597
302 Ga0207659_10163307
303 Ga0207687_10012149
304 Ga0207700_10000001
305 Ga0207700_10159496
306 Ga0207664_10000965
307 Ga0207664_10022297
308 Ga0207664_10061737
309 Ga0207664_10143096
310 Ga0207709_10026503
311 Ga0207665_10007439
312 Ga0207678_10128246
313 Ga0207648_10104886
314 Ga0207674_10569697
315 Ga0207675_100060406
316 Ga0207683_10093154
317 Ga0207698_10684529
318 Ga0207428_10002836
319 Ga0265337_1031038
320 Ga0265334_10054897
321 Ga0265336_10001244
322 Ga0265338_10021403
323 Ga0265338_10112747
324 Ga0265324_10011965
325 Ga0265327_10058394
326 Ga0265313_10008680
327 Ga0265314_10021188
328 Ga0316576_10055587
329 Ga0316576_10079640
330 Ga0316576_10464286
331 Ga0316578_10108269
332 Ga0316577_10022906
333 Ga0373954_0058848
334 Ga0316574_0019978
335 Ga0316574_0066394
336 Ga0316574_0071540
337 Ga0373933_0271361
338 Ga0316584_0002560
339 Ga0395899_0047976
340 Ga0395898_0041472
341 Ga0395898_0604290
342 Ga0395905_0004368
343 Ga0395905_0085805
344 Ga0395901_0000944
345 Ga0451793_1748676
346 Ga0451798_0602317
347 Ga0451849_0025055
348 Ga0451843_1668580
349 Ga0451855_1200198
350 Ga0439441_006702
351 Ga0450889_006037
352 Ga0450918_004217
353 Ga0466963_0014400
354 Ga0466963_0035410
355 Ga0466964_0169909
356 Ga0466968_0007597
357 Ga0466968_0016305
358 Ga0466957_0018123
359 Ga0466959_0065918
360 Ga0466958_0023450
361 Ga0466958_0300515
362 Ga0466967_0004566
363 Ga0466967_0005924
364 Ga0466967_0006654
365 Ga0466967_0012419
366 Ga0466967_0013186
367 Ga0466967_0030100
368 Ga0466967_0046748
369 Ga0466967_0052641
370 Ga0466967_0073895
371 Ga0466967_0082455
372 Ga0466967_0097788
373 Ga0466967_0156979
374 Ga0466967_0477242
375 Ga0466967_0525878
376 Ga0495653_0149963
377 Ga0495608_0013943
378 Ga0495608_0034695
379 Ga0495608_0267307
380 Ga0495630_0020573
381 Ga0495640_0024010
382 Ga0495586_0010543
383 Ga0495645_0326078
384 Ga0495634_0008937
385 Ga0495634_0033870
386 Ga0495634_0180354
387 Ga0495635_0034074
388 Ga0495657_0018634
389 Ga0495647_0038330
390 Ga0495647_0062791
391 Ga0495658_0265320
392 Ga0495613_0006852
393 Ga0495674_0170927
394 Ga0495674_0208991
395 Ga0495676_0097925
396 Ga0495676_0113725
397 Ga0495680_0213919
398 Ga0495680_0291378
399 Ga0495684_0035046
400 Ga0495684_0439953
401 Ga0495614_0099298
402 Ga0496100_0045326
403 Ga0496101_0049261
404 Ga0496101_0083641
405 Ga0496102_0008414
406 Ga0496103_0023809
407 Ga0496104_0010174
408 Ga0496104_0025683
409 Ga0496105_0000974
410 Ga0496106_0117217
411 Ga0496107_0012199
412 Ga0496108_0007607
413 Ga0496108_0152430
414 Ga0496108_0312999
415 Ga0496108_0313784
416 Ga0496109_0009853
417 Ga0496109_0195238
418 Ga0496110_0000283
419 Ga0496111_0063735
420 Ga0496111_0085053
421 Ga0496111_0140763
422 Ga0496112_0013770
423 Ga0496112_0032613
424 Ga0496112_0093734
425 Ga0496112_0121092
426 Ga0496114_0000639
427 Ga0496114_0000926
428 Ga0496114_0006300
429 Ga0496114_0041928
430 Ga0496114_0099868
431 Ga0496114_0154149
432 Ga0501031_0035706
433 Ga0501037_0140477
434 Ga0501039_0248039
435 Ga0501042_0065112
436 Ga0501046_0243706
437 Ga0501048_0022430
438 Ga0501067_0030185
439 Ga0501071_0224902
440 Ga0501072_0008989
441 Ga0501075_0029448
442 Ga0501076_0505107
443 Ga0501077_0074930
444 Ga0501077_0110382
445 Ga0501079_0065217
446 Ga0501079_0072691
447 nmdc:mga09592_10398_c1
448 nmdc:mga0qj67_7406_c1
449 nmdc:mga08y16_55995_c1
450 nmdc:mga0n895_272407_c1
451 nmdc:mga08x19_448444_c1
452 Ga0495601_0023384
453 Ga0495619_0009969
454 Ga0495619_0199402
455 Ga0495619_0427971
456 Ga0501084_0059135
457 Ga0501082_0027750
458 Ga0501082_0336078
459 Ga0530510_0007963
460 Ga0530510_0227100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

163

253

0.92

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

31

147

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Am structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9201 148 196
6rok-assembly1.cif.gz_A the crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor 0.9032 2 254
6fl1-assembly1.cif.gz_A crystal structure of the complex between the lactococcus lactis fpg mutant t221p and a fapy-dg containing dna 0.9022 2 254
4pcz-assembly1.cif.gz_A crystal structure of a complex between r247g llfpg mutant and a thf containing dna 0.9018 2 254
2xzu-assembly1.cif.gz_A crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and an oxidized pyrimidine containing dna at 310k 0.9014 2 254
ID Description Score Start End Superfamily
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9276 148 196 1.10.8.50
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9174 127 259 1.10.8.50
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9099 135 249 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9083 127 253 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.905 147 200 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A7V8YVB0-F1-model_v4 Zf-TFIIB domain-containing protein 0.9684 64 269 GO:0000703
GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
AF-A0A538MK96-F1-model_v4 Uncharacterized protein 0.9677 1 269 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A538MK96-F1-model_v4 Uncharacterized protein 0.9641 1 269 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A538C9Y7-F1-model_v4 Formamidopyrimidine-DNA glycosylase catalytic domain-containing protein 0.9575 1 156 GO:0003906
GO:0006284
GO:0008270
GO:0019104
AF-A0A7V8YVB0-F1-model_v4 Zf-TFIIB domain-containing protein 0.9546 64 269 GO:0000703
GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829

Map