F342736

General Info

Members Datasets Scaffolds Average Seq Length
230 163 460 252

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100142552|Ga0070689_1001425522
Length 285
Sequence MTCVAGSCQHIRVMTYESADCGGLMMEGRFLVGRHAVITGGGHGIGGAIAEAFAGLGASMSLMGRDTWKLEAHASMLREVGVTVETFECDVADEASVEAAFAASRERLGPAQVLVNNAGQAESAALGDTSRELWDRMLAVNLTGTYLCTRQVLPAMLKARSGRIVNVASTAGLRGYPKTAAYCAAKHGVIGFTRSLALETAKSGITVNAVCPGYTDTDMAQRAVDGLSAALGKSRDEARAMLTRINPLGRLITPEEVAAAVAWLCSPGATGITGQSIPVAGGEVM

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
98 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
99 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
100 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
101 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
102 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
105 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
106 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
136 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
137 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
138 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
162 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
163 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0.43
Rhizoplane 0.87
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100142552 3300005340 Bacteria 1928
2 JGI24744J21845_10016039 3300002077 Bacteria 1493
3 Ga0070690_100003397 3300005330 Bacteria 8700
4 Ga0070670_100004709 3300005331 Bacteria 11450
5 Ga0068869_100010583 3300005334 Bacteria 6021
6 Ga0070680_100056726 3300005336 Bacteria 3202
7 Ga0068868_100023802 3300005338 Bacteria 4638
8 Ga0070689_100000337 3300005340 Bacteria 27384
9 Ga0070691_10265250 3300005341 Bacteria 926
10 Ga0070687_100030528 3300005343 Bacteria 2635
11 Ga0070661_100006371 3300005344 Bacteria 8143
12 Ga0070675_100000590 3300005354 Bacteria 24895
13 Ga0070675_100573762 3300005354 Bacteria 1022
14 Ga0070671_100026218 3300005355 Bacteria 4789
15 Ga0070673_100001770 3300005364 Bacteria 12869
16 Ga0070673_100156991 3300005364 Bacteria 1931
17 Ga0070701_10096664 3300005438 Bacteria 1628
18 Ga0070678_100007824 3300005456 Bacteria 6359
19 Ga0070662_100019145 3300005457 Bacteria 4643
20 Ga0070662_100129306 3300005457 Bacteria 1945
21 Ga0070681_10023010 3300005458 Bacteria 6264
22 Ga0070681_10196821 3300005458 Bacteria 1934
23 Ga0068867_100019091 3300005459 Bacteria 4882
24 Ga0070685_10163224 3300005466 Bacteria 1422
25 Ga0070684_100002059 3300005535 Bacteria 14811
26 Ga0068853_100098659 3300005539 Bacteria 2580
27 Ga0070672_100021123 3300005543 Bacteria 4760
28 Ga0070672_100214104 3300005543 Bacteria 1615
29 Ga0070686_100000052 3300005544 Bacteria 96215
30 Ga0070693_100179974 3300005547 Bacteria 1360
31 Ga0070704_100115171 3300005549 Bacteria 2053
32 Ga0070664_100000397 3300005564 Bacteria 32538
33 Ga0068857_100078593 3300005577 Bacteria 2945
34 Ga0068856_100307187 3300005614 Bacteria 1604
35 Ga0068859_100001635 3300005617 Bacteria 22899
36 Ga0068859_100603302 3300005617 Bacteria 1191
37 Ga0068866_10116257 3300005718 Bacteria 1500
38 Ga0068861_100012519 3300005719 Bacteria 5917
39 Ga0068861_100055217 3300005719 Bacteria 3028
40 Ga0068870_10010400 3300005840 Bacteria 4274
41 Ga0068863_100000998 3300005841 Bacteria 28350
42 Ga0068863_100145680 3300005841 Bacteria 2265
43 Ga0068860_100093475 3300005843 Bacteria 2866
44 Ga0068862_100000542 3300005844 Bacteria 39532
45 Ga0068862_100009222 3300005844 Bacteria 8173
46 Ga0097621_100183255 3300006237 Bacteria 1810
47 Ga0075370_10180769 3300006353 Bacteria 1241
48 Ga0075428_100000382 3300006844 Bacteria 43854
49 Ga0075430_100039732 3300006846 Bacteria 3982
50 Ga0075431_100003681 3300006847 Bacteria 14887
51 Ga0075431_100021732 3300006847 Bacteria 6561
52 Ga0075429_100065417 3300006880 Bacteria 3165
53 Ga0068865_100024346 3300006881 Bacteria 3971
54 Ga0097620_100001635 3300006931 Bacteria 22899
55 Ga0097620_100603290 3300006931 Bacteria 1191
56 Ga0111539_10080501 3300009094 Bacteria 3831
57 Ga0111539_10164183 3300009094 Bacteria 2597
58 Ga0111539_10325140 3300009094 Bacteria 1790
59 Ga0111539_10586995 3300009094 Bacteria 1298
60 Ga0114129_10012199 3300009147 Bacteria 12228
61 Ga0105241_10186784 3300009174 Bacteria 1723
62 Ga0105248_10009514 3300009177 Bacteria 10697
63 Ga0105248_10424807 3300009177 Bacteria 1497
64 Ga0105237_10039118 3300009545 Bacteria 4788
65 Ga0105237_10103112 3300009545 Bacteria 2844
66 Ga0105249_10390084 3300009553 Bacteria 1420
67 Ga0105030_100352 3300009987 Bacteria 4009
68 Ga0105239_10076359 3300010375 Bacteria 3685
69 Ga0105239_10077124 3300010375 Bacteria 3667
70 Ga0105239_10318024 3300010375 Bacteria 1755
71 Ga0105246_10086241 3300011119 Bacteria 2250
72 Ga0157374_10493411 3300013296 Bacteria 1229
73 Ga0163162_10047054 3300013306 Bacteria 4324
74 Ga0157375_10045122 3300013308 Bacteria 4289
75 Ga0157377_10027834 3300014745 Bacteria 3038
76 Ga0157376_10157686 3300014969 Bacteria 2054
77 Ga0213872_10000068 3300021361 Bacteria 91693
78 Ga0207642_10045048 3300025899 Bacteria 1956
79 Ga0207688_10029473 3300025901 Bacteria 3022
80 Ga0207680_10142870 3300025903 Bacteria 1588
81 Ga0207643_10018498 3300025908 Bacteria 3815
82 Ga0207705_10093584 3300025909 Bacteria 2203
83 Ga0207707_10448308 3300025912 Bacteria 1104
84 Ga0207662_10018849 3300025918 Bacteria 3919
85 Ga0207681_10005178 3300025923 Bacteria 8008
86 Ga0207650_10076317 3300025925 Bacteria 2532
87 Ga0207650_10118585 3300025925 Bacteria 2057
88 Ga0207659_10025581 3300025926 Bacteria 3968
89 Ga0207659_10544271 3300025926 Bacteria 986
90 Ga0207644_10034292 3300025931 Bacteria 3551
91 Ga0207706_10000696 3300025933 Bacteria 35110
92 Ga0207706_10026066 3300025933 Bacteria 5234
93 Ga0207706_10062506 3300025933 Bacteria 3279
94 Ga0207670_10190353 3300025936 Bacteria 1552
95 Ga0207704_10050300 3300025938 Bacteria 2513
96 Ga0207691_10035676 3300025940 Bacteria 4614
97 Ga0207711_10040092 3300025941 Bacteria 3983
98 Ga0207689_10044439 3300025942 Bacteria 3673
99 Ga0207689_10070388 3300025942 Bacteria 2874
100 Ga0207651_10015164 3300025960 Bacteria 4470
101 Ga0207658_10022418 3300025986 Bacteria 4397
102 Ga0207639_10137043 3300026041 Bacteria 2034
103 Ga0207708_10045743 3300026075 Bacteria 3335
104 Ga0207702_10290061 3300026078 Bacteria 1550
105 Ga0207641_10004753 3300026088 Bacteria 11709
106 Ga0207641_10196746 3300026088 Bacteria 1856
107 Ga0207648_10020973 3300026089 Bacteria 5882
108 Ga0207674_10014019 3300026116 Bacteria 8859
109 Ga0207674_10271009 3300026116 Bacteria 1645
110 Ga0207675_100000884 3300026118 Bacteria 29908
111 Ga0207675_100056818 3300026118 Bacteria 3650
112 Ga0207675_100375957 3300026118 Bacteria 1396
113 Ga0207675_100498331 3300026118 Bacteria 1212
114 Ga0207683_10141302 3300026121 Bacteria 2170
115 Ga0268266_10152981 3300028379 Bacteria 2081
116 Ga0265328_10003269 3300031239 Bacteria 7176
117 Ga0265340_10130729 3300031247 Bacteria 1152
118 Ga0265327_10001530 3300031251 Bacteria 28537
119 Ga0307408_100034827 3300031548 Bacteria 3529
120 Ga0307516_10003101 3300031730 Bacteria 21612
121 Ga0307413_10050419 3300031824 Bacteria 2501
122 Ga0307410_10036744 3300031852 Bacteria 3193
123 Ga0307409_100353025 3300031995 Bacteria 1388
124 Ga0395905_0001722 3300037471 Bacteria 25630
125 Ga0436361_0969160 3300039447 Bacteria 24645
126 Ga0436361_1073123 3300039447 Bacteria 1987
127 Ga0451855_0902946 3300041511 Bacteria 877
128 Ga0439442_002484 3300042002 Bacteria 3621
129 Ga0450920_000636 3300042122 Bacteria 5599
130 Ga0450923_001265 3300042125 Bacteria 3291
131 Ga0450894_002088 3300042131 Bacteria 2741
132 Ga0450895_003475 3300042132 Bacteria 1216
133 Ga0450907_005151 3300042146 Bacteria 2215
134 Ga0450910_013161 3300042147 Bacteria 1202
135 Ga0450908_001255 3300042184 Bacteria 4903
136 Ga0450918_005801 3300042531 Bacteria 2209
137 Ga0451577_0116031 3300042876 Bacteria 2398
138 Ga0451577_0539814 3300042876 Bacteria 1059
139 Ga0453684_0000884 3300044712 Bacteria 100146
140 Ga0453684_0033131 3300044712 Bacteria 7208
141 Ga0453684_0042047 3300044712 Bacteria 6167
142 Ga0453684_0217971 3300044712 Bacteria 2212
143 Ga0453684_0310628 3300044712 Unclassified 1789
144 Ga0451576_0008293 3300045051 Bacteria 12212
145 Ga0495669_0018965 3300046684 Bacteria 2965
146 Ga0496106_0012552 3300048909 Bacteria 6256
147 Ga0496106_0440255 3300048909 Bacteria 1047
148 Ga0496124_0525803 3300048927 Bacteria 787
149 Ga0501299_005071 3300049522 Bacteria 2005
150 Ga0501031_0071671 3300049568 Bacteria 2256
151 Ga0501033_0011627 3300049570 Bacteria 6732
152 Ga0501034_0173090 3300049571 Bacteria 2125
153 Ga0501034_0580610 3300049571 Bacteria 1028
154 Ga0501036_0240769 3300049572 Bacteria 1517
155 Ga0501036_0412250 3300049572 Bacteria 1127
156 Ga0501037_0273252 3300049573 Bacteria 1179
157 Ga0501038_0373947 3300049574 Bacteria 1106
158 Ga0501039_0150373 3300049575 Bacteria 1829
159 Ga0501040_0076317 3300049576 Bacteria 2317
160 Ga0501046_0150880 3300049580 Bacteria 1753
161 Ga0501047_0034018 3300049581 Bacteria 4920
162 Ga0501048_0167431 3300049582 Bacteria 1556
163 Ga0501048_0169407 3300049582 Bacteria 1547
164 Ga0501068_0180901 3300049584 Bacteria 1333
165 Ga0501069_0011672 3300049585 Bacteria 4658
166 Ga0501070_0054094 3300049586 Bacteria 3328
167 Ga0501070_0250103 3300049586 Bacteria 1450
168 Ga0501070_0299642 3300049586 Bacteria 1310
169 Ga0501071_0051156 3300049587 Bacteria 2976
170 Ga0501071_0096388 3300049587 Bacteria 2177
171 Ga0501071_0106548 3300049587 Bacteria 2070
172 Ga0501072_0095900 3300049588 Bacteria 2357
173 Ga0501073_0010372 3300049589 Bacteria 6832
174 Ga0501073_0369805 3300049589 Bacteria 990
175 Ga0501074_0083212 3300049590 Bacteria 2294
176 Ga0501074_0139913 3300049590 Bacteria 1731
177 Ga0501075_0008123 3300049591 Bacteria 7301
178 Ga0501076_0001607 3300049592 Bacteria 15216
179 Ga0501076_0180109 3300049592 Bacteria 1723
180 Ga0501077_0054435 3300049593 Bacteria 2541
181 Ga0501198_000001 3300049649 Bacteria 234552
182 Ga0501211_001355 3300049658 Bacteria 2614
183 Ga0501222_000013 3300049662 Bacteria 87490
184 Ga0501222_002582 3300049662 Bacteria 2505
185 Ga0501233_008404 3300049668 Bacteria 1989
186 Ga0501235_002917 3300049669 Bacteria 3682
187 Ga0501221_001147 3300049704 Bacteria 4368
188 Ga0501079_0004974 3300049741 Bacteria 9855
189 Ga0501079_0014545 3300049741 Bacteria 6001
190 Ga0501079_0126699 3300049741 Bacteria 1986
191 Ga0501080_0002039 3300049742 Bacteria 17472
192 Ga0501080_0010979 3300049742 Bacteria 8291
193 Ga0501081_0004065 3300049743 Bacteria 9371
194 Ga0501081_0339887 3300049743 Bacteria 1105
195 Ga0501083_0017211 3300049744 Bacteria 5040
196 Ga0501232_007013 3300049757 Bacteria 1176
197 Ga0501035_0088893 3300049822 Bacteria 2721
198 Ga0501044_0090204 3300049823 Bacteria 3093
199 Ga0501044_0401567 3300049823 Bacteria 1283
200 Ga0501045_0023814 3300049824 Bacteria 4394
201 Ga0501045_0407080 3300049824 Bacteria 1012
202 nmdc:mga05p37_164851_c1 3300050507 Bacteria 2705
203 nmdc:mga05p37_39046_c1 3300050507 Bacteria 5825
204 nmdc:mga09592_113831_c1 3300050508 Bacteria 2322
205 nmdc:mga09592_378920_c1 3300050508 Bacteria 1223
206 nmdc:mga09592_71546_c1 3300050508 Bacteria 2944
207 nmdc:mga09592_9742_c1 3300050508 Bacteria 7804
208 nmdc:mga0qj67_29325_c1 3300050509 Bacteria 4274
209 nmdc:mga06r32_538384_c1 3300050510 Bacteria 1142
210 nmdc:mga06r32_5432_c1 3300050510 Bacteria 11470
211 nmdc:mga06r32_5497_c1 3300050510 Bacteria 11413
212 nmdc:mga06r32_59349_c1 3300050510 Bacteria 3679
213 nmdc:mga08y16_243962_c1 3300050511 Bacteria 1857
214 nmdc:mga08y16_36453_c1 3300050511 Bacteria 5166
215 nmdc:mga0n895_1272396_c1 3300050512 Bacteria 707
216 nmdc:mga0n895_2951_c1 3300050512 Bacteria 13500
217 nmdc:mga0a205_341_c1 3300050515 Bacteria 35122
218 Ga0500627_0103031 3300053158 Bacteria 1282
219 Ga0501084_0131048 3300054114 Bacteria 2110
220 Ga0501084_0290642 3300054114 Bacteria 1380
221 Ga0590075_024517 3300059424 Bacteria 1514
222 Ga0501082_0006008 3300060353 Bacteria 10526
223 Ga0501082_0087662 3300060353 Bacteria 2685
224 Ga0501082_0142102 3300060353 Bacteria 2083
225 Ga0530510_0003015 3300061734 Bacteria 11557
226 Ga0530510_0009532 3300061734 Bacteria 6809
227 Ga0530510_0059580 3300061734 Bacteria 2762
228 3003670150 3003665799 Bacteria 7279786
229 643598951 643348564 Bacteria 8839022
230 8054564996 8054563764 Bacteria 5592885
231 Ga0070689_100142552
232 JGI24744J21845_10016039
233 Ga0070690_100003397
234 Ga0070670_100004709
235 Ga0068869_100010583
236 Ga0070680_100056726
237 Ga0068868_100023802
238 Ga0070689_100000337
239 Ga0070691_10265250
240 Ga0070687_100030528
241 Ga0070661_100006371
242 Ga0070675_100000590
243 Ga0070675_100573762
244 Ga0070671_100026218
245 Ga0070673_100001770
246 Ga0070673_100156991
247 Ga0070701_10096664
248 Ga0070678_100007824
249 Ga0070662_100019145
250 Ga0070662_100129306
251 Ga0070681_10023010
252 Ga0070681_10196821
253 Ga0068867_100019091
254 Ga0070685_10163224
255 Ga0070684_100002059
256 Ga0068853_100098659
257 Ga0070672_100021123
258 Ga0070672_100214104
259 Ga0070686_100000052
260 Ga0070693_100179974
261 Ga0070704_100115171
262 Ga0070664_100000397
263 Ga0068857_100078593
264 Ga0068856_100307187
265 Ga0068859_100001635
266 Ga0068859_100603302
267 Ga0068866_10116257
268 Ga0068861_100012519
269 Ga0068861_100055217
270 Ga0068870_10010400
271 Ga0068863_100000998
272 Ga0068863_100145680
273 Ga0068860_100093475
274 Ga0068862_100000542
275 Ga0068862_100009222
276 Ga0097621_100183255
277 Ga0075370_10180769
278 Ga0075428_100000382
279 Ga0075430_100039732
280 Ga0075431_100003681
281 Ga0075431_100021732
282 Ga0075429_100065417
283 Ga0068865_100024346
284 Ga0097620_100001635
285 Ga0097620_100603290
286 Ga0111539_10080501
287 Ga0111539_10164183
288 Ga0111539_10325140
289 Ga0111539_10586995
290 Ga0114129_10012199
291 Ga0105241_10186784
292 Ga0105248_10009514
293 Ga0105248_10424807
294 Ga0105237_10039118
295 Ga0105237_10103112
296 Ga0105249_10390084
297 Ga0105030_100352
298 Ga0105239_10076359
299 Ga0105239_10077124
300 Ga0105239_10318024
301 Ga0105246_10086241
302 Ga0157374_10493411
303 Ga0163162_10047054
304 Ga0157375_10045122
305 Ga0157377_10027834
306 Ga0157376_10157686
307 Ga0213872_10000068
308 Ga0207642_10045048
309 Ga0207688_10029473
310 Ga0207680_10142870
311 Ga0207643_10018498
312 Ga0207705_10093584
313 Ga0207707_10448308
314 Ga0207662_10018849
315 Ga0207681_10005178
316 Ga0207650_10076317
317 Ga0207650_10118585
318 Ga0207659_10025581
319 Ga0207659_10544271
320 Ga0207644_10034292
321 Ga0207706_10000696
322 Ga0207706_10026066
323 Ga0207706_10062506
324 Ga0207670_10190353
325 Ga0207704_10050300
326 Ga0207691_10035676
327 Ga0207711_10040092
328 Ga0207689_10044439
329 Ga0207689_10070388
330 Ga0207651_10015164
331 Ga0207658_10022418
332 Ga0207639_10137043
333 Ga0207708_10045743
334 Ga0207702_10290061
335 Ga0207641_10004753
336 Ga0207641_10196746
337 Ga0207648_10020973
338 Ga0207674_10014019
339 Ga0207674_10271009
340 Ga0207675_100000884
341 Ga0207675_100056818
342 Ga0207675_100375957
343 Ga0207675_100498331
344 Ga0207683_10141302
345 Ga0268266_10152981
346 Ga0265328_10003269
347 Ga0265340_10130729
348 Ga0265327_10001530
349 Ga0307408_100034827
350 Ga0307516_10003101
351 Ga0307413_10050419
352 Ga0307410_10036744
353 Ga0307409_100353025
354 Ga0395905_0001722
355 Ga0436361_0969160
356 Ga0436361_1073123
357 Ga0451855_0902946
358 Ga0439442_002484
359 Ga0450920_000636
360 Ga0450923_001265
361 Ga0450894_002088
362 Ga0450895_003475
363 Ga0450907_005151
364 Ga0450910_013161
365 Ga0450908_001255
366 Ga0450918_005801
367 Ga0451577_0116031
368 Ga0451577_0539814
369 Ga0453684_0000884
370 Ga0453684_0033131
371 Ga0453684_0042047
372 Ga0453684_0217971
373 Ga0453684_0310628
374 Ga0451576_0008293
375 Ga0495669_0018965
376 Ga0496106_0012552
377 Ga0496106_0440255
378 Ga0496124_0525803
379 Ga0501299_005071
380 Ga0501031_0071671
381 Ga0501033_0011627
382 Ga0501034_0173090
383 Ga0501034_0580610
384 Ga0501036_0240769
385 Ga0501036_0412250
386 Ga0501037_0273252
387 Ga0501038_0373947
388 Ga0501039_0150373
389 Ga0501040_0076317
390 Ga0501046_0150880
391 Ga0501047_0034018
392 Ga0501048_0167431
393 Ga0501048_0169407
394 Ga0501068_0180901
395 Ga0501069_0011672
396 Ga0501070_0054094
397 Ga0501070_0250103
398 Ga0501070_0299642
399 Ga0501071_0051156
400 Ga0501071_0096388
401 Ga0501071_0106548
402 Ga0501072_0095900
403 Ga0501073_0010372
404 Ga0501073_0369805
405 Ga0501074_0083212
406 Ga0501074_0139913
407 Ga0501075_0008123
408 Ga0501076_0001607
409 Ga0501076_0180109
410 Ga0501077_0054435
411 Ga0501198_000001
412 Ga0501211_001355
413 Ga0501222_000013
414 Ga0501222_002582
415 Ga0501233_008404
416 Ga0501235_002917
417 Ga0501221_001147
418 Ga0501079_0004974
419 Ga0501079_0014545
420 Ga0501079_0126699
421 Ga0501080_0002039
422 Ga0501080_0010979
423 Ga0501081_0004065
424 Ga0501081_0339887
425 Ga0501083_0017211
426 Ga0501232_007013
427 Ga0501035_0088893
428 Ga0501044_0090204
429 Ga0501044_0401567
430 Ga0501045_0023814
431 Ga0501045_0407080
432 nmdc:mga05p37_164851_c1
433 nmdc:mga05p37_39046_c1
434 nmdc:mga09592_113831_c1
435 nmdc:mga09592_378920_c1
436 nmdc:mga09592_71546_c1
437 nmdc:mga09592_9742_c1
438 nmdc:mga0qj67_29325_c1
439 nmdc:mga06r32_538384_c1
440 nmdc:mga06r32_5432_c1
441 nmdc:mga06r32_5497_c1
442 nmdc:mga06r32_59349_c1
443 nmdc:mga08y16_243962_c1
444 nmdc:mga08y16_36453_c1
445 nmdc:mga0n895_1272396_c1
446 nmdc:mga0n895_2951_c1
447 nmdc:mga0a205_341_c1
448 Ga0500627_0103031
449 Ga0501084_0131048
450 Ga0501084_0290642
451 Ga0590075_024517
452 Ga0501082_0006008
453 Ga0501082_0087662
454 Ga0501082_0142102
455 Ga0530510_0003015
456 Ga0530510_0009532
457 Ga0530510_0059580
458 3003670150
459 643598951
460 8054564996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

34

227

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

283

0.93

PF08659

KR

KR domain

35

216

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9697 11 262
3enn-assembly1.cif.gz_D 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9683 11 263
4cqm-assembly1.cif.gz_K crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9658 15 265
3enn-assembly1.cif.gz_A 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9649 11 263
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9643 10 265
ID Description Score Start End Superfamily
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 15 265 3.40.50.720
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 16 263 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9614 11 263 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9575 11 262 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 12 263 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E5QBP5-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9853 15 263 GO:0016491
AF-X7ECF0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9788 10 263 GO:0016491
AF-A0A4Q4X5U3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9772 12 265 GO:0003700
GO:0016491
AF-A0A2T5H910-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9766 11 263 GO:0016491
AF-E2CQR6-F1-model_v4 Granaticin polyketide synthase putative ketoacyl reductase 1 0.9756 12 263 GO:0016491

Map