F342547

General Info

Members Datasets Scaffolds Average Seq Length
229 175 458 334

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2884791551|2884795761
Length 332
Sequence KEIVVSGIRPTGYLHLGNYFGAIRNYIRMQEEFDCYFFVADWHSLTTHPNPKDLQANVMRVLAENIASGLDPEKVTLYAQSHVPEIAELYLLMNMLAYKGELEKVPTFKDKVRLQPENVNAGLLTYPVLMSVDILIQRAVKVPVGKDQGQHLEMARNFAQRFNNRYGNLFPEPVAFNYGDNLVRILSLDGKGGKMSKSENEMSTLYLSDSDEQIRQKLKKAKTDSGSGVPGEPMPESVANLIEIMKLVSTPDTVQFYTDAFNAGTIRYGDMKTQLGEDMVKFITPIREKAKGLQEDPTYLRKIMKEGAEKARANAAQTLQQARNLMGLNYFE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
122 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
138 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
139 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
140 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
141 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
142 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
143 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
144 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
148 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
158 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
163 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
164 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
168 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
169 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
170 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
171 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
172 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
173 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
174 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
175 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 0
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.61
Nodule 0
Rhizoplane 0
Rhizosphere 82.97
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2796384 2162886007 Bacteria 2352
2 JGI24739J22299_10014338 3300001989 Bacteria 2884
3 JGI25159J45721_1011827 3300002987 Bacteria 2114
4 JGI25153J46596_10029516 3300003215 Bacteria 1881
5 rootH1_10087428 3300003316 Bacteria 6678
6 rootH2_10004858 3300003320 Bacteria 14814
7 rootH2_10011909 3300003320 Bacteria 17660
8 rootH2_10052963 3300003320 Bacteria 13053
9 rootH2_10084737 3300003320 Bacteria 2845
10 rootH1_10088425 3300003323 Bacteria 2210
11 JGI25160J50197_1007678 3300003354 Bacteria 4195
12 Ga0065704_10074551 3300005289 Bacteria 6190
13 Ga0070676_10063770 3300005328 Bacteria 2196
14 Ga0070683_100012609 3300005329 Bacteria 7348
15 Ga0070690_100013413 3300005330 Bacteria 4841
16 Ga0070670_100044175 3300005331 Unclassified 3831
17 Ga0068869_100108756 3300005334 Bacteria 2106
18 Ga0070666_10111507 3300005335 Bacteria 1892
19 Ga0070668_100042369 3300005347 Bacteria 3489
20 Ga0070669_100033585 3300005353 Bacteria 3712
21 Ga0070671_100200210 3300005355 Bacteria 1693
22 Ga0070673_100390036 3300005364 Bacteria 1243
23 Ga0070688_100157435 3300005365 Bacteria 1558
24 Ga0070659_100062461 3300005366 Bacteria 2944
25 Ga0070659_100190156 3300005366 Bacteria 1687
26 Ga0070667_100002333 3300005367 Bacteria 16608
27 Ga0070684_100007996 3300005535 Bacteria 8255
28 Ga0068853_100002321 3300005539 Bacteria 14242
29 Ga0068853_100200474 3300005539 Bacteria 1816
30 Ga0070672_100007250 3300005543 Bacteria 7511
31 Ga0070672_100187734 3300005543 Bacteria 1725
32 Ga0070686_100057081 3300005544 Bacteria 2507
33 Ga0070665_100000001 3300005548 Bacteria 1083363
34 Ga0068855_100031693 3300005563 Bacteria 6312
35 Ga0068855_100141981 3300005563 Bacteria 2736
36 Ga0070664_100026896 3300005564 Bacteria 4778
37 Ga0070664_100059032 3300005564 Bacteria 3264
38 Ga0068857_100160605 3300005577 Bacteria 2039
39 Ga0068856_100002822 3300005614 Bacteria 17786
40 Ga0070702_100072032 3300005615 Bacteria 2044
41 Ga0068852_100014910 3300005616 Bacteria 6006
42 Ga0068852_100060461 3300005616 Bacteria 3289
43 Ga0068852_100139257 3300005616 Bacteria 2244
44 Ga0068852_100385867 3300005616 Bacteria 1375
45 Ga0068859_100010302 3300005617 Bacteria 9408
46 Ga0068858_100255245 3300005842 Bacteria 1666
47 Ga0068860_100000004 3300005843 Bacteria 506126
48 Ga0097620_100010301 3300006931 Bacteria 9408
49 Ga0105240_10000061 3300009093 Bacteria 218897
50 Ga0105240_10030932 3300009093 Bacteria 6951
51 Ga0105241_10000491 3300009174 Bacteria 29828
52 Ga0105241_10419039 3300009174 Bacteria 1178
53 Ga0105242_10046793 3300009176 Bacteria 3511
54 Ga0105237_10011113 3300009545 Bacteria 9544
55 Ga0105237_10025906 3300009545 Bacteria 5996
56 Ga0105237_10061073 3300009545 Bacteria 3769
57 Ga0105237_10078326 3300009545 Bacteria 3295
58 Ga0105237_10198389 3300009545 Bacteria 2006
59 Ga0105238_10028281 3300009551 Bacteria 5713
60 Ga0105238_10071469 3300009551 Bacteria 3467
61 Ga0105239_10000029 3300010375 Bacteria 234749
62 Ga0105239_10043489 3300010375 Bacteria 4924
63 Ga0105239_10080684 3300010375 Bacteria 3580
64 Ga0105239_10108734 3300010375 Bacteria 3072
65 Ga0105239_10120127 3300010375 Bacteria 2917
66 Ga0157371_10004195 3300013102 Bacteria 12698
67 Ga0157371_10031379 3300013102 Unclassified 3828
68 Ga0157370_10019359 3300013104 Bacteria 6831
69 Ga0157374_10000001 3300013296 Bacteria 1077351
70 Ga0157374_10043760 3300013296 Bacteria 4137
71 Ga0157378_10006378 3300013297 Bacteria 10314
72 Ga0163162_10001306 3300013306 Bacteria 23316
73 Ga0157372_10155770 3300013307 Bacteria 2639
74 Ga0157372_10345808 3300013307 Unclassified 1733
75 Ga0163163_10001622 3300014325 Bacteria 18926
76 Ga0157380_10196220 3300014326 Bacteria 1787
77 Ga0157376_10007182 3300014969 Bacteria 7920
78 Ga0182005_1000040 3300015265 Bacteria 151222
79 Ga0209436_100519 3300025208 Bacteria 16799
80 Ga0209436_103237 3300025208 Bacteria 4419
81 Ga0209130_1001416 3300025284 Bacteria 15976
82 Ga0209564_1004634 3300025295 Bacteria 8272
83 Ga0209758_1003964 3300025297 Bacteria 12840
84 Ga0207426_1000258 3300025302 Bacteria 114759
85 Ga0207426_1001000 3300025302 Bacteria 27562
86 Ga0207426_1006580 3300025302 Bacteria 5018
87 Ga0207680_10046864 3300025903 Bacteria 2558
88 Ga0207647_10000017 3300025904 Bacteria 129999
89 Ga0207645_10038232 3300025907 Bacteria 3078
90 Ga0207654_10022428 3300025911 Bacteria 3369
91 Ga0207695_10000057 3300025913 Bacteria 376090
92 Ga0207695_10001216 3300025913 Bacteria 44107
93 Ga0207695_10068990 3300025913 Bacteria 3620
94 Ga0207671_10006310 3300025914 Bacteria 10589
95 Ga0207671_10042467 3300025914 Bacteria 3365
96 Ga0207671_10053028 3300025914 Bacteria 3006
97 Ga0207662_10007559 3300025918 Bacteria 5920
98 Ga0207649_10065380 3300025920 Bacteria 2302
99 Ga0207694_10189449 3300025924 Bacteria 1670
100 Ga0207650_10002470 3300025925 Bacteria 12857
101 Ga0207644_10174784 3300025931 Bacteria 1679
102 Ga0207690_10062075 3300025932 Bacteria 2542
103 Ga0207670_10184829 3300025936 Bacteria 1572
104 Ga0207691_10231795 3300025940 Bacteria 1599
105 Ga0207689_10005410 3300025942 Bacteria 11429
106 Ga0207661_10004853 3300025944 Bacteria 9423
107 Ga0207679_10012722 3300025945 Bacteria 5495
108 Ga0207679_10067295 3300025945 Bacteria 2687
109 Ga0207679_10133224 3300025945 Bacteria 1997
110 Ga0207667_10016052 3300025949 Bacteria 8481
111 Ga0207651_10126020 3300025960 Bacteria 1951
112 Ga0207668_10119765 3300025972 Bacteria 1991
113 Ga0207658_10024452 3300025986 Bacteria 4227
114 Ga0207639_10020200 3300026041 Bacteria 4765
115 Ga0207639_10117585 3300026041 Bacteria 2179
116 Ga0207702_10020368 3300026078 Bacteria 5495
117 Ga0207675_100007260 3300026118 Bacteria 10475
118 Ga0207698_10102753 3300026142 Bacteria 2373
119 Ga0207698_10151478 3300026142 Bacteria 2014
120 Ga0207698_10308607 3300026142 Bacteria 1476
121 Ga0209995_1006056 3300027471 Bacteria 1945
122 Ga0268266_10000065 3300028379 Bacteria 246498
123 Ga0268264_10000011 3300028381 Bacteria 580884
124 Ga0307513_10064177 3300031456 Bacteria 3872
125 Ga0307509_10063503 3300031507 Bacteria 3888
126 Ga0307508_10001362 3300031616 Bacteria 27521
127 Ga0307516_10001871 3300031730 Bacteria 28796
128 Ga0307406_10040060 3300031901 Bacteria 2911
129 Ga0307416_100349923 3300032002 Unclassified 1495
130 Ga0395898_0026696 3300037466 Bacteria 5806
131 Ga0395905_0000424 3300037471 Bacteria 58940
132 Ga0395905_0043548 3300037471 Bacteria 4211
133 Ga0395905_0415032 3300037471 Bacteria 1242
134 Ga0439439_0010384 3300041406 Bacteria 2225
135 Ga0439433_0023571 3300041999 Bacteria 1385
136 Ga0439449_0027940 3300042007 Bacteria 2104
137 Ga0439454_009309 3300042011 Bacteria 1273
138 Ga0439462_0004926 3300042015 Bacteria 3279
139 Ga0451577_0000010 3300042876 Bacteria 616686
140 Ga0451577_0026299 3300042876 Bacteria 5272
141 Ga0451577_0283391 3300042876 Bacteria 1501
142 Ga0466969_0000235 3300044656 Bacteria 30219
143 Ga0466972_0001764 3300044658 Bacteria 10604
144 Ga0453683_0000637 3300044673 Bacteria 38080
145 Ga0453683_0007268 3300044673 Bacteria 7544
146 Ga0466965_0024163 3300044683 Bacteria 2938
147 Ga0466961_0172687 3300044693 Bacteria 1344
148 Ga0466964_0037825 3300044706 Bacteria 1939
149 Ga0453684_0000130 3300044712 Bacteria 331761
150 Ga0453684_0000262 3300044712 Bacteria 226746
151 Ga0453684_0000616 3300044712 Bacteria 130153
152 Ga0453684_0028094 3300044712 Bacteria 8042
153 Ga0453684_0095732 3300044712 Bacteria 3648
154 Ga0466971_0020395 3300044719 Bacteria 2948
155 Ga0466968_0003029 3300044735 Bacteria 6208
156 Ga0466957_0001155 3300044842 Bacteria 13662
157 Ga0466959_0000015 3300045049 Bacteria 149242
158 Ga0466959_0000681 3300045049 Bacteria 19853
159 Ga0466959_0049161 3300045049 Bacteria 3098
160 Ga0466959_0211030 3300045049 Bacteria 1349
161 Ga0451576_0000957 3300045051 Bacteria 54079
162 Ga0466967_0485843 3300045976 Bacteria 1210
163 Ga0495633_0000017 3300046558 Bacteria 249973
164 Ga0495611_0000021 3300046648 Bacteria 123657
165 Ga0495625_0068306 3300046660 Bacteria 2499
166 Ga0495670_0115978 3300046691 Bacteria 1389
167 Ga0495687_000001 3300047443 Bacteria 1215582
168 Ga0496121_0000010 3300048924 Bacteria 793488
169 Ga0496126_0015072 3300048929 Bacteria 7792
170 Ga0501291_002120 3300049514 Bacteria 2352
171 Ga0501298_000345 3300049521 Bacteria 6237
172 Ga0501031_0047626 3300049568 Bacteria 2795
173 Ga0501032_0020731 3300049569 Bacteria 4576
174 Ga0501034_0016080 3300049571 Bacteria 7677
175 Ga0501036_0008269 3300049572 Bacteria 8529
176 Ga0501037_0103095 3300049573 Bacteria 2058
177 Ga0501038_0016085 3300049574 Bacteria 6792
178 Ga0501039_0410541 3300049575 Bacteria 1063
179 Ga0501043_0064538 3300049579 Bacteria 2875
180 Ga0501046_0010747 3300049580 Bacteria 7851
181 Ga0501048_0003516 3300049582 Bacteria 11913
182 Ga0501068_0186301 3300049584 Bacteria 1313
183 Ga0501070_0018849 3300049586 Bacteria 5790
184 Ga0501073_0000756 3300049589 Bacteria 22920
185 Ga0501074_0005849 3300049590 Bacteria 8872
186 Ga0501198_000744 3300049649 Bacteria 4060
187 Ga0501202_000519 3300049652 Bacteria 5561
188 Ga0501202_002573 3300049652 Bacteria 3058
189 Ga0501222_001289 3300049662 Bacteria 3516
190 Ga0501223_002673 3300049663 Bacteria 3928
191 Ga0501233_001399 3300049668 Bacteria 4121
192 Ga0501233_002062 3300049668 Bacteria 3507
193 Ga0501235_003870 3300049669 Bacteria 3234
194 Ga0501242_003190 3300049674 Bacteria 1763
195 Ga0501257_005233 3300049686 Bacteria 2855
196 Ga0501259_000050 3300049688 Bacteria 16591
197 Ga0501221_002656 3300049704 Bacteria 2945
198 Ga0501234_003537 3300049707 Bacteria 2455
199 Ga0501234_008620 3300049707 Unclassified 1589
200 Ga0501245_000570 3300049708 Bacteria 4504
201 Ga0501079_0083070 3300049741 Bacteria 2478
202 Ga0501080_0175886 3300049742 Bacteria 1971
203 Ga0501083_0035281 3300049744 Bacteria 3417
204 Ga0501083_0081535 3300049744 Bacteria 2144
205 Ga0501268_005171 3300049765 Bacteria 1866
206 Ga0501035_0067681 3300049822 Bacteria 3168
207 Ga0501212_000453 3300049851 Bacteria 3962
208 Ga0500644_0000488 3300053088 Bacteria 17326
209 Ga0500646_0011615 3300053090 Bacteria 2266
210 Ga0500583_0000224 3300053092 Bacteria 20897
211 Ga0500583_0061171 3300053092 Bacteria 1777
212 Ga0500569_000124 3300053109 Bacteria 12046
213 Ga0500577_0001651 3300053142 Bacteria 5712
214 Ga0500616_0014414 3300053153 Bacteria 4543
215 Ga0500622_0000059 3300053156 Bacteria 134223
216 Ga0500633_0078800 3300053160 Bacteria 1189
217 Ga0500611_000005 3300053727 Bacteria 228837
218 Ga0500661_014314 3300055283 Bacteria 1428
219 Ga0501082_0432675 3300060353 Bacteria 1149
220 Ga0466962_0037917 3300061719 Bacteria 2309
221 2884795761 2884791551 Bacteria 8511252
222 2819572063 2818991442 Bacteria 8318214
223 2821141692 2821136567 Bacteria 8080116
224 2883070874 2883068021 Bacteria 6192739
225 2896114012 2896109856 Bacteria 7140722
226 2904469893 2904467357 Bacteria 8057758
227 2929178675 2929177148 Bacteria 7883697
228 2945981086 2945977869 Bacteria 7777518
229 2946019513 2946013367 Bacteria 7766675
230 SwRhRL2b_contig_2796384
231 JGI24739J22299_10014338
232 JGI25159J45721_1011827
233 JGI25153J46596_10029516
234 rootH1_10087428
235 rootH2_10004858
236 rootH2_10011909
237 rootH2_10052963
238 rootH2_10084737
239 rootH1_10088425
240 JGI25160J50197_1007678
241 Ga0065704_10074551
242 Ga0070676_10063770
243 Ga0070683_100012609
244 Ga0070690_100013413
245 Ga0070670_100044175
246 Ga0068869_100108756
247 Ga0070666_10111507
248 Ga0070668_100042369
249 Ga0070669_100033585
250 Ga0070671_100200210
251 Ga0070673_100390036
252 Ga0070688_100157435
253 Ga0070659_100062461
254 Ga0070659_100190156
255 Ga0070667_100002333
256 Ga0070684_100007996
257 Ga0068853_100002321
258 Ga0068853_100200474
259 Ga0070672_100007250
260 Ga0070672_100187734
261 Ga0070686_100057081
262 Ga0070665_100000001
263 Ga0068855_100031693
264 Ga0068855_100141981
265 Ga0070664_100026896
266 Ga0070664_100059032
267 Ga0068857_100160605
268 Ga0068856_100002822
269 Ga0070702_100072032
270 Ga0068852_100014910
271 Ga0068852_100060461
272 Ga0068852_100139257
273 Ga0068852_100385867
274 Ga0068859_100010302
275 Ga0068858_100255245
276 Ga0068860_100000004
277 Ga0097620_100010301
278 Ga0105240_10000061
279 Ga0105240_10030932
280 Ga0105241_10000491
281 Ga0105241_10419039
282 Ga0105242_10046793
283 Ga0105237_10011113
284 Ga0105237_10025906
285 Ga0105237_10061073
286 Ga0105237_10078326
287 Ga0105237_10198389
288 Ga0105238_10028281
289 Ga0105238_10071469
290 Ga0105239_10000029
291 Ga0105239_10043489
292 Ga0105239_10080684
293 Ga0105239_10108734
294 Ga0105239_10120127
295 Ga0157371_10004195
296 Ga0157371_10031379
297 Ga0157370_10019359
298 Ga0157374_10000001
299 Ga0157374_10043760
300 Ga0157378_10006378
301 Ga0163162_10001306
302 Ga0157372_10155770
303 Ga0157372_10345808
304 Ga0163163_10001622
305 Ga0157380_10196220
306 Ga0157376_10007182
307 Ga0182005_1000040
308 Ga0209436_100519
309 Ga0209436_103237
310 Ga0209130_1001416
311 Ga0209564_1004634
312 Ga0209758_1003964
313 Ga0207426_1000258
314 Ga0207426_1001000
315 Ga0207426_1006580
316 Ga0207680_10046864
317 Ga0207647_10000017
318 Ga0207645_10038232
319 Ga0207654_10022428
320 Ga0207695_10000057
321 Ga0207695_10001216
322 Ga0207695_10068990
323 Ga0207671_10006310
324 Ga0207671_10042467
325 Ga0207671_10053028
326 Ga0207662_10007559
327 Ga0207649_10065380
328 Ga0207694_10189449
329 Ga0207650_10002470
330 Ga0207644_10174784
331 Ga0207690_10062075
332 Ga0207670_10184829
333 Ga0207691_10231795
334 Ga0207689_10005410
335 Ga0207661_10004853
336 Ga0207679_10012722
337 Ga0207679_10067295
338 Ga0207679_10133224
339 Ga0207667_10016052
340 Ga0207651_10126020
341 Ga0207668_10119765
342 Ga0207658_10024452
343 Ga0207639_10020200
344 Ga0207639_10117585
345 Ga0207702_10020368
346 Ga0207675_100007260
347 Ga0207698_10102753
348 Ga0207698_10151478
349 Ga0207698_10308607
350 Ga0209995_1006056
351 Ga0268266_10000065
352 Ga0268264_10000011
353 Ga0307513_10064177
354 Ga0307509_10063503
355 Ga0307508_10001362
356 Ga0307516_10001871
357 Ga0307406_10040060
358 Ga0307416_100349923
359 Ga0395898_0026696
360 Ga0395905_0000424
361 Ga0395905_0043548
362 Ga0395905_0415032
363 Ga0439439_0010384
364 Ga0439433_0023571
365 Ga0439449_0027940
366 Ga0439454_009309
367 Ga0439462_0004926
368 Ga0451577_0000010
369 Ga0451577_0026299
370 Ga0451577_0283391
371 Ga0466969_0000235
372 Ga0466972_0001764
373 Ga0453683_0000637
374 Ga0453683_0007268
375 Ga0466965_0024163
376 Ga0466961_0172687
377 Ga0466964_0037825
378 Ga0453684_0000130
379 Ga0453684_0000262
380 Ga0453684_0000616
381 Ga0453684_0028094
382 Ga0453684_0095732
383 Ga0466971_0020395
384 Ga0466968_0003029
385 Ga0466957_0001155
386 Ga0466959_0000015
387 Ga0466959_0000681
388 Ga0466959_0049161
389 Ga0466959_0211030
390 Ga0451576_0000957
391 Ga0466967_0485843
392 Ga0495633_0000017
393 Ga0495611_0000021
394 Ga0495625_0068306
395 Ga0495670_0115978
396 Ga0495687_000001
397 Ga0496121_0000010
398 Ga0496126_0015072
399 Ga0501291_002120
400 Ga0501298_000345
401 Ga0501031_0047626
402 Ga0501032_0020731
403 Ga0501034_0016080
404 Ga0501036_0008269
405 Ga0501037_0103095
406 Ga0501038_0016085
407 Ga0501039_0410541
408 Ga0501043_0064538
409 Ga0501046_0010747
410 Ga0501048_0003516
411 Ga0501068_0186301
412 Ga0501070_0018849
413 Ga0501073_0000756
414 Ga0501074_0005849
415 Ga0501198_000744
416 Ga0501202_000519
417 Ga0501202_002573
418 Ga0501222_001289
419 Ga0501223_002673
420 Ga0501233_001399
421 Ga0501233_002062
422 Ga0501235_003870
423 Ga0501242_003190
424 Ga0501257_005233
425 Ga0501259_000050
426 Ga0501221_002656
427 Ga0501234_003537
428 Ga0501234_008620
429 Ga0501245_000570
430 Ga0501079_0083070
431 Ga0501080_0175886
432 Ga0501083_0035281
433 Ga0501083_0081535
434 Ga0501268_005171
435 Ga0501035_0067681
436 Ga0501212_000453
437 Ga0500644_0000488
438 Ga0500646_0011615
439 Ga0500583_0000224
440 Ga0500583_0061171
441 Ga0500569_000124
442 Ga0500577_0001651
443 Ga0500616_0014414
444 Ga0500622_0000059
445 Ga0500633_0078800
446 Ga0500611_000005
447 Ga0500661_014314
448 Ga0501082_0432675
449 Ga0466962_0037917
450 2884795761
451 2819572063
452 2821141692
453 2883070874
454 2896114012
455 2904469893
456 2929178675
457 2945981086
458 2946019513

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

1

284

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhj-assembly2.cif.gz_C independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9228 6 330
6dfu-assembly1.cif.gz_A tryptophan--trna ligase from haemophilus influenzae. 0.9135 5 330
3fhj-assembly3.cif.gz_E independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9134 6 330
3fhj-assembly3.cif.gz_F independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9105 6 330
3m5w-assembly1.cif.gz_A crystal structure of tryptophanyl-trna synthetase from campylobacter jejuni 0.9105 6 330
ID Description Score Start End Superfamily
3m5wA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9178 6 180 3.40.50.620
2g36A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8949 6 180 3.40.50.620
3prhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8937 5 332 3.40.50.620
af_Q86A90_13_226_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8933 5 181 3.40.50.620
2yy5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8855 5 180 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1M5FNW5-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9526 5 333 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A520C4N7-F1-model_v4 Tryptophan--tRNA ligase 0.952 173 334 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A258KSE9-F1-model_v4 Tryptophan--tRNA ligase 0.9427 147 334 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-X1JDE2-F1-model_v4 tryptophan--tRNA ligase (EC 6.1.1.2) 0.9409 3 111 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A420YT38-F1-model_v4 tryptophan--tRNA ligase (EC 6.1.1.2) 0.9374 3 107 GO:0004830
GO:0005524
GO:0005829
GO:0006436

Map