F342547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 175 | 458 | 334 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2884791551|2884795761 |
| Length | 332 |
| Sequence | KEIVVSGIRPTGYLHLGNYFGAIRNYIRMQEEFDCYFFVADWHSLTTHPNPKDLQANVMRVLAENIASGLDPEKVTLYAQSHVPEIAELYLLMNMLAYKGELEKVPTFKDKVRLQPENVNAGLLTYPVLMSVDILIQRAVKVPVGKDQGQHLEMARNFAQRFNNRYGNLFPEPVAFNYGDNLVRILSLDGKGGKMSKSENEMSTLYLSDSDEQIRQKLKKAKTDSGSGVPGEPMPESVANLIEIMKLVSTPDTVQFYTDAFNAGTIRYGDMKTQLGEDMVKFITPIREKAKGLQEDPTYLRKIMKEGAEKARANAAQTLQQARNLMGLNYFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 88 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 89 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 90 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 91 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 92 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 96 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 97 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 98 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 99 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 100 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 101 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 102 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 103 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 104 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 105 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 106 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 107 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 108 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 109 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 110 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 120 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 121 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 122 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 123 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 138 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 139 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 140 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 141 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 142 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 143 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 144 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 145 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 146 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 147 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 148 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 153 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 155 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 157 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 158 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 159 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 160 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 161 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 162 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 163 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 164 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 165 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 167 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 168 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 169 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 170 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 171 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 172 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 173 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 174 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 175 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.07 |
| Metatranscriptomes | 0 |
| Isolates | 3.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.61 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 82.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2796384 | 2162886007 | Bacteria | 2352 |
| 2 | JGI24739J22299_10014338 | 3300001989 | Bacteria | 2884 |
| 3 | JGI25159J45721_1011827 | 3300002987 | Bacteria | 2114 |
| 4 | JGI25153J46596_10029516 | 3300003215 | Bacteria | 1881 |
| 5 | rootH1_10087428 | 3300003316 | Bacteria | 6678 |
| 6 | rootH2_10004858 | 3300003320 | Bacteria | 14814 |
| 7 | rootH2_10011909 | 3300003320 | Bacteria | 17660 |
| 8 | rootH2_10052963 | 3300003320 | Bacteria | 13053 |
| 9 | rootH2_10084737 | 3300003320 | Bacteria | 2845 |
| 10 | rootH1_10088425 | 3300003323 | Bacteria | 2210 |
| 11 | JGI25160J50197_1007678 | 3300003354 | Bacteria | 4195 |
| 12 | Ga0065704_10074551 | 3300005289 | Bacteria | 6190 |
| 13 | Ga0070676_10063770 | 3300005328 | Bacteria | 2196 |
| 14 | Ga0070683_100012609 | 3300005329 | Bacteria | 7348 |
| 15 | Ga0070690_100013413 | 3300005330 | Bacteria | 4841 |
| 16 | Ga0070670_100044175 | 3300005331 | Unclassified | 3831 |
| 17 | Ga0068869_100108756 | 3300005334 | Bacteria | 2106 |
| 18 | Ga0070666_10111507 | 3300005335 | Bacteria | 1892 |
| 19 | Ga0070668_100042369 | 3300005347 | Bacteria | 3489 |
| 20 | Ga0070669_100033585 | 3300005353 | Bacteria | 3712 |
| 21 | Ga0070671_100200210 | 3300005355 | Bacteria | 1693 |
| 22 | Ga0070673_100390036 | 3300005364 | Bacteria | 1243 |
| 23 | Ga0070688_100157435 | 3300005365 | Bacteria | 1558 |
| 24 | Ga0070659_100062461 | 3300005366 | Bacteria | 2944 |
| 25 | Ga0070659_100190156 | 3300005366 | Bacteria | 1687 |
| 26 | Ga0070667_100002333 | 3300005367 | Bacteria | 16608 |
| 27 | Ga0070684_100007996 | 3300005535 | Bacteria | 8255 |
| 28 | Ga0068853_100002321 | 3300005539 | Bacteria | 14242 |
| 29 | Ga0068853_100200474 | 3300005539 | Bacteria | 1816 |
| 30 | Ga0070672_100007250 | 3300005543 | Bacteria | 7511 |
| 31 | Ga0070672_100187734 | 3300005543 | Bacteria | 1725 |
| 32 | Ga0070686_100057081 | 3300005544 | Bacteria | 2507 |
| 33 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 34 | Ga0068855_100031693 | 3300005563 | Bacteria | 6312 |
| 35 | Ga0068855_100141981 | 3300005563 | Bacteria | 2736 |
| 36 | Ga0070664_100026896 | 3300005564 | Bacteria | 4778 |
| 37 | Ga0070664_100059032 | 3300005564 | Bacteria | 3264 |
| 38 | Ga0068857_100160605 | 3300005577 | Bacteria | 2039 |
| 39 | Ga0068856_100002822 | 3300005614 | Bacteria | 17786 |
| 40 | Ga0070702_100072032 | 3300005615 | Bacteria | 2044 |
| 41 | Ga0068852_100014910 | 3300005616 | Bacteria | 6006 |
| 42 | Ga0068852_100060461 | 3300005616 | Bacteria | 3289 |
| 43 | Ga0068852_100139257 | 3300005616 | Bacteria | 2244 |
| 44 | Ga0068852_100385867 | 3300005616 | Bacteria | 1375 |
| 45 | Ga0068859_100010302 | 3300005617 | Bacteria | 9408 |
| 46 | Ga0068858_100255245 | 3300005842 | Bacteria | 1666 |
| 47 | Ga0068860_100000004 | 3300005843 | Bacteria | 506126 |
| 48 | Ga0097620_100010301 | 3300006931 | Bacteria | 9408 |
| 49 | Ga0105240_10000061 | 3300009093 | Bacteria | 218897 |
| 50 | Ga0105240_10030932 | 3300009093 | Bacteria | 6951 |
| 51 | Ga0105241_10000491 | 3300009174 | Bacteria | 29828 |
| 52 | Ga0105241_10419039 | 3300009174 | Bacteria | 1178 |
| 53 | Ga0105242_10046793 | 3300009176 | Bacteria | 3511 |
| 54 | Ga0105237_10011113 | 3300009545 | Bacteria | 9544 |
| 55 | Ga0105237_10025906 | 3300009545 | Bacteria | 5996 |
| 56 | Ga0105237_10061073 | 3300009545 | Bacteria | 3769 |
| 57 | Ga0105237_10078326 | 3300009545 | Bacteria | 3295 |
| 58 | Ga0105237_10198389 | 3300009545 | Bacteria | 2006 |
| 59 | Ga0105238_10028281 | 3300009551 | Bacteria | 5713 |
| 60 | Ga0105238_10071469 | 3300009551 | Bacteria | 3467 |
| 61 | Ga0105239_10000029 | 3300010375 | Bacteria | 234749 |
| 62 | Ga0105239_10043489 | 3300010375 | Bacteria | 4924 |
| 63 | Ga0105239_10080684 | 3300010375 | Bacteria | 3580 |
| 64 | Ga0105239_10108734 | 3300010375 | Bacteria | 3072 |
| 65 | Ga0105239_10120127 | 3300010375 | Bacteria | 2917 |
| 66 | Ga0157371_10004195 | 3300013102 | Bacteria | 12698 |
| 67 | Ga0157371_10031379 | 3300013102 | Unclassified | 3828 |
| 68 | Ga0157370_10019359 | 3300013104 | Bacteria | 6831 |
| 69 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 70 | Ga0157374_10043760 | 3300013296 | Bacteria | 4137 |
| 71 | Ga0157378_10006378 | 3300013297 | Bacteria | 10314 |
| 72 | Ga0163162_10001306 | 3300013306 | Bacteria | 23316 |
| 73 | Ga0157372_10155770 | 3300013307 | Bacteria | 2639 |
| 74 | Ga0157372_10345808 | 3300013307 | Unclassified | 1733 |
| 75 | Ga0163163_10001622 | 3300014325 | Bacteria | 18926 |
| 76 | Ga0157380_10196220 | 3300014326 | Bacteria | 1787 |
| 77 | Ga0157376_10007182 | 3300014969 | Bacteria | 7920 |
| 78 | Ga0182005_1000040 | 3300015265 | Bacteria | 151222 |
| 79 | Ga0209436_100519 | 3300025208 | Bacteria | 16799 |
| 80 | Ga0209436_103237 | 3300025208 | Bacteria | 4419 |
| 81 | Ga0209130_1001416 | 3300025284 | Bacteria | 15976 |
| 82 | Ga0209564_1004634 | 3300025295 | Bacteria | 8272 |
| 83 | Ga0209758_1003964 | 3300025297 | Bacteria | 12840 |
| 84 | Ga0207426_1000258 | 3300025302 | Bacteria | 114759 |
| 85 | Ga0207426_1001000 | 3300025302 | Bacteria | 27562 |
| 86 | Ga0207426_1006580 | 3300025302 | Bacteria | 5018 |
| 87 | Ga0207680_10046864 | 3300025903 | Bacteria | 2558 |
| 88 | Ga0207647_10000017 | 3300025904 | Bacteria | 129999 |
| 89 | Ga0207645_10038232 | 3300025907 | Bacteria | 3078 |
| 90 | Ga0207654_10022428 | 3300025911 | Bacteria | 3369 |
| 91 | Ga0207695_10000057 | 3300025913 | Bacteria | 376090 |
| 92 | Ga0207695_10001216 | 3300025913 | Bacteria | 44107 |
| 93 | Ga0207695_10068990 | 3300025913 | Bacteria | 3620 |
| 94 | Ga0207671_10006310 | 3300025914 | Bacteria | 10589 |
| 95 | Ga0207671_10042467 | 3300025914 | Bacteria | 3365 |
| 96 | Ga0207671_10053028 | 3300025914 | Bacteria | 3006 |
| 97 | Ga0207662_10007559 | 3300025918 | Bacteria | 5920 |
| 98 | Ga0207649_10065380 | 3300025920 | Bacteria | 2302 |
| 99 | Ga0207694_10189449 | 3300025924 | Bacteria | 1670 |
| 100 | Ga0207650_10002470 | 3300025925 | Bacteria | 12857 |
| 101 | Ga0207644_10174784 | 3300025931 | Bacteria | 1679 |
| 102 | Ga0207690_10062075 | 3300025932 | Bacteria | 2542 |
| 103 | Ga0207670_10184829 | 3300025936 | Bacteria | 1572 |
| 104 | Ga0207691_10231795 | 3300025940 | Bacteria | 1599 |
| 105 | Ga0207689_10005410 | 3300025942 | Bacteria | 11429 |
| 106 | Ga0207661_10004853 | 3300025944 | Bacteria | 9423 |
| 107 | Ga0207679_10012722 | 3300025945 | Bacteria | 5495 |
| 108 | Ga0207679_10067295 | 3300025945 | Bacteria | 2687 |
| 109 | Ga0207679_10133224 | 3300025945 | Bacteria | 1997 |
| 110 | Ga0207667_10016052 | 3300025949 | Bacteria | 8481 |
| 111 | Ga0207651_10126020 | 3300025960 | Bacteria | 1951 |
| 112 | Ga0207668_10119765 | 3300025972 | Bacteria | 1991 |
| 113 | Ga0207658_10024452 | 3300025986 | Bacteria | 4227 |
| 114 | Ga0207639_10020200 | 3300026041 | Bacteria | 4765 |
| 115 | Ga0207639_10117585 | 3300026041 | Bacteria | 2179 |
| 116 | Ga0207702_10020368 | 3300026078 | Bacteria | 5495 |
| 117 | Ga0207675_100007260 | 3300026118 | Bacteria | 10475 |
| 118 | Ga0207698_10102753 | 3300026142 | Bacteria | 2373 |
| 119 | Ga0207698_10151478 | 3300026142 | Bacteria | 2014 |
| 120 | Ga0207698_10308607 | 3300026142 | Bacteria | 1476 |
| 121 | Ga0209995_1006056 | 3300027471 | Bacteria | 1945 |
| 122 | Ga0268266_10000065 | 3300028379 | Bacteria | 246498 |
| 123 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 124 | Ga0307513_10064177 | 3300031456 | Bacteria | 3872 |
| 125 | Ga0307509_10063503 | 3300031507 | Bacteria | 3888 |
| 126 | Ga0307508_10001362 | 3300031616 | Bacteria | 27521 |
| 127 | Ga0307516_10001871 | 3300031730 | Bacteria | 28796 |
| 128 | Ga0307406_10040060 | 3300031901 | Bacteria | 2911 |
| 129 | Ga0307416_100349923 | 3300032002 | Unclassified | 1495 |
| 130 | Ga0395898_0026696 | 3300037466 | Bacteria | 5806 |
| 131 | Ga0395905_0000424 | 3300037471 | Bacteria | 58940 |
| 132 | Ga0395905_0043548 | 3300037471 | Bacteria | 4211 |
| 133 | Ga0395905_0415032 | 3300037471 | Bacteria | 1242 |
| 134 | Ga0439439_0010384 | 3300041406 | Bacteria | 2225 |
| 135 | Ga0439433_0023571 | 3300041999 | Bacteria | 1385 |
| 136 | Ga0439449_0027940 | 3300042007 | Bacteria | 2104 |
| 137 | Ga0439454_009309 | 3300042011 | Bacteria | 1273 |
| 138 | Ga0439462_0004926 | 3300042015 | Bacteria | 3279 |
| 139 | Ga0451577_0000010 | 3300042876 | Bacteria | 616686 |
| 140 | Ga0451577_0026299 | 3300042876 | Bacteria | 5272 |
| 141 | Ga0451577_0283391 | 3300042876 | Bacteria | 1501 |
| 142 | Ga0466969_0000235 | 3300044656 | Bacteria | 30219 |
| 143 | Ga0466972_0001764 | 3300044658 | Bacteria | 10604 |
| 144 | Ga0453683_0000637 | 3300044673 | Bacteria | 38080 |
| 145 | Ga0453683_0007268 | 3300044673 | Bacteria | 7544 |
| 146 | Ga0466965_0024163 | 3300044683 | Bacteria | 2938 |
| 147 | Ga0466961_0172687 | 3300044693 | Bacteria | 1344 |
| 148 | Ga0466964_0037825 | 3300044706 | Bacteria | 1939 |
| 149 | Ga0453684_0000130 | 3300044712 | Bacteria | 331761 |
| 150 | Ga0453684_0000262 | 3300044712 | Bacteria | 226746 |
| 151 | Ga0453684_0000616 | 3300044712 | Bacteria | 130153 |
| 152 | Ga0453684_0028094 | 3300044712 | Bacteria | 8042 |
| 153 | Ga0453684_0095732 | 3300044712 | Bacteria | 3648 |
| 154 | Ga0466971_0020395 | 3300044719 | Bacteria | 2948 |
| 155 | Ga0466968_0003029 | 3300044735 | Bacteria | 6208 |
| 156 | Ga0466957_0001155 | 3300044842 | Bacteria | 13662 |
| 157 | Ga0466959_0000015 | 3300045049 | Bacteria | 149242 |
| 158 | Ga0466959_0000681 | 3300045049 | Bacteria | 19853 |
| 159 | Ga0466959_0049161 | 3300045049 | Bacteria | 3098 |
| 160 | Ga0466959_0211030 | 3300045049 | Bacteria | 1349 |
| 161 | Ga0451576_0000957 | 3300045051 | Bacteria | 54079 |
| 162 | Ga0466967_0485843 | 3300045976 | Bacteria | 1210 |
| 163 | Ga0495633_0000017 | 3300046558 | Bacteria | 249973 |
| 164 | Ga0495611_0000021 | 3300046648 | Bacteria | 123657 |
| 165 | Ga0495625_0068306 | 3300046660 | Bacteria | 2499 |
| 166 | Ga0495670_0115978 | 3300046691 | Bacteria | 1389 |
| 167 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 168 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 169 | Ga0496126_0015072 | 3300048929 | Bacteria | 7792 |
| 170 | Ga0501291_002120 | 3300049514 | Bacteria | 2352 |
| 171 | Ga0501298_000345 | 3300049521 | Bacteria | 6237 |
| 172 | Ga0501031_0047626 | 3300049568 | Bacteria | 2795 |
| 173 | Ga0501032_0020731 | 3300049569 | Bacteria | 4576 |
| 174 | Ga0501034_0016080 | 3300049571 | Bacteria | 7677 |
| 175 | Ga0501036_0008269 | 3300049572 | Bacteria | 8529 |
| 176 | Ga0501037_0103095 | 3300049573 | Bacteria | 2058 |
| 177 | Ga0501038_0016085 | 3300049574 | Bacteria | 6792 |
| 178 | Ga0501039_0410541 | 3300049575 | Bacteria | 1063 |
| 179 | Ga0501043_0064538 | 3300049579 | Bacteria | 2875 |
| 180 | Ga0501046_0010747 | 3300049580 | Bacteria | 7851 |
| 181 | Ga0501048_0003516 | 3300049582 | Bacteria | 11913 |
| 182 | Ga0501068_0186301 | 3300049584 | Bacteria | 1313 |
| 183 | Ga0501070_0018849 | 3300049586 | Bacteria | 5790 |
| 184 | Ga0501073_0000756 | 3300049589 | Bacteria | 22920 |
| 185 | Ga0501074_0005849 | 3300049590 | Bacteria | 8872 |
| 186 | Ga0501198_000744 | 3300049649 | Bacteria | 4060 |
| 187 | Ga0501202_000519 | 3300049652 | Bacteria | 5561 |
| 188 | Ga0501202_002573 | 3300049652 | Bacteria | 3058 |
| 189 | Ga0501222_001289 | 3300049662 | Bacteria | 3516 |
| 190 | Ga0501223_002673 | 3300049663 | Bacteria | 3928 |
| 191 | Ga0501233_001399 | 3300049668 | Bacteria | 4121 |
| 192 | Ga0501233_002062 | 3300049668 | Bacteria | 3507 |
| 193 | Ga0501235_003870 | 3300049669 | Bacteria | 3234 |
| 194 | Ga0501242_003190 | 3300049674 | Bacteria | 1763 |
| 195 | Ga0501257_005233 | 3300049686 | Bacteria | 2855 |
| 196 | Ga0501259_000050 | 3300049688 | Bacteria | 16591 |
| 197 | Ga0501221_002656 | 3300049704 | Bacteria | 2945 |
| 198 | Ga0501234_003537 | 3300049707 | Bacteria | 2455 |
| 199 | Ga0501234_008620 | 3300049707 | Unclassified | 1589 |
| 200 | Ga0501245_000570 | 3300049708 | Bacteria | 4504 |
| 201 | Ga0501079_0083070 | 3300049741 | Bacteria | 2478 |
| 202 | Ga0501080_0175886 | 3300049742 | Bacteria | 1971 |
| 203 | Ga0501083_0035281 | 3300049744 | Bacteria | 3417 |
| 204 | Ga0501083_0081535 | 3300049744 | Bacteria | 2144 |
| 205 | Ga0501268_005171 | 3300049765 | Bacteria | 1866 |
| 206 | Ga0501035_0067681 | 3300049822 | Bacteria | 3168 |
| 207 | Ga0501212_000453 | 3300049851 | Bacteria | 3962 |
| 208 | Ga0500644_0000488 | 3300053088 | Bacteria | 17326 |
| 209 | Ga0500646_0011615 | 3300053090 | Bacteria | 2266 |
| 210 | Ga0500583_0000224 | 3300053092 | Bacteria | 20897 |
| 211 | Ga0500583_0061171 | 3300053092 | Bacteria | 1777 |
| 212 | Ga0500569_000124 | 3300053109 | Bacteria | 12046 |
| 213 | Ga0500577_0001651 | 3300053142 | Bacteria | 5712 |
| 214 | Ga0500616_0014414 | 3300053153 | Bacteria | 4543 |
| 215 | Ga0500622_0000059 | 3300053156 | Bacteria | 134223 |
| 216 | Ga0500633_0078800 | 3300053160 | Bacteria | 1189 |
| 217 | Ga0500611_000005 | 3300053727 | Bacteria | 228837 |
| 218 | Ga0500661_014314 | 3300055283 | Bacteria | 1428 |
| 219 | Ga0501082_0432675 | 3300060353 | Bacteria | 1149 |
| 220 | Ga0466962_0037917 | 3300061719 | Bacteria | 2309 |
| 221 | 2884795761 | 2884791551 | Bacteria | 8511252 |
| 222 | 2819572063 | 2818991442 | Bacteria | 8318214 |
| 223 | 2821141692 | 2821136567 | Bacteria | 8080116 |
| 224 | 2883070874 | 2883068021 | Bacteria | 6192739 |
| 225 | 2896114012 | 2896109856 | Bacteria | 7140722 |
| 226 | 2904469893 | 2904467357 | Bacteria | 8057758 |
| 227 | 2929178675 | 2929177148 | Bacteria | 7883697 |
| 228 | 2945981086 | 2945977869 | Bacteria | 7777518 |
| 229 | 2946019513 | 2946013367 | Bacteria | 7766675 |
| 230 | SwRhRL2b_contig_2796384 | |||
| 231 | JGI24739J22299_10014338 | |||
| 232 | JGI25159J45721_1011827 | |||
| 233 | JGI25153J46596_10029516 | |||
| 234 | rootH1_10087428 | |||
| 235 | rootH2_10004858 | |||
| 236 | rootH2_10011909 | |||
| 237 | rootH2_10052963 | |||
| 238 | rootH2_10084737 | |||
| 239 | rootH1_10088425 | |||
| 240 | JGI25160J50197_1007678 | |||
| 241 | Ga0065704_10074551 | |||
| 242 | Ga0070676_10063770 | |||
| 243 | Ga0070683_100012609 | |||
| 244 | Ga0070690_100013413 | |||
| 245 | Ga0070670_100044175 | |||
| 246 | Ga0068869_100108756 | |||
| 247 | Ga0070666_10111507 | |||
| 248 | Ga0070668_100042369 | |||
| 249 | Ga0070669_100033585 | |||
| 250 | Ga0070671_100200210 | |||
| 251 | Ga0070673_100390036 | |||
| 252 | Ga0070688_100157435 | |||
| 253 | Ga0070659_100062461 | |||
| 254 | Ga0070659_100190156 | |||
| 255 | Ga0070667_100002333 | |||
| 256 | Ga0070684_100007996 | |||
| 257 | Ga0068853_100002321 | |||
| 258 | Ga0068853_100200474 | |||
| 259 | Ga0070672_100007250 | |||
| 260 | Ga0070672_100187734 | |||
| 261 | Ga0070686_100057081 | |||
| 262 | Ga0070665_100000001 | |||
| 263 | Ga0068855_100031693 | |||
| 264 | Ga0068855_100141981 | |||
| 265 | Ga0070664_100026896 | |||
| 266 | Ga0070664_100059032 | |||
| 267 | Ga0068857_100160605 | |||
| 268 | Ga0068856_100002822 | |||
| 269 | Ga0070702_100072032 | |||
| 270 | Ga0068852_100014910 | |||
| 271 | Ga0068852_100060461 | |||
| 272 | Ga0068852_100139257 | |||
| 273 | Ga0068852_100385867 | |||
| 274 | Ga0068859_100010302 | |||
| 275 | Ga0068858_100255245 | |||
| 276 | Ga0068860_100000004 | |||
| 277 | Ga0097620_100010301 | |||
| 278 | Ga0105240_10000061 | |||
| 279 | Ga0105240_10030932 | |||
| 280 | Ga0105241_10000491 | |||
| 281 | Ga0105241_10419039 | |||
| 282 | Ga0105242_10046793 | |||
| 283 | Ga0105237_10011113 | |||
| 284 | Ga0105237_10025906 | |||
| 285 | Ga0105237_10061073 | |||
| 286 | Ga0105237_10078326 | |||
| 287 | Ga0105237_10198389 | |||
| 288 | Ga0105238_10028281 | |||
| 289 | Ga0105238_10071469 | |||
| 290 | Ga0105239_10000029 | |||
| 291 | Ga0105239_10043489 | |||
| 292 | Ga0105239_10080684 | |||
| 293 | Ga0105239_10108734 | |||
| 294 | Ga0105239_10120127 | |||
| 295 | Ga0157371_10004195 | |||
| 296 | Ga0157371_10031379 | |||
| 297 | Ga0157370_10019359 | |||
| 298 | Ga0157374_10000001 | |||
| 299 | Ga0157374_10043760 | |||
| 300 | Ga0157378_10006378 | |||
| 301 | Ga0163162_10001306 | |||
| 302 | Ga0157372_10155770 | |||
| 303 | Ga0157372_10345808 | |||
| 304 | Ga0163163_10001622 | |||
| 305 | Ga0157380_10196220 | |||
| 306 | Ga0157376_10007182 | |||
| 307 | Ga0182005_1000040 | |||
| 308 | Ga0209436_100519 | |||
| 309 | Ga0209436_103237 | |||
| 310 | Ga0209130_1001416 | |||
| 311 | Ga0209564_1004634 | |||
| 312 | Ga0209758_1003964 | |||
| 313 | Ga0207426_1000258 | |||
| 314 | Ga0207426_1001000 | |||
| 315 | Ga0207426_1006580 | |||
| 316 | Ga0207680_10046864 | |||
| 317 | Ga0207647_10000017 | |||
| 318 | Ga0207645_10038232 | |||
| 319 | Ga0207654_10022428 | |||
| 320 | Ga0207695_10000057 | |||
| 321 | Ga0207695_10001216 | |||
| 322 | Ga0207695_10068990 | |||
| 323 | Ga0207671_10006310 | |||
| 324 | Ga0207671_10042467 | |||
| 325 | Ga0207671_10053028 | |||
| 326 | Ga0207662_10007559 | |||
| 327 | Ga0207649_10065380 | |||
| 328 | Ga0207694_10189449 | |||
| 329 | Ga0207650_10002470 | |||
| 330 | Ga0207644_10174784 | |||
| 331 | Ga0207690_10062075 | |||
| 332 | Ga0207670_10184829 | |||
| 333 | Ga0207691_10231795 | |||
| 334 | Ga0207689_10005410 | |||
| 335 | Ga0207661_10004853 | |||
| 336 | Ga0207679_10012722 | |||
| 337 | Ga0207679_10067295 | |||
| 338 | Ga0207679_10133224 | |||
| 339 | Ga0207667_10016052 | |||
| 340 | Ga0207651_10126020 | |||
| 341 | Ga0207668_10119765 | |||
| 342 | Ga0207658_10024452 | |||
| 343 | Ga0207639_10020200 | |||
| 344 | Ga0207639_10117585 | |||
| 345 | Ga0207702_10020368 | |||
| 346 | Ga0207675_100007260 | |||
| 347 | Ga0207698_10102753 | |||
| 348 | Ga0207698_10151478 | |||
| 349 | Ga0207698_10308607 | |||
| 350 | Ga0209995_1006056 | |||
| 351 | Ga0268266_10000065 | |||
| 352 | Ga0268264_10000011 | |||
| 353 | Ga0307513_10064177 | |||
| 354 | Ga0307509_10063503 | |||
| 355 | Ga0307508_10001362 | |||
| 356 | Ga0307516_10001871 | |||
| 357 | Ga0307406_10040060 | |||
| 358 | Ga0307416_100349923 | |||
| 359 | Ga0395898_0026696 | |||
| 360 | Ga0395905_0000424 | |||
| 361 | Ga0395905_0043548 | |||
| 362 | Ga0395905_0415032 | |||
| 363 | Ga0439439_0010384 | |||
| 364 | Ga0439433_0023571 | |||
| 365 | Ga0439449_0027940 | |||
| 366 | Ga0439454_009309 | |||
| 367 | Ga0439462_0004926 | |||
| 368 | Ga0451577_0000010 | |||
| 369 | Ga0451577_0026299 | |||
| 370 | Ga0451577_0283391 | |||
| 371 | Ga0466969_0000235 | |||
| 372 | Ga0466972_0001764 | |||
| 373 | Ga0453683_0000637 | |||
| 374 | Ga0453683_0007268 | |||
| 375 | Ga0466965_0024163 | |||
| 376 | Ga0466961_0172687 | |||
| 377 | Ga0466964_0037825 | |||
| 378 | Ga0453684_0000130 | |||
| 379 | Ga0453684_0000262 | |||
| 380 | Ga0453684_0000616 | |||
| 381 | Ga0453684_0028094 | |||
| 382 | Ga0453684_0095732 | |||
| 383 | Ga0466971_0020395 | |||
| 384 | Ga0466968_0003029 | |||
| 385 | Ga0466957_0001155 | |||
| 386 | Ga0466959_0000015 | |||
| 387 | Ga0466959_0000681 | |||
| 388 | Ga0466959_0049161 | |||
| 389 | Ga0466959_0211030 | |||
| 390 | Ga0451576_0000957 | |||
| 391 | Ga0466967_0485843 | |||
| 392 | Ga0495633_0000017 | |||
| 393 | Ga0495611_0000021 | |||
| 394 | Ga0495625_0068306 | |||
| 395 | Ga0495670_0115978 | |||
| 396 | Ga0495687_000001 | |||
| 397 | Ga0496121_0000010 | |||
| 398 | Ga0496126_0015072 | |||
| 399 | Ga0501291_002120 | |||
| 400 | Ga0501298_000345 | |||
| 401 | Ga0501031_0047626 | |||
| 402 | Ga0501032_0020731 | |||
| 403 | Ga0501034_0016080 | |||
| 404 | Ga0501036_0008269 | |||
| 405 | Ga0501037_0103095 | |||
| 406 | Ga0501038_0016085 | |||
| 407 | Ga0501039_0410541 | |||
| 408 | Ga0501043_0064538 | |||
| 409 | Ga0501046_0010747 | |||
| 410 | Ga0501048_0003516 | |||
| 411 | Ga0501068_0186301 | |||
| 412 | Ga0501070_0018849 | |||
| 413 | Ga0501073_0000756 | |||
| 414 | Ga0501074_0005849 | |||
| 415 | Ga0501198_000744 | |||
| 416 | Ga0501202_000519 | |||
| 417 | Ga0501202_002573 | |||
| 418 | Ga0501222_001289 | |||
| 419 | Ga0501223_002673 | |||
| 420 | Ga0501233_001399 | |||
| 421 | Ga0501233_002062 | |||
| 422 | Ga0501235_003870 | |||
| 423 | Ga0501242_003190 | |||
| 424 | Ga0501257_005233 | |||
| 425 | Ga0501259_000050 | |||
| 426 | Ga0501221_002656 | |||
| 427 | Ga0501234_003537 | |||
| 428 | Ga0501234_008620 | |||
| 429 | Ga0501245_000570 | |||
| 430 | Ga0501079_0083070 | |||
| 431 | Ga0501080_0175886 | |||
| 432 | Ga0501083_0035281 | |||
| 433 | Ga0501083_0081535 | |||
| 434 | Ga0501268_005171 | |||
| 435 | Ga0501035_0067681 | |||
| 436 | Ga0501212_000453 | |||
| 437 | Ga0500644_0000488 | |||
| 438 | Ga0500646_0011615 | |||
| 439 | Ga0500583_0000224 | |||
| 440 | Ga0500583_0061171 | |||
| 441 | Ga0500569_000124 | |||
| 442 | Ga0500577_0001651 | |||
| 443 | Ga0500616_0014414 | |||
| 444 | Ga0500622_0000059 | |||
| 445 | Ga0500633_0078800 | |||
| 446 | Ga0500611_000005 | |||
| 447 | Ga0500661_014314 | |||
| 448 | Ga0501082_0432675 | |||
| 449 | Ga0466962_0037917 | |||
| 450 | 2884795761 | |||
| 451 | 2819572063 | |||
| 452 | 2821141692 | |||
| 453 | 2883070874 | |||
| 454 | 2896114012 | |||
| 455 | 2904469893 | |||
| 456 | 2929178675 | |||
| 457 | 2945981086 | |||
| 458 | 2946019513 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fhj-assembly2.cif.gz_C | independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations | 0.9228 | 6 | 330 |
| 6dfu-assembly1.cif.gz_A | tryptophan--trna ligase from haemophilus influenzae. | 0.9135 | 5 | 330 |
| 3fhj-assembly3.cif.gz_E | independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations | 0.9134 | 6 | 330 |
| 3fhj-assembly3.cif.gz_F | independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations | 0.9105 | 6 | 330 |
| 3m5w-assembly1.cif.gz_A | crystal structure of tryptophanyl-trna synthetase from campylobacter jejuni | 0.9105 | 6 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m5wA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9178 | 6 | 180 | 3.40.50.620 |
| 2g36A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8949 | 6 | 180 | 3.40.50.620 |
| 3prhB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8937 | 5 | 332 | 3.40.50.620 |
| af_Q86A90_13_226_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8933 | 5 | 181 | 3.40.50.620 |
| 2yy5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8855 | 5 | 180 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M5FNW5-F1-model_v4 | Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) | 0.9526 | 5 | 333 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A520C4N7-F1-model_v4 | Tryptophan--tRNA ligase | 0.952 | 173 | 334 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A258KSE9-F1-model_v4 | Tryptophan--tRNA ligase | 0.9427 | 147 | 334 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-X1JDE2-F1-model_v4 | tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9409 | 3 | 111 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |
| AF-A0A420YT38-F1-model_v4 | tryptophan--tRNA ligase (EC 6.1.1.2) | 0.9374 | 3 | 107 |
GO:0004830
GO:0005524 GO:0005829 GO:0006436 |