F342201

General Info

Members Datasets Scaffolds Average Seq Length
229 171 225 264

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0027483|Ga0373933_0027483_914_1819
Length 292
Sequence VADRRNLSRSRRKLGRSEAGDLERWFAACSGYHPRSPVIDIGANLTSKSFQRDLPAVLERAAAAGVHTLVVTGTSLAGSHAAAALAAQGAPAALYATAGVHPHHAVEATGAWTSELRALAADPRVVAIGECGLDFNRDYSPRPDQIRCFHAQLELAAELGRPVFLHERDAHDTFAGILREHRASLPGAVIHCFTGTRAELDVYLSLDLHIGITGWICDERRGRELVAVVPAIPAGRLMIETDEPYLLPRNMPSPPRDRRNEPAFLPYVLDAVAAARGEPPAARAFFRLPAGE

Samples

Sample ID Description Type Environment
1 2739367700 Dyella sp. YR388 Isolate Unclassified
2 2847085930 Erwinia persicina B64 Isolate Bulb
3 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
4 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 2.62
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.44
Endosphere 0.87
Nodule 0
Rhizoplane 1.31
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000443 3300001915 Bacteria 12540
2 JGI24741J21665_1003641 3300001915 Bacteria 3610
3 JGI24741J21665_1006076 3300001915 Bacteria 2462
4 JGI24740J21852_10001066 3300001979 Bacteria 12354
5 JGI25162J39368_1001347 3300002737 Bacteria 13620
6 rootH1_10001245 3300003323 Unclassified 2994
7 Ga0058692_1008171 3300003856 Bacteria 2710
8 Ga0065715_10249492 3300005293 Bacteria 1172
9 Ga0070658_10148079 3300005327 Bacteria 1964
10 Ga0070658_10158725 3300005327 Bacteria 1896
11 Ga0070676_10170071 3300005328 Bacteria 1409
12 Ga0070680_100001338 3300005336 Bacteria 17851
13 Ga0070680_100008110 3300005336 Bacteria 8020
14 Ga0070682_100004117 3300005337 Bacteria 8064
15 Ga0070689_100388343 3300005340 Bacteria 1178
16 Ga0070691_10002683 3300005341 Bacteria 7925
17 Ga0070691_10043290 3300005341 Bacteria 2133
18 Ga0070691_10062020 3300005341 Unclassified 1800
19 Ga0070661_100001687 3300005344 Bacteria 15290
20 Ga0070692_10000300 3300005345 Bacteria 14057
21 Ga0070659_100109105 3300005366 Bacteria 2233
22 Ga0070714_100051371 3300005435 Bacteria 3514
23 Ga0070713_100728502 3300005436 Bacteria 948
24 Ga0070710_10071478 3300005437 Bacteria 2001
25 Ga0070694_100011114 3300005444 Bacteria 5573
26 Ga0070663_100003728 3300005455 Bacteria 8836
27 Ga0070663_100046328 3300005455 Bacteria 3076
28 Ga0070662_100006712 3300005457 Bacteria 7437
29 Ga0070681_10000758 3300005458 Bacteria 26818
30 Ga0070681_10057509 3300005458 Bacteria 3869
31 Ga0070679_100003594 3300005530 Bacteria 14173
32 Ga0070679_100008915 3300005530 Bacteria 9464
33 Ga0070684_100062868 3300005535 Bacteria 3253
34 Ga0070684_100082883 3300005535 Bacteria 2841
35 Ga0068853_100176517 3300005539 Bacteria 1935
36 Ga0070672_100320893 3300005543 Bacteria 1317
37 Ga0070696_100000604 3300005546 Bacteria 23023
38 Ga0068855_100003083 3300005563 Bacteria 20391
39 Ga0068855_100048852 3300005563 Bacteria 4992
40 Ga0068855_100163424 3300005563 Bacteria 2525
41 Ga0068854_100001300 3300005578 Bacteria 15043
42 Ga0068854_100041836 3300005578 Bacteria 3239
43 Ga0068856_100002840 3300005614 Bacteria 17730
44 Ga0068856_100029962 3300005614 Bacteria 5318
45 Ga0068856_100316355 3300005614 Bacteria 1578
46 Ga0068852_100003846 3300005616 Bacteria 10544
47 Ga0068852_100379581 3300005616 Bacteria 1386
48 Ga0068861_100538866 3300005719 Bacteria 1062
49 Ga0068863_100091505 3300005841 Bacteria 2885
50 Ga0081455_10002126 3300005937 Bacteria 23617
51 Ga0075428_100015601 3300006844 Bacteria 8422
52 Ga0075433_10100005 3300006852 Bacteria 2567
53 Ga0075429_100013563 3300006880 Bacteria 7068
54 Ga0068865_100023250 3300006881 Bacteria 4057
55 Ga0105240_10206544 3300009093 Bacteria 2298
56 Ga0111539_10001714 3300009094 Bacteria 29167
57 Ga0111539_10004299 3300009094 Bacteria 18631
58 Ga0111539_10016651 3300009094 Bacteria 9112
59 Ga0105245_10430734 3300009098 Bacteria 1324
60 Ga0105241_10125204 3300009174 Bacteria 2074
61 Ga0105237_10134582 3300009545 Bacteria 2466
62 Ga0105238_10270370 3300009551 Bacteria 1680
63 Ga0157373_10008790 3300013100 Bacteria 7482
64 Ga0157371_10116301 3300013102 Bacteria 1900
65 Ga0157370_10463805 3300013104 Bacteria 1164
66 Ga0157369_10009753 3300013105 Bacteria 10983
67 Ga0157369_10355533 3300013105 Bacteria 1521
68 Ga0157372_10003060 3300013307 Bacteria 18021
69 Ga0157372_10005166 3300013307 Bacteria 13881
70 Ga0157372_10019649 3300013307 Bacteria 7282
71 Ga0157372_10353254 3300013307 Bacteria 1713
72 Ga0157375_10162151 3300013308 Bacteria 2378
73 Ga0157380_10005781 3300014326 Bacteria 8656
74 Ga0157380_10040328 3300014326 Bacteria 3636
75 Ga0182008_10029089 3300014497 Bacteria 2792
76 Ga0157376_10250344 3300014969 Bacteria 1654
77 Ga0206356_10090416 3300020070 Bacteria 7772
78 Ga0206354_10033410 3300020081 Bacteria 2246
79 Ga0206354_10598552 3300020081 Bacteria 4095
80 Ga0206353_10275513 3300020082 Bacteria 12277
81 Ga0206353_11536262 3300020082 Bacteria 10063
82 Ga0154015_1270747 3300020610 Bacteria 1828
83 Ga0213876_10118509 3300021384 Bacteria 1405
84 Ga0209026_1003646 3300025250 Bacteria 4941
85 Ga0207647_10000380 3300025904 Bacteria 36130
86 Ga0207705_10000147 3300025909 Bacteria 75079
87 Ga0207705_10000235 3300025909 Bacteria 54903
88 Ga0207705_10000441 3300025909 Bacteria 35880
89 Ga0207705_10114071 3300025909 Bacteria 1999
90 Ga0207707_10000540 3300025912 Bacteria 38631
91 Ga0207707_10000690 3300025912 Bacteria 33565
92 Ga0207695_10001446 3300025913 Bacteria 39733
93 Ga0207695_10002564 3300025913 Bacteria 26706
94 Ga0207671_10045188 3300025914 Bacteria 3256
95 Ga0207660_10000771 3300025917 Bacteria 21311
96 Ga0207660_10010625 3300025917 Bacteria 5981
97 Ga0207660_10054503 3300025917 Bacteria 2854
98 Ga0207657_10003533 3300025919 Bacteria 16697
99 Ga0207649_10000529 3300025920 Bacteria 26586
100 Ga0207649_10087730 3300025920 Bacteria 2030
101 Ga0207652_10000107 3300025921 Bacteria 90283
102 Ga0207652_10000269 3300025921 Bacteria 54064
103 Ga0207652_10001907 3300025921 Bacteria 18071
104 Ga0207694_10001857 3300025924 Bacteria 17576
105 Ga0207700_10646032 3300025928 Bacteria 943
106 Ga0207664_10068399 3300025929 Bacteria 2853
107 Ga0207644_10232704 3300025931 Bacteria 1465
108 Ga0207690_10000353 3300025932 Bacteria 30578
109 Ga0207690_10000885 3300025932 Bacteria 19138
110 Ga0207706_10004684 3300025933 Bacteria 12824
111 Ga0207670_10326184 3300025936 Bacteria 1209
112 Ga0207661_10001035 3300025944 Bacteria 18463
113 Ga0207679_10003918 3300025945 Bacteria 9238
114 Ga0207667_10000711 3300025949 Bacteria 43138
115 Ga0207667_10000747 3300025949 Bacteria 42240
116 Ga0207667_10008846 3300025949 Bacteria 11918
117 Ga0207640_10001133 3300025981 Bacteria 14648
118 Ga0207640_10002111 3300025981 Bacteria 10678
119 Ga0207639_10000902 3300026041 Bacteria 20102
120 Ga0207639_10349518 3300026041 Bacteria 1320
121 Ga0207678_10001804 3300026067 Bacteria 19601
122 Ga0207678_10002152 3300026067 Bacteria 17827
123 Ga0207678_10014719 3300026067 Bacteria 6882
124 Ga0207702_10279626 3300026078 Bacteria 1577
125 Ga0207648_10176097 3300026089 Bacteria 1892
126 Ga0207674_10030251 3300026116 Bacteria 5695
127 Ga0207675_100317811 3300026118 Bacteria 1520
128 Ga0207698_10000363 3300026142 Bacteria 26617
129 Ga0207698_10000390 3300026142 Bacteria 25365
130 Ga0209371_1000429 3300027312 Bacteria 42773
131 Ga0207428_10019805 3300027907 Bacteria 5731
132 Ga0207428_10032977 3300027907 Bacteria 4257
133 Ga0268266_10406129 3300028379 Bacteria 1289
134 Ga0265338_10014885 3300028800 Bacteria 8603
135 Ga0268256_1002004 3300030500 Bacteria 11035
136 Ga0265320_10006860 3300031240 Bacteria 7131
137 Ga0265342_10000038 3300031712 Bacteria 140732
138 Ga0316576_10008216 3300031727 Bacteria 6636
139 Ga0316576_10083433 3300031727 Bacteria 2374
140 Ga0316578_10138668 3300031728 Bacteria 1465
141 Ga0307413_10345483 3300031824 Bacteria 1146
142 Ga0307412_10040944 3300031911 Bacteria 3000
143 Ga0307409_100631105 3300031995 Bacteria 1063
144 Ga0307416_100158842 3300032002 Bacteria 2086
145 Ga0373952_0024966 3300035092 Bacteria 1287
146 Ga0373960_0078263 3300035121 Bacteria 1036
147 Ga0373943_0123597 3300035170 Bacteria 1378
148 Ga0373955_0036456 3300035172 Bacteria 2609
149 Ga0316574_0168110 3300035398 Bacteria 1412
150 Ga0373931_0088923 3300035691 Bacteria 1718
151 Ga0373933_0018110 3300035724 Bacteria 3957
152 Ga0373933_0027483 3300035724 Bacteria 3277
153 Ga0373933_0286838 3300035724 Bacteria 1064
154 Ga0373937_0012453 3300036401 Bacteria 7484
155 Ga0373937_0305548 3300036401 Bacteria 1504
156 Ga0316584_0021776 3300036712 Bacteria 4664
157 Ga0395899_0021766 3300037312 Bacteria 4862
158 Ga0395899_0076345 3300037312 Bacteria 2446
159 Ga0395900_0134515 3300037418 Bacteria 2532
160 Ga0395898_0032982 3300037466 Bacteria 5169
161 Ga0436365_1397382 3300039437 Bacteria 5261
162 Ga0439438_002042 3300041405 Bacteria 8796
163 Ga0439447_003374 3300041407 Bacteria 5681
164 Ga0453684_0615229 3300044712 Unclassified 1189
165 Ga0495591_000539 3300046458 Bacteria 29095
166 Ga0495650_0000360 3300046471 Bacteria 80145
167 Ga0495605_0008926 3300046474 Bacteria 5651
168 Ga0495662_0100332 3300046476 Unclassified 1416
169 Ga0495584_0008677 3300046491 Bacteria 5258
170 Ga0495607_0003461 3300046501 Bacteria 12090
171 Ga0495606_0000541 3300046507 Bacteria 60650
172 Ga0495618_0021243 3300046514 Bacteria 4002
173 Ga0495628_0008636 3300046516 Bacteria 8728
174 Ga0495630_0025000 3300046517 Bacteria 4415
175 Ga0495637_0013056 3300046520 Bacteria 3955
176 Ga0495644_0005092 3300046523 Bacteria 5143
177 Ga0495648_0003190 3300046524 Bacteria 14581
178 Ga0495654_0000519 3300046530 Bacteria 31360
179 Ga0495640_0035090 3300046533 Bacteria 3552
180 Ga0495586_0057512 3300046535 Unclassified 2110
181 Ga0495645_0396640 3300046543 Bacteria 880
182 Ga0495634_0133294 3300046642 Unclassified 1582
183 Ga0495658_0150860 3300046683 Unclassified 1427
184 Ga0495671_0012698 3300046692 Bacteria 4591
185 Ga0495649_0002754 3300046694 Bacteria 12236
186 Ga0495589_0018622 3300046794 Bacteria 3560
187 Ga0495660_0000134 3300046810 Bacteria 80417
188 Ga0495674_0005105 3300047319 Bacteria 12611
189 Ga0495672_0000224 3300047320 Bacteria 80413
190 Ga0495680_0037967 3300047322 Bacteria 3854
191 Ga0495680_0360023 3300047322 Bacteria 1011
192 Ga0495673_0000622 3300047469 Bacteria 34841
193 Ga0496104_0206452 3300048907 Bacteria 1876
194 Ga0496109_0817725 3300048912 Bacteria 870
195 Ga0496114_0195534 3300048917 Bacteria 1770
196 Ga0496116_0000282 3300048919 Bacteria 87438
197 Ga0496119_0000219 3300048922 Bacteria 81203
198 Ga0496119_0000680 3300048922 Bacteria 45409
199 Ga0496119_0001950 3300048922 Bacteria 23502
200 Ga0496120_0000279 3300048923 Bacteria 85805
201 Ga0496120_0000301 3300048923 Bacteria 82406
202 Ga0496125_0253640 3300048928 Bacteria 1108
203 Ga0495682_0000139 3300049460 Bacteria 62814
204 Ga0501036_0481865 3300049572 Unclassified 1033
205 Ga0501037_0399848 3300049573 Bacteria 942
206 Ga0501038_0268606 3300049574 Bacteria 1346
207 Ga0501039_0414670 3300049575 Bacteria 1058
208 Ga0501040_0238878 3300049576 Bacteria 1295
209 Ga0501041_0037475 3300049577 Bacteria 2939
210 Ga0501041_0121030 3300049577 Bacteria 1627
211 Ga0501047_0267716 3300049581 Bacteria 1555
212 Ga0501069_0004125 3300049585 Bacteria 7501
213 Ga0501070_0000067 3300049586 Bacteria 87334
214 Ga0501070_0059024 3300049586 Bacteria 3180
215 Ga0501070_0169709 3300049586 Bacteria 1797
216 Ga0501071_0033264 3300049587 Bacteria 3663
217 Ga0501072_0130001 3300049588 Bacteria 2007
218 Ga0501073_0187896 3300049589 Bacteria 1429
219 Ga0501035_0074622 3300049822 Bacteria 3000
220 nmdc:mga09592_19013_c1 3300050508 Bacteria 5637
221 nmdc:mga08y16_30877_c1 3300050511 Bacteria 5635
222 nmdc:mga08y16_36385_c1 3300050511 Bacteria 5170
223 nmdc:mga08y16_998_c1 3300050511 Bacteria 27608
224 Ga0495601_0035679 3300053077 Bacteria 3105
225 Ga0500621_000018 3300053126 Bacteria 80374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0399848 Ga0501037_0399848_123_914 233
2 3300049581 Ga0501047_0267716 Ga0501047_0267716_85_876 233
3 3300049589 Ga0501073_0187896 Ga0501073_0187896_116_907 233
4 3300047322 Ga0495680_0037967 Ga0495680_0037967_264_1076 234
5 3300031727 Ga0316576_10083433 Ga0316576_100834334 238
6 3300031728 Ga0316578_10138668 Ga0316578_101386682 238
7 3300036712 Ga0316584_0021776 Ga0316584_0021776_401_1201 238
8 3300048912 Ga0496109_0817725 Ga0496109_0817725_29_748 238
9 3300031240 Ga0265320_10006860 Ga0265320_100068606 240
10 3300031712 Ga0265342_10000038 Ga0265342_1000003859 240
11 3300035172 Ga0373955_0036456 Ga0373955_0036456_1186_1992 243
12 3300035724 Ga0373933_0018110 Ga0373933_0018110_2593_3399 243
13 3300036401 Ga0373937_0012453 Ga0373937_0012453_3574_4380 243
14 3300048907 Ga0496104_0206452 Ga0496104_0206452_564_1358 248
15 3300005437 Ga0070710_10071478 Ga0070710_100714782 250
16 3300009094 Ga0111539_10001714 Ga0111539_1000171412 250
17 3300050511 nmdc:mga08y16_998_c1 nmdc:mga08y16_998_c1_9464_10252 250
18 3300005535 Ga0070684_100082883 Ga0070684_1000828831 251
19 3300005535 Ga0070684_100062868 Ga0070684_1000628684 252
20 3300044712 Ga0453684_0615229 Ga0453684_0615229_229_999 252
21 3300013102 Ga0157371_10116301 Ga0157371_101163011 254
22 3300013307 Ga0157372_10353254 Ga0157372_103532542 254
23 3300035724 Ga0373933_0027483 Ga0373933_0027483_914_1819 254
24 3300046514 Ga0495618_0021243 Ga0495618_0021243_380_1174 254
25 3300047319 Ga0495674_0005105 Ga0495674_0005105_8566_9360 254
26 3300053077 Ga0495601_0035679 Ga0495601_0035679_1963_2757 254
27 iso_pu_bacteria 2847085930 2847089584 255
28 iso_pu_bacteria 2908669403 2908674536 255
29 3300021384 Ga0213876_10118509 Ga0213876_101185091 259
30 3300035170 Ga0373943_0123597 Ga0373943_0123597_255_1037 259
31 3300035691 Ga0373931_0088923 Ga0373931_0088923_911_1690 259
32 3300039437 Ga0436365_1397382 Ga0436365_1397382_4002_4784 259
33 3300046543 Ga0495645_0396640 Ga0495645_0396640_33_815 259
34 3300047322 Ga0495680_0360023 Ga0495680_0360023_82_864 259
35 3300048919 Ga0496116_0000282 Ga0496116_0000282_10972_11751 259
36 3300048922 Ga0496119_0000680 Ga0496119_0000680_43046_43825 259
37 3300048923 Ga0496120_0000279 Ga0496120_0000279_74008_74787 259
38 iso_pu_bacteria 2739367700 2739733533 259
39 3300003856 Ga0058692_1008171 Ga0058692_10081714 261
40 3300005328 Ga0070676_10170071 Ga0070676_101700711 261
41 3300005340 Ga0070689_100388343 Ga0070689_1003883431 261
42 3300005435 Ga0070714_100051371 Ga0070714_1000513712 261
43 3300005436 Ga0070713_100728502 Ga0070713_1007285021 261
44 3300005543 Ga0070672_100320893 Ga0070672_1003208931 261
45 3300005719 Ga0068861_100538866 Ga0068861_1005388662 261
46 3300005841 Ga0068863_100091505 Ga0068863_1000915055 261
47 3300005937 Ga0081455_10002126 Ga0081455_1000212618 261
48 3300006881 Ga0068865_100023250 Ga0068865_1000232502 261
49 3300009098 Ga0105245_10430734 Ga0105245_104307341 261
50 3300013307 Ga0157372_10005166 Ga0157372_100051668 261
51 3300013308 Ga0157375_10162151 Ga0157375_101621515 261
52 3300014969 Ga0157376_10250344 Ga0157376_102503442 261
53 3300025928 Ga0207700_10646032 Ga0207700_106460321 261
54 3300025929 Ga0207664_10068399 Ga0207664_100683993 261
55 3300025931 Ga0207644_10232704 Ga0207644_102327042 261
56 3300025936 Ga0207670_10326184 Ga0207670_103261842 261
57 3300026089 Ga0207648_10176097 Ga0207648_101760971 261
58 3300026118 Ga0207675_100317811 Ga0207675_1003178111 261
59 3300027312 Ga0209371_1000429 Ga0209371_10004299 261
60 3300028379 Ga0268266_10406129 Ga0268266_104061291 261
61 3300030500 Ga0268256_1002004 Ga0268256_10020046 261
62 3300035092 Ga0373952_0024966 Ga0373952_0024966_299_1090 261
63 3300035121 Ga0373960_0078263 Ga0373960_0078263_166_957 261
64 3300036401 Ga0373937_0305548 Ga0373937_0305548_168_956 261
65 3300041405 Ga0439438_002042 Ga0439438_002042_5967_6755 261
66 3300041407 Ga0439447_003374 Ga0439447_003374_1627_2415 261
67 3300046458 Ga0495591_000539 Ga0495591_000539_10708_11493 261
68 3300046471 Ga0495650_0000360 Ga0495650_0000360_10585_11370 261
69 3300046474 Ga0495605_0008926 Ga0495605_0008926_898_1683 261
70 3300046476 Ga0495662_0100332 Ga0495662_0100332_322_1110 261
71 3300046491 Ga0495584_0008677 Ga0495584_0008677_4308_5093 261
72 3300046501 Ga0495607_0003461 Ga0495607_0003461_5521_6306 261
73 3300046507 Ga0495606_0000541 Ga0495606_0000541_10792_11577 261
74 3300046516 Ga0495628_0008636 Ga0495628_0008636_5455_6243 261
75 3300046517 Ga0495630_0025000 Ga0495630_0025000_2486_3274 261
76 3300046520 Ga0495637_0013056 Ga0495637_0013056_1928_2713 261
77 3300046523 Ga0495644_0005092 Ga0495644_0005092_46_831 261
78 3300046524 Ga0495648_0003190 Ga0495648_0003190_9134_9919 261
79 3300046530 Ga0495654_0000519 Ga0495654_0000519_19725_20510 261
80 3300046533 Ga0495640_0035090 Ga0495640_0035090_2356_3144 261
81 3300046535 Ga0495586_0057512 Ga0495586_0057512_811_1599 261
82 3300046642 Ga0495634_0133294 Ga0495634_0133294_267_1055 261
83 3300046683 Ga0495658_0150860 Ga0495658_0150860_450_1238 261
84 3300046692 Ga0495671_0012698 Ga0495671_0012698_166_951 261
85 3300046694 Ga0495649_0002754 Ga0495649_0002754_5278_6063 261
86 3300046794 Ga0495589_0018622 Ga0495589_0018622_989_1774 261
87 3300046810 Ga0495660_0000134 Ga0495660_0000134_10875_11660 261
88 3300047320 Ga0495672_0000224 Ga0495672_0000224_68789_69574 261
89 3300047469 Ga0495673_0000622 Ga0495673_0000622_23218_24003 261
90 3300048922 Ga0496119_0000219 Ga0496119_0000219_11009_11800 261
91 3300048923 Ga0496120_0000301 Ga0496120_0000301_11009_11800 261
92 3300048928 Ga0496125_0253640 Ga0496125_0253640_301_1089 261
93 3300049460 Ga0495682_0000139 Ga0495682_0000139_51191_51976 261
94 3300053126 Ga0500621_000018 Ga0500621_000018_10820_11605 261
95 iso_pu_bacteria 2925326138 2925334046 261
96 3300005563 Ga0068855_100003083 Ga0068855_10000308310 262
97 3300005614 Ga0068856_100002840 Ga0068856_10000284010 262
98 3300025949 Ga0207667_10008846 Ga0207667_100088467 262
99 3300026078 Ga0207702_10279626 Ga0207702_102796262 262
100 3300048922 Ga0496119_0001950 Ga0496119_0001950_3964_4758 262
101 3300001915 JGI24741J21665_1000443 JGI24741J21665_10004435 263
102 3300001915 JGI24741J21665_1003641 JGI24741J21665_10036414 263
103 3300001915 JGI24741J21665_1006076 JGI24741J21665_10060762 263
104 3300001979 JGI24740J21852_10001066 JGI24740J21852_100010662 263
105 3300002737 JGI25162J39368_1001347 JGI25162J39368_100134711 263
106 3300003323 rootH1_10001245 rootH1_100012454 263
107 3300005293 Ga0065715_10249492 Ga0065715_102494922 263
108 3300005327 Ga0070658_10148079 Ga0070658_101480792 263
109 3300005327 Ga0070658_10158725 Ga0070658_101587252 263
110 3300005336 Ga0070680_100001338 Ga0070680_10000133810 263
111 3300005336 Ga0070680_100008110 Ga0070680_1000081105 263
112 3300005337 Ga0070682_100004117 Ga0070682_1000041176 263
113 3300005341 Ga0070691_10002683 Ga0070691_100026837 263
114 3300005341 Ga0070691_10043290 Ga0070691_100432903 263
115 3300005341 Ga0070691_10062020 Ga0070691_100620202 263
116 3300005344 Ga0070661_100001687 Ga0070661_1000016877 263
117 3300005345 Ga0070692_10000300 Ga0070692_100003004 263
118 3300005366 Ga0070659_100109105 Ga0070659_1001091053 263
119 3300005444 Ga0070694_100011114 Ga0070694_1000111144 263
120 3300005455 Ga0070663_100003728 Ga0070663_1000037284 263
121 3300005455 Ga0070663_100046328 Ga0070663_1000463282 263
122 3300005457 Ga0070662_100006712 Ga0070662_1000067124 263
123 3300005458 Ga0070681_10000758 Ga0070681_1000075810 263
124 3300005458 Ga0070681_10057509 Ga0070681_100575094 263
125 3300005530 Ga0070679_100003594 Ga0070679_1000035943 263
126 3300005530 Ga0070679_100008915 Ga0070679_1000089157 263
127 3300005539 Ga0068853_100176517 Ga0068853_1001765172 263
128 3300005546 Ga0070696_100000604 Ga0070696_1000006047 263
129 3300005563 Ga0068855_100048852 Ga0068855_1000488524 263
130 3300005563 Ga0068855_100163424 Ga0068855_1001634242 263
131 3300005578 Ga0068854_100001300 Ga0068854_1000013009 263
132 3300005578 Ga0068854_100041836 Ga0068854_1000418362 263
133 3300005614 Ga0068856_100029962 Ga0068856_1000299625 263
134 3300005614 Ga0068856_100316355 Ga0068856_1003163551 263
135 3300005616 Ga0068852_100003846 Ga0068852_1000038463 263
136 3300005616 Ga0068852_100379581 Ga0068852_1003795812 263
137 3300006844 Ga0075428_100015601 Ga0075428_10001560110 263
138 3300006852 Ga0075433_10100005 Ga0075433_101000053 263
139 3300006880 Ga0075429_100013563 Ga0075429_1000135635 263
140 3300009093 Ga0105240_10206544 Ga0105240_102065442 263
141 3300009094 Ga0111539_10004299 Ga0111539_100042995 263
142 3300009094 Ga0111539_10016651 Ga0111539_100166514 263
143 3300009174 Ga0105241_10125204 Ga0105241_101252042 263
144 3300009545 Ga0105237_10134582 Ga0105237_101345823 263
145 3300009551 Ga0105238_10270370 Ga0105238_102703702 263
146 3300013100 Ga0157373_10008790 Ga0157373_100087904 263
147 3300013104 Ga0157370_10463805 Ga0157370_104638052 263
148 3300013105 Ga0157369_10009753 Ga0157369_100097537 263
149 3300013105 Ga0157369_10355533 Ga0157369_103555332 263
150 3300013307 Ga0157372_10003060 Ga0157372_100030607 263
151 3300013307 Ga0157372_10019649 Ga0157372_100196492 263
152 3300014326 Ga0157380_10005781 Ga0157380_100057814 263
153 3300014326 Ga0157380_10040328 Ga0157380_100403282 263
154 3300014497 Ga0182008_10029089 Ga0182008_100290892 263
155 3300020070 Ga0206356_10090416 Ga0206356_100904162 263
156 3300020081 Ga0206354_10033410 Ga0206354_100334101 263
157 3300020081 Ga0206354_10598552 Ga0206354_105985522 263
158 3300020082 Ga0206353_10275513 Ga0206353_102755132 263
159 3300020082 Ga0206353_11536262 Ga0206353_115362622 263
160 3300020610 Ga0154015_1270747 Ga0154015_12707472 263
161 3300025250 Ga0209026_1003646 Ga0209026_10036463 263
162 3300025904 Ga0207647_10000380 Ga0207647_1000038016 263
163 3300025909 Ga0207705_10000147 Ga0207705_1000014745 263
164 3300025909 Ga0207705_10000235 Ga0207705_1000023526 263
165 3300025909 Ga0207705_10000441 Ga0207705_1000044116 263
166 3300025909 Ga0207705_10114071 Ga0207705_101140712 263
167 3300025912 Ga0207707_10000540 Ga0207707_1000054014 263
168 3300025912 Ga0207707_10000690 Ga0207707_1000069020 263
169 3300025913 Ga0207695_10001446 Ga0207695_1000144624 263
170 3300025913 Ga0207695_10002564 Ga0207695_100025649 263
171 3300025914 Ga0207671_10045188 Ga0207671_100451883 263
172 3300025917 Ga0207660_10000771 Ga0207660_1000077110 263
173 3300025917 Ga0207660_10010625 Ga0207660_100106255 263
174 3300025917 Ga0207660_10054503 Ga0207660_100545032 263
175 3300025919 Ga0207657_10003533 Ga0207657_1000353310 263
176 3300025920 Ga0207649_10000529 Ga0207649_1000052916 263
177 3300025920 Ga0207649_10087730 Ga0207649_100877303 263
178 3300025921 Ga0207652_10000107 Ga0207652_1000010714 263
179 3300025921 Ga0207652_10000269 Ga0207652_1000026928 263
180 3300025921 Ga0207652_10001907 Ga0207652_1000190714 263
181 3300025924 Ga0207694_10001857 Ga0207694_1000185711 263
182 3300025932 Ga0207690_10000353 Ga0207690_100003539 263
183 3300025932 Ga0207690_10000885 Ga0207690_100008854 263
184 3300025933 Ga0207706_10004684 Ga0207706_100046841 263
185 3300025944 Ga0207661_10001035 Ga0207661_100010351 263
186 3300025945 Ga0207679_10003918 Ga0207679_100039188 263
187 3300025949 Ga0207667_10000711 Ga0207667_1000071122 263
188 3300025949 Ga0207667_10000747 Ga0207667_1000074725 263
189 3300025981 Ga0207640_10001133 Ga0207640_100011332 263
190 3300025981 Ga0207640_10002111 Ga0207640_100021113 263
191 3300026041 Ga0207639_10000902 Ga0207639_1000090210 263
192 3300026041 Ga0207639_10349518 Ga0207639_103495181 263
193 3300026067 Ga0207678_10001804 Ga0207678_1000180416 263
194 3300026067 Ga0207678_10002152 Ga0207678_1000215210 263
195 3300026067 Ga0207678_10014719 Ga0207678_100147195 263
196 3300026116 Ga0207674_10030251 Ga0207674_100302514 263
197 3300026142 Ga0207698_10000363 Ga0207698_1000036317 263
198 3300026142 Ga0207698_10000390 Ga0207698_1000039013 263
199 3300027907 Ga0207428_10019805 Ga0207428_100198053 263
200 3300027907 Ga0207428_10032977 Ga0207428_100329775 263
201 3300028800 Ga0265338_10014885 Ga0265338_100148855 263
202 3300031727 Ga0316576_10008216 Ga0316576_100082168 263
203 3300031824 Ga0307413_10345483 Ga0307413_103454831 263
204 3300031911 Ga0307412_10040944 Ga0307412_100409443 263
205 3300031995 Ga0307409_100631105 Ga0307409_1006311052 263
206 3300032002 Ga0307416_100158842 Ga0307416_1001588423 263
207 3300035398 Ga0316574_0168110 Ga0316574_0168110_458_1258 263
208 3300035724 Ga0373933_0286838 Ga0373933_0286838_171_1001 263
209 3300037312 Ga0395899_0021766 Ga0395899_0021766_2483_3274 263
210 3300037312 Ga0395899_0076345 Ga0395899_0076345_884_1675 263
211 3300037418 Ga0395900_0134515 Ga0395900_0134515_660_1451 263
212 3300037466 Ga0395898_0032982 Ga0395898_0032982_1723_2514 263
213 3300048917 Ga0496114_0195534 Ga0496114_0195534_731_1531 263
214 3300049572 Ga0501036_0481865 Ga0501036_0481865_193_999 263
215 3300049574 Ga0501038_0268606 Ga0501038_0268606_22_828 263
216 3300049575 Ga0501039_0414670 Ga0501039_0414670_149_946 263
217 3300049576 Ga0501040_0238878 Ga0501040_0238878_346_1143 263
218 3300049577 Ga0501041_0037475 Ga0501041_0037475_1976_2818 263
219 3300049577 Ga0501041_0121030 Ga0501041_0121030_599_1396 263
220 3300049585 Ga0501069_0004125 Ga0501069_0004125_2769_3581 263
221 3300049586 Ga0501070_0000067 Ga0501070_0000067_49064_49876 263
222 3300049586 Ga0501070_0059024 Ga0501070_0059024_197_988 263
223 3300049586 Ga0501070_0169709 Ga0501070_0169709_802_1593 263
224 3300049587 Ga0501071_0033264 Ga0501071_0033264_950_1747 263
225 3300049588 Ga0501072_0130001 Ga0501072_0130001_412_1209 263
226 3300049822 Ga0501035_0074622 Ga0501035_0074622_749_1567 263
227 3300050508 nmdc:mga09592_19013_c1 nmdc:mga09592_19013_c1_1760_2557 263
228 3300050511 nmdc:mga08y16_30877_c1 nmdc:mga08y16_30877_c1_898_1695 263
229 3300050511 nmdc:mga08y16_36385_c1 nmdc:mga08y16_36385_c1_2333_3127 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

39

284

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9885 1 263
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9848 1 263
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9734 3 263
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9697 3 263
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.956 3 259
ID Description Score Start End Superfamily
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9809 2 263 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9735 2 263 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9734 3 263 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9697 3 263 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9539 3 259 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A5S3YZ71-F1-model_v4 Hydrolase TatD 0.9941 164 251 GO:0016788
AF-A0A2E6M2J0-F1-model_v4 Hydrolase TatD 0.9933 3 262 GO:0016788
GO:0046872
AF-A0A1I2EL87-F1-model_v4 TatD DNase family protein 0.9932 2 262 GO:0004518
AF-A0A2N6CK95-F1-model_v4 Hydrolase TatD 0.9931 1 262 GO:0004518
GO:0046872
AF-A0A0J5Y9F8-F1-model_v4 deleted 0.9924 3 262

Feature Viewer

pLDDT pTM Quality
96.98 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map