F342129

General Info

Members Datasets Scaffolds Average Seq Length
229 156 458 139

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10196575|Ga0307515_101965753
Length 155
Sequence VTAATSGAPELMAEEQRYNPSRRKSRRRALDVLYSADLRGDISAAELLAQTLRRMGGDRPEHMEYAIALVEGVVANAARIDELLASYAEGWTLERMPPVDRNLARIAVYELIHRPDVDDPVAISEAVELAKELSTEDSPRFLNGLLDRIAQYATR

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
87 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
137 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2506783011 Frankia datiscae Dg1 Isolate Nodule
146 2643221546 Microbacterium sp. Root53 Isolate Unclassified
147 2643221576 Nocardioides sp. Root614 Isolate Unclassified
148 2643221590 Nocardioides sp. Root682 Isolate Unclassified
149 2643221604 Nocardioides sp. Root190 Isolate Unclassified
150 2643221617 Nocardioides sp. Root79 Isolate Unclassified
151 2643221620 Nocardioides sp. Root240 Isolate Unclassified
152 2738541305 Nocardioides sp. CF167 Isolate Unclassified
153 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
154 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
155 2919395869 Microbacterium resistens 2980 Isolate Unclassified
156 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 0.44
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0.44
Rhizoplane 9.61
Rhizosphere 76.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10196575 3300028794 Bacteria 1907
2 Ga0070658_10007141 3300005327 Bacteria 9018
3 Ga0070683_102058206 3300005329 Bacteria 548
4 Ga0070683_102075766 3300005329 Bacteria 546
5 Ga0070690_100580957 3300005330 Bacteria 848
6 Ga0070682_100484252 3300005337 Bacteria 955
7 Ga0070661_101100973 3300005344 Bacteria 662
8 Ga0070714_100313649 3300005435 Bacteria 1465
9 Ga0070714_101001566 3300005435 Bacteria 813
10 Ga0070713_100663551 3300005436 Bacteria 994
11 Ga0070705_100475858 3300005440 Bacteria 943
12 Ga0070678_101797004 3300005456 Bacteria 578
13 Ga0070706_101653154 3300005467 Bacteria 584
14 Ga0070684_100486911 3300005535 Bacteria 1142
15 Ga0070684_101608578 3300005535 Bacteria 613
16 Ga0068853_101253456 3300005539 Bacteria 716
17 Ga0070672_101367230 3300005543 Bacteria 633
18 Ga0068855_100321294 3300005563 Bacteria 1711
19 Ga0070664_100560055 3300005564 Bacteria 1057
20 Ga0068857_100169050 3300005577 Bacteria 1987
21 Ga0068854_100563738 3300005578 Bacteria 968
22 Ga0068852_100199225 3300005616 Bacteria 1894
23 Ga0068859_100769539 3300005617 Bacteria 1051
24 Ga0068859_100878650 3300005617 Bacteria 982
25 Ga0068859_101113330 3300005617 Bacteria 869
26 Ga0068864_100009241 3300005618 Bacteria 8128
27 Ga0068863_100051978 3300005841 Bacteria 3883
28 Ga0068863_101478012 3300005841 Bacteria 688
29 Ga0068858_100479145 3300005842 Bacteria 1201
30 Ga0068858_100766831 3300005842 Bacteria 940
31 Ga0081539_10242243 3300005985 Bacteria 807
32 Ga0075365_10422141 3300006038 Bacteria 942
33 Ga0075364_10209077 3300006051 Bacteria 1323
34 Ga0075364_10465690 3300006051 Bacteria 864
35 Ga0075428_100014256 3300006844 Bacteria 8842
36 Ga0075428_100263689 3300006844 Bacteria 1855
37 Ga0075430_100002154 3300006846 Bacteria 16297
38 Ga0075430_100219728 3300006846 Bacteria 1576
39 Ga0075430_100947996 3300006846 Bacteria 709
40 Ga0075431_100029946 3300006847 Bacteria 5605
41 Ga0075431_100151137 3300006847 Bacteria 2391
42 Ga0075431_100311807 3300006847 Bacteria 1588
43 Ga0075431_100341044 3300006847 Bacteria 1508
44 Ga0075431_100854409 3300006847 Bacteria 881
45 Ga0075433_10566923 3300006852 Bacteria 998
46 Ga0075429_100003119 3300006880 Bacteria 14081
47 Ga0068865_101902973 3300006881 Bacteria 539
48 Ga0075436_101283699 3300006914 Bacteria 554
49 Ga0097620_100769466 3300006931 Bacteria 1051
50 Ga0097620_100878633 3300006931 Bacteria 982
51 Ga0097620_101113388 3300006931 Bacteria 869
52 Ga0105250_10094432 3300009092 Bacteria 1218
53 Ga0111539_11378015 3300009094 Bacteria 818
54 Ga0105245_11737960 3300009098 Bacteria 676
55 Ga0114129_10007033 3300009147 Bacteria 16019
56 Ga0114129_10233724 3300009147 Bacteria 2475
57 Ga0114129_10584715 3300009147 Bacteria 1448
58 Ga0114129_11181204 3300009147 Bacteria 954
59 Ga0105248_10015063 3300009177 Bacteria 8515
60 Ga0105249_11459863 3300009553 Bacteria 756
61 Ga0157369_11199547 3300013105 Bacteria 775
62 Ga0157374_11367771 3300013296 Bacteria 730
63 Ga0157372_10479418 3300013307 Bacteria 1450
64 Ga0157375_10011389 3300013308 Bacteria 7851
65 Ga0157375_11359500 3300013308 Bacteria 836
66 Ga0163163_10016215 3300014325 Bacteria 6917
67 Ga0163163_10270854 3300014325 Bacteria 1749
68 Ga0182008_10430166 3300014497 Bacteria 714
69 Ga0157377_10656013 3300014745 Bacteria 756
70 Ga0157379_10031239 3300014968 Bacteria 4744
71 Ga0157376_13121875 3300014969 Bacteria 502
72 Ga0207699_10715063 3300025906 Bacteria 734
73 Ga0207705_10168862 3300025909 Bacteria 1646
74 Ga0207659_10521447 3300025926 Bacteria 1008
75 Ga0207700_10531803 3300025928 Bacteria 1042
76 Ga0207664_10325519 3300025929 Bacteria 1357
77 Ga0207664_11525937 3300025929 Bacteria 590
78 Ga0207670_11112414 3300025936 Bacteria 667
79 Ga0207711_10017153 3300025941 Bacteria 6015
80 Ga0207689_10124775 3300025942 Bacteria 2118
81 Ga0207679_10167216 3300025945 Bacteria 1807
82 Ga0207679_10374065 3300025945 Bacteria 1247
83 Ga0207679_10456006 3300025945 Bacteria 1135
84 Ga0207712_11080203 3300025961 Bacteria 714
85 Ga0207640_11090702 3300025981 Bacteria 706
86 Ga0207677_11511396 3300026023 Bacteria 620
87 Ga0207703_10318241 3300026035 Bacteria 1424
88 Ga0207703_10441223 3300026035 Bacteria 1214
89 Ga0207639_11010843 3300026041 Bacteria 779
90 Ga0207708_10853802 3300026075 Bacteria 786
91 Ga0207702_11363373 3300026078 Bacteria 703
92 Ga0207641_10372944 3300026088 Bacteria 1365
93 Ga0207641_10923261 3300026088 Bacteria 867
94 Ga0207676_10010839 3300026095 Bacteria 6501
95 Ga0207676_11231779 3300026095 Bacteria 742
96 Ga0207674_10040882 3300026116 Bacteria 4799
97 Ga0207698_12087452 3300026142 Bacteria 580
98 Ga0307405_10279782 3300031731 Bacteria 1255
99 Ga0307413_11717427 3300031824 Bacteria 560
100 Ga0307406_10002255 3300031901 Bacteria 10503
101 Ga0307406_10003320 3300031901 Bacteria 8773
102 Ga0307407_10541404 3300031903 Bacteria 859
103 Ga0307407_10557853 3300031903 Bacteria 848
104 Ga0307412_10256719 3300031911 Bacteria 1360
105 Ga0307412_12120101 3300031911 Bacteria 522
106 Ga0307409_100000105 3300031995 Bacteria 30290
107 Ga0307409_100793434 3300031995 Bacteria 954
108 Ga0307416_100063041 3300032002 Bacteria 3034
109 Ga0307416_101972730 3300032002 Bacteria 686
110 Ga0307414_10461546 3300032004 Bacteria 1116
111 Ga0307415_100000023 3300032126 Bacteria 64440
112 Ga0307415_100040218 3300032126 Bacteria 3096
113 Ga0373959_0069247 3300034820 Bacteria 795
114 Ga0373945_0188465 3300035116 Bacteria 852
115 Ga0373955_0053581 3300035172 Bacteria 2203
116 Ga0373947_0328299 3300035725 Bacteria 1024
117 Ga0395900_0127861 3300037418 Bacteria 2605
118 Ga0395900_0449703 3300037418 Bacteria 1245
119 Ga0395900_0564502 3300037418 Bacteria 1081
120 Ga0395900_1041332 3300037418 Bacteria 737
121 Ga0395898_0081185 3300037466 Bacteria 3127
122 Ga0395898_0596489 3300037466 Bacteria 1047
123 Ga0395898_0802978 3300037466 Bacteria 881
124 Ga0395898_0959863 3300037466 Bacteria 792
125 Ga0395901_0016556 3300038443 Bacteria 7512
126 Ga0395901_0046092 3300038443 Bacteria 4527
127 Ga0451793_0100518 3300041452 Bacteria 784
128 Ga0451797_1477298 3300041453 Bacteria 519
129 Ga0451837_0914641 3300041494 Bacteria 635
130 Ga0451837_1310963 3300041494 Bacteria 662
131 Ga0451843_1067848 3300041509 Bacteria 594
132 Ga0451853_0510098 3300041512 Bacteria 781
133 Ga0466972_0415635 3300044658 Bacteria 631
134 Ga0466972_0560333 3300044658 Bacteria 539
135 Ga0466965_0055290 3300044683 Bacteria 1975
136 Ga0466965_0123439 3300044683 Bacteria 1339
137 Ga0466965_0124449 3300044683 Bacteria 1333
138 Ga0466966_0045696 3300044684 Bacteria 2799
139 Ga0466966_0215547 3300044684 Bacteria 1160
140 Ga0466966_0278783 3300044684 Bacteria 1006
141 Ga0466966_0469386 3300044684 Bacteria 757
142 Ga0466961_0284851 3300044693 Bacteria 1011
143 Ga0466963_0159463 3300044694 Bacteria 1570
144 Ga0466963_0711861 3300044694 Bacteria 708
145 Ga0466964_0176651 3300044706 Bacteria 1010
146 Ga0466971_0343328 3300044719 Bacteria 722
147 Ga0466970_0018644 3300044765 Bacteria 3595
148 Ga0466970_0038080 3300044765 Bacteria 2550
149 Ga0466970_0046305 3300044765 Bacteria 2316
150 Ga0466970_0162418 3300044765 Bacteria 1236
151 Ga0466970_0522766 3300044765 Bacteria 684
152 Ga0466970_0647247 3300044765 Bacteria 615
153 Ga0466957_0132765 3300044842 Bacteria 1597
154 Ga0466957_0378084 3300044842 Bacteria 965
155 Ga0466957_0601404 3300044842 Bacteria 770
156 Ga0466957_1224478 3300044842 Bacteria 543
157 Ga0466960_0013219 3300044901 Bacteria 3502
158 Ga0466960_0168617 3300044901 Bacteria 1180
159 Ga0466960_0191753 3300044901 Bacteria 1112
160 Ga0466959_0178197 3300045049 Bacteria 1488
161 Ga0466959_0459063 3300045049 Bacteria 863
162 Ga0466958_0512365 3300045836 Bacteria 779
163 Ga0466967_1118437 3300045976 Bacteria 785
164 Ga0466967_1137605 3300045976 Bacteria 778
165 Ga0495662_0375187 3300046476 Bacteria 699
166 Ga0495669_0021022 3300046684 Bacteria 2829
167 Ga0495581_0210760 3300047315 Bacteria 1136
168 Ga0496100_0071691 3300048903 Bacteria 2314
169 Ga0496100_0716422 3300048903 Bacteria 781
170 Ga0496101_0111938 3300048904 Bacteria 2056
171 Ga0496101_0145942 3300048904 Bacteria 1807
172 Ga0496101_1049946 3300048904 Bacteria 640
173 Ga0496102_0045887 3300048905 Bacteria 3968
174 Ga0496103_0879455 3300048906 Bacteria 562
175 Ga0496104_0113107 3300048907 Bacteria 2603
176 Ga0496105_0007879 3300048908 Bacteria 8271
177 Ga0496105_0060313 3300048908 Bacteria 3130
178 Ga0496106_0229542 3300048909 Bacteria 1482
179 Ga0496107_0304698 3300048910 Bacteria 1186
180 Ga0496107_0583058 3300048910 Bacteria 827
181 Ga0496108_0010524 3300048911 Bacteria 7514
182 Ga0496109_0016464 3300048912 Bacteria 6463
183 Ga0496110_0020443 3300048913 Bacteria 5590
184 Ga0496111_0010139 3300048914 Bacteria 6309
185 Ga0496112_0011266 3300048915 Bacteria 8156
186 Ga0496113_0027610 3300048916 Bacteria 4071
187 Ga0496114_0001776 3300048917 Bacteria 16356
188 Ga0496126_0880292 3300048929 Bacteria 681
189 Ga0501039_1224108 3300049575 Bacteria 580
190 Ga0501042_0225631 3300049578 Bacteria 1351
191 Ga0501076_1300198 3300049592 Bacteria 598
192 nmdc:mga03683_488162_c1 3300050489 Bacteria 595
193 nmdc:mga00v17_461718_c1 3300050491 Bacteria 824
194 nmdc:mga00v17_88085_c1 3300050491 Bacteria 1946
195 nmdc:mga05p37_438484_c1 3300050507 Bacteria 1515
196 nmdc:mga05p37_7864_c1 3300050507 Bacteria 12588
197 nmdc:mga09592_15483_c1 3300050508 Bacteria 6233
198 nmdc:mga09592_60123_c1 3300050508 Bacteria 3212
199 nmdc:mga0qj67_1440_c1 3300050509 Bacteria 16662
200 nmdc:mga0qj67_203772_c1 3300050509 Bacteria 1607
201 nmdc:mga06r32_100391_c1 3300050510 Bacteria 2839
202 nmdc:mga06r32_1551768_c1 3300050510 Bacteria 602
203 nmdc:mga06r32_285179_c1 3300050510 Bacteria 1638
204 nmdc:mga0n895_1337372_c1 3300050512 Bacteria 686
205 nmdc:mga0rr50_244026_c1 3300050513 Bacteria 1489
206 Ga0500646_0000160 3300053090 Bacteria 19918
207 Ga0500641_0222752 3300053096 Bacteria 799
208 Ga0500654_168121 3300053099 Bacteria 727
209 Ga0500660_063734 3300053100 Bacteria 1761
210 Ga0500556_0001967 3300053104 Bacteria 7255
211 Ga0500593_000733 3300053117 Bacteria 12399
212 Ga0500588_0021608 3300053146 Bacteria 1740
213 Ga0500604_0223856 3300053151 Bacteria 649
214 Ga0587111_0095641 3300060346 Bacteria 732
215 Ga0466962_0111824 3300061719 Bacteria 1315
216 Ga0466962_0257112 3300061719 Bacteria 859
217 Ga0530510_0418520 3300061734 Bacteria 1011
218 2506867883 2506783011 Bacteria 5323186
219 2643752040 2643221546 Bacteria 2910897
220 2643891658 2643221576 Bacteria 5214352
221 2643960706 2643221590 Bacteria 5214697
222 2644035778 2643221604 Bacteria 5014917
223 2644102329 2643221617 Bacteria 5139111
224 2644115553 2643221620 Bacteria 5134593
225 2738868110 2738541305 Bacteria 4910150
226 2812333158 2811994874 Bacteria 5367947
227 2855386933 2855386786 Bacteria 4752232
228 2919399045 2919395869 Bacteria 3704152
229 2945971733 2945968032 Bacteria 4111363
230 Ga0307515_10196575
231 Ga0070658_10007141
232 Ga0070683_102058206
233 Ga0070683_102075766
234 Ga0070690_100580957
235 Ga0070682_100484252
236 Ga0070661_101100973
237 Ga0070714_100313649
238 Ga0070714_101001566
239 Ga0070713_100663551
240 Ga0070705_100475858
241 Ga0070678_101797004
242 Ga0070706_101653154
243 Ga0070684_100486911
244 Ga0070684_101608578
245 Ga0068853_101253456
246 Ga0070672_101367230
247 Ga0068855_100321294
248 Ga0070664_100560055
249 Ga0068857_100169050
250 Ga0068854_100563738
251 Ga0068852_100199225
252 Ga0068859_100769539
253 Ga0068859_100878650
254 Ga0068859_101113330
255 Ga0068864_100009241
256 Ga0068863_100051978
257 Ga0068863_101478012
258 Ga0068858_100479145
259 Ga0068858_100766831
260 Ga0081539_10242243
261 Ga0075365_10422141
262 Ga0075364_10209077
263 Ga0075364_10465690
264 Ga0075428_100014256
265 Ga0075428_100263689
266 Ga0075430_100002154
267 Ga0075430_100219728
268 Ga0075430_100947996
269 Ga0075431_100029946
270 Ga0075431_100151137
271 Ga0075431_100311807
272 Ga0075431_100341044
273 Ga0075431_100854409
274 Ga0075433_10566923
275 Ga0075429_100003119
276 Ga0068865_101902973
277 Ga0075436_101283699
278 Ga0097620_100769466
279 Ga0097620_100878633
280 Ga0097620_101113388
281 Ga0105250_10094432
282 Ga0111539_11378015
283 Ga0105245_11737960
284 Ga0114129_10007033
285 Ga0114129_10233724
286 Ga0114129_10584715
287 Ga0114129_11181204
288 Ga0105248_10015063
289 Ga0105249_11459863
290 Ga0157369_11199547
291 Ga0157374_11367771
292 Ga0157372_10479418
293 Ga0157375_10011389
294 Ga0157375_11359500
295 Ga0163163_10016215
296 Ga0163163_10270854
297 Ga0182008_10430166
298 Ga0157377_10656013
299 Ga0157379_10031239
300 Ga0157376_13121875
301 Ga0207699_10715063
302 Ga0207705_10168862
303 Ga0207659_10521447
304 Ga0207700_10531803
305 Ga0207664_10325519
306 Ga0207664_11525937
307 Ga0207670_11112414
308 Ga0207711_10017153
309 Ga0207689_10124775
310 Ga0207679_10167216
311 Ga0207679_10374065
312 Ga0207679_10456006
313 Ga0207712_11080203
314 Ga0207640_11090702
315 Ga0207677_11511396
316 Ga0207703_10318241
317 Ga0207703_10441223
318 Ga0207639_11010843
319 Ga0207708_10853802
320 Ga0207702_11363373
321 Ga0207641_10372944
322 Ga0207641_10923261
323 Ga0207676_10010839
324 Ga0207676_11231779
325 Ga0207674_10040882
326 Ga0207698_12087452
327 Ga0307405_10279782
328 Ga0307413_11717427
329 Ga0307406_10002255
330 Ga0307406_10003320
331 Ga0307407_10541404
332 Ga0307407_10557853
333 Ga0307412_10256719
334 Ga0307412_12120101
335 Ga0307409_100000105
336 Ga0307409_100793434
337 Ga0307416_100063041
338 Ga0307416_101972730
339 Ga0307414_10461546
340 Ga0307415_100000023
341 Ga0307415_100040218
342 Ga0373959_0069247
343 Ga0373945_0188465
344 Ga0373955_0053581
345 Ga0373947_0328299
346 Ga0395900_0127861
347 Ga0395900_0449703
348 Ga0395900_0564502
349 Ga0395900_1041332
350 Ga0395898_0081185
351 Ga0395898_0596489
352 Ga0395898_0802978
353 Ga0395898_0959863
354 Ga0395901_0016556
355 Ga0395901_0046092
356 Ga0451793_0100518
357 Ga0451797_1477298
358 Ga0451837_0914641
359 Ga0451837_1310963
360 Ga0451843_1067848
361 Ga0451853_0510098
362 Ga0466972_0415635
363 Ga0466972_0560333
364 Ga0466965_0055290
365 Ga0466965_0123439
366 Ga0466965_0124449
367 Ga0466966_0045696
368 Ga0466966_0215547
369 Ga0466966_0278783
370 Ga0466966_0469386
371 Ga0466961_0284851
372 Ga0466963_0159463
373 Ga0466963_0711861
374 Ga0466964_0176651
375 Ga0466971_0343328
376 Ga0466970_0018644
377 Ga0466970_0038080
378 Ga0466970_0046305
379 Ga0466970_0162418
380 Ga0466970_0522766
381 Ga0466970_0647247
382 Ga0466957_0132765
383 Ga0466957_0378084
384 Ga0466957_0601404
385 Ga0466957_1224478
386 Ga0466960_0013219
387 Ga0466960_0168617
388 Ga0466960_0191753
389 Ga0466959_0178197
390 Ga0466959_0459063
391 Ga0466958_0512365
392 Ga0466967_1118437
393 Ga0466967_1137605
394 Ga0495662_0375187
395 Ga0495669_0021022
396 Ga0495581_0210760
397 Ga0496100_0071691
398 Ga0496100_0716422
399 Ga0496101_0111938
400 Ga0496101_0145942
401 Ga0496101_1049946
402 Ga0496102_0045887
403 Ga0496103_0879455
404 Ga0496104_0113107
405 Ga0496105_0007879
406 Ga0496105_0060313
407 Ga0496106_0229542
408 Ga0496107_0304698
409 Ga0496107_0583058
410 Ga0496108_0010524
411 Ga0496109_0016464
412 Ga0496110_0020443
413 Ga0496111_0010139
414 Ga0496112_0011266
415 Ga0496113_0027610
416 Ga0496114_0001776
417 Ga0496126_0880292
418 Ga0501039_1224108
419 Ga0501042_0225631
420 Ga0501076_1300198
421 nmdc:mga03683_488162_c1
422 nmdc:mga00v17_461718_c1
423 nmdc:mga00v17_88085_c1
424 nmdc:mga05p37_438484_c1
425 nmdc:mga05p37_7864_c1
426 nmdc:mga09592_15483_c1
427 nmdc:mga09592_60123_c1
428 nmdc:mga0qj67_1440_c1
429 nmdc:mga0qj67_203772_c1
430 nmdc:mga06r32_100391_c1
431 nmdc:mga06r32_1551768_c1
432 nmdc:mga06r32_285179_c1
433 nmdc:mga0n895_1337372_c1
434 nmdc:mga0rr50_244026_c1
435 Ga0500646_0000160
436 Ga0500641_0222752
437 Ga0500654_168121
438 Ga0500660_063734
439 Ga0500556_0001967
440 Ga0500593_000733
441 Ga0500588_0021608
442 Ga0500604_0223856
443 Ga0587111_0095641
444 Ga0466962_0111824
445 Ga0466962_0257112
446 Ga0530510_0418520
447 2506867883
448 2643752040
449 2643891658
450 2643960706
451 2644035778
452 2644102329
453 2644115553
454 2738868110
455 2812333158
456 2855386933
457 2919399045
458 2945971733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

23

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.9423 3 127
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.8983 1 136
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.8937 3 127
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.8922 1 129
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.8921 1 136
ID Description Score Start End Superfamily
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9432 1 127 1.10.940.10
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9423 3 127 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9074 5 134 1.10.940.10
3r2cB00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8964 4 133 1.10.940.10
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8937 3 127 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A1M7RFF5-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9922 3 133 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7X0L3N3-F1-model_v4 N utilization substance protein B 0.9909 40 134 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A4R1CU13-F1-model_v4 deleted 0.9906 1 132
AF-A0A5J5L0E5-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.99 2 134 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0LUG6-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9883 1 136 GO:0003723
GO:0005829
GO:0006353
GO:0031564

Map