F342120

General Info

Members Datasets Scaffolds Average Seq Length
229 150 458 111

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10983508|Ga0207683_109835082
Length 129
Sequence MGCSRARRTSADDRRARRAGAIVNLVVNDPFKALSHPIRRGIVERLASGPATVGEATAGFGVSKPAISKHLKLLEETGVVRREVVGRTHRLSLAPDVLSEAADWMDRQRALWGRLFDVVDDYLKEEGHQ

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.11
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 8.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10983508 3300026121 Bacteria 783
2 JGI24745J21846_1042376 3300002073 Bacteria 566
3 JGI25407J50210_10002416 3300003373 Bacteria 4390
4 JGI25407J50210_10007802 3300003373 Bacteria 2689
5 Ga0070683_100062401 3300005329 Bacteria 3465
6 Ga0068869_100923124 3300005334 Bacteria 756
7 Ga0070682_100028675 3300005337 Bacteria 3349
8 Ga0070682_101376710 3300005337 Bacteria 602
9 Ga0068868_101693425 3300005338 Bacteria 596
10 Ga0070691_10914130 3300005341 Bacteria 542
11 Ga0070692_10381024 3300005345 Bacteria 885
12 Ga0070674_100714481 3300005356 Bacteria 858
13 Ga0070688_101802276 3300005365 Unclassified 502
14 Ga0070700_101187287 3300005441 Bacteria 637
15 Ga0070694_101394320 3300005444 Unclassified 591
16 Ga0070678_100006759 3300005456 Bacteria 6759
17 Ga0070662_100338831 3300005457 Bacteria 1230
18 Ga0068867_101231308 3300005459 Bacteria 689
19 Ga0070685_10000030 3300005466 Bacteria 87995
20 Ga0070684_100383614 3300005535 Bacteria 1294
21 Ga0070684_100654762 3300005535 Bacteria 978
22 Ga0070684_101696550 3300005535 Unclassified 596
23 Ga0068853_100004033 3300005539 Bacteria 11299
24 Ga0068853_100107244 3300005539 Bacteria 2477
25 Ga0068853_100801579 3300005539 Bacteria 902
26 Ga0070686_100140874 3300005544 Bacteria 1678
27 Ga0068855_100710764 3300005563 Bacteria 1075
28 Ga0070664_100521839 3300005564 Bacteria 1096
29 Ga0068854_100894635 3300005578 Bacteria 780
30 Ga0070702_100615793 3300005615 Bacteria 816
31 Ga0068852_100153532 3300005616 Bacteria 2143
32 Ga0068864_100735798 3300005618 Bacteria 966
33 Ga0068866_10081814 3300005718 Bacteria 1736
34 Ga0068866_10145026 3300005718 Bacteria 1368
35 Ga0068861_101410954 3300005719 Bacteria 680
36 Ga0068862_100373768 3300005844 Bacteria 1328
37 Ga0068862_102141991 3300005844 Bacteria 570
38 Ga0081455_10054570 3300005937 Bacteria 3404
39 Ga0081538_10000669 3300005981 Bacteria 37700
40 Ga0081538_10004585 3300005981 Bacteria 12714
41 Ga0081538_10008498 3300005981 Bacteria 8699
42 Ga0081538_10012333 3300005981 Bacteria 6855
43 Ga0081538_10051708 3300005981 Bacteria 2463
44 Ga0081538_10159695 3300005981 Bacteria 1004
45 Ga0081540_1000051 3300005983 Bacteria 126311
46 Ga0070717_10017390 3300006028 Bacteria 5595
47 Ga0075432_10437351 3300006058 Bacteria 572
48 Ga0070712_100513227 3300006175 Bacteria 1006
49 Ga0075428_100058029 3300006844 Bacteria 4237
50 Ga0075430_100001114 3300006846 Bacteria 21391
51 Ga0075430_100595888 3300006846 Bacteria 912
52 Ga0075431_100067295 3300006847 Bacteria 3697
53 Ga0075433_11742487 3300006852 Bacteria 536
54 Ga0075429_100120519 3300006880 Bacteria 2293
55 Ga0068865_100367578 3300006881 Bacteria 1170
56 Ga0105240_12748692 3300009093 Unclassified 507
57 Ga0111539_10174434 3300009094 Bacteria 2511
58 Ga0105245_10000091 3300009098 Bacteria 89925
59 Ga0105245_10853013 3300009098 Bacteria 951
60 Ga0105245_11717583 3300009098 Bacteria 680
61 Ga0105247_10683313 3300009101 Bacteria 771
62 Ga0114129_10106826 3300009147 Bacteria 3867
63 Ga0105243_10649650 3300009148 Bacteria 1022
64 Ga0105243_11104834 3300009148 Bacteria 801
65 Ga0105242_10999541 3300009176 Bacteria 844
66 Ga0105248_10000466 3300009177 Bacteria 46063
67 Ga0105237_10410056 3300009545 Bacteria 1360
68 Ga0105238_10214378 3300009551 Bacteria 1902
69 Ga0105249_10932888 3300009553 Bacteria 936
70 Ga0105249_12013881 3300009553 Bacteria 650
71 Ga0105239_10607386 3300010375 Bacteria 1248
72 Ga0105246_11443310 3300011119 Bacteria 644
73 Ga0157370_10025302 3300013104 Bacteria 5875
74 Ga0157369_10000128 3300013105 Bacteria 108576
75 Ga0157369_10548019 3300013105 Bacteria 1195
76 Ga0157374_10001707 3300013296 Bacteria 18418
77 Ga0157378_10001813 3300013297 Bacteria 19166
78 Ga0163162_10986722 3300013306 Bacteria 952
79 Ga0157372_10184628 3300013307 Bacteria 2415
80 Ga0157377_10575540 3300014745 Bacteria 799
81 Ga0157376_10271010 3300014969 Bacteria 1595
82 Ga0163161_10758982 3300017792 Bacteria 812
83 Ga0207688_10023202 3300025901 Bacteria 3396
84 Ga0207688_10181372 3300025901 Bacteria 1256
85 Ga0207645_10425513 3300025907 Bacteria 895
86 Ga0207684_10172213 3300025910 Bacteria 1866
87 Ga0207671_10286805 3300025914 Bacteria 1299
88 Ga0207693_10586855 3300025915 Bacteria 868
89 Ga0207662_10390950 3300025918 Bacteria 941
90 Ga0207652_10597473 3300025921 Bacteria 990
91 Ga0207681_10214459 3300025923 Bacteria 1486
92 Ga0207681_10243833 3300025923 Bacteria 1400
93 Ga0207694_10387857 3300025924 Bacteria 1160
94 Ga0207650_10727255 3300025925 Bacteria 839
95 Ga0207687_10000042 3300025927 Bacteria 108169
96 Ga0207687_11066583 3300025927 Bacteria 693
97 Ga0207700_10036000 3300025928 Unclassified 3571
98 Ga0207664_10052251 3300025929 Unclassified 3231
99 Ga0207690_10082918 3300025932 Bacteria 2243
100 Ga0207690_10919558 3300025932 Bacteria 726
101 Ga0207706_10077033 3300025933 Bacteria 2933
102 Ga0207686_10781664 3300025934 Bacteria 764
103 Ga0207704_10000012 3300025938 Bacteria 178319
104 Ga0207704_10217826 3300025938 Bacteria 1410
105 Ga0207704_10375987 3300025938 Bacteria 1114
106 Ga0207691_10152888 3300025940 Bacteria 2028
107 Ga0207711_10000085 3300025941 Bacteria 99467
108 Ga0207661_10118670 3300025944 Bacteria 2249
109 Ga0207661_10486325 3300025944 Bacteria 1127
110 Ga0207712_11013490 3300025961 Bacteria 737
111 Ga0207668_11154753 3300025972 Bacteria 695
112 Ga0207640_11205794 3300025981 Bacteria 673
113 Ga0207677_10193558 3300026023 Bacteria 1610
114 Ga0207639_10086032 3300026041 Bacteria 2502
115 Ga0207639_10736862 3300026041 Bacteria 916
116 Ga0207678_10085711 3300026067 Bacteria 2692
117 Ga0207708_10553828 3300026075 Bacteria 970
118 Ga0207702_10745090 3300026078 Bacteria 967
119 Ga0207702_12133469 3300026078 Bacteria 550
120 Ga0207648_11661867 3300026089 Bacteria 600
121 Ga0207676_10481042 3300026095 Bacteria 1176
122 Ga0207674_10184434 3300026116 Bacteria 2037
123 Ga0207674_10572535 3300026116 Bacteria 1091
124 Ga0207675_100013345 3300026118 Bacteria 7667
125 Ga0207675_100112409 3300026118 Bacteria 2570
126 Ga0207698_10102887 3300026142 Bacteria 2372
127 Ga0268266_11879963 3300028379 Bacteria 573
128 Ga0268264_12257104 3300028381 Bacteria 552
129 Ga0307408_100139893 3300031548 Bacteria 1899
130 Ga0307408_100186255 3300031548 Bacteria 1669
131 Ga0307408_100296352 3300031548 Bacteria 1353
132 Ga0307405_10054684 3300031731 Bacteria 2494
133 Ga0307410_10082005 3300031852 Unclassified 2268
134 Ga0307410_10153480 3300031852 Bacteria 1717
135 Ga0307410_10619946 3300031852 Bacteria 904
136 Ga0307410_11595233 3300031852 Bacteria 576
137 Ga0307406_10073519 3300031901 Unclassified 2248
138 Ga0307406_10169308 3300031901 Bacteria 1579
139 Ga0307406_10781457 3300031901 Bacteria 804
140 Ga0307406_11753820 3300031901 Bacteria 551
141 Ga0307407_10052130 3300031903 Bacteria 2348
142 Ga0307407_10317330 3300031903 Bacteria 1092
143 Ga0307412_10223091 3300031911 Bacteria 1446
144 Ga0307412_10660840 3300031911 Bacteria 893
145 Ga0307412_10666135 3300031911 Unclassified 889
146 Ga0307409_100029522 3300031995 Bacteria 3925
147 Ga0307409_100147937 3300031995 Bacteria 2034
148 Ga0307409_100408459 3300031995 Bacteria 1299
149 Ga0307409_100906935 3300031995 Bacteria 895
150 Ga0307416_100103681 3300032002 Bacteria 2484
151 Ga0307416_100173288 3300032002 Bacteria 2012
152 Ga0307416_100290796 3300032002 Bacteria 1617
153 Ga0307416_100380843 3300032002 Unclassified 1441
154 Ga0307416_100589258 3300032002 Bacteria 1190
155 Ga0307416_100893757 3300032002 Bacteria 988
156 Ga0307414_10765891 3300032004 Bacteria 878
157 Ga0307411_10093026 3300032005 Unclassified 2110
158 Ga0307411_10439099 3300032005 Bacteria 1089
159 Ga0307411_10532491 3300032005 Bacteria 999
160 Ga0307411_10709532 3300032005 Bacteria 877
161 Ga0307415_100018859 3300032126 Bacteria 4177
162 Ga0307415_100064638 3300032126 Bacteria 2547
163 Ga0307415_100533583 3300032126 Bacteria 1032
164 Ga0307415_100645446 3300032126 Unclassified 948
165 Ga0307415_100647664 3300032126 Unclassified 947
166 Ga0307415_100903203 3300032126 Bacteria 814
167 Ga0395899_0313411 3300037312 Bacteria 1059
168 Ga0395899_0676243 3300037312 Bacteria 650
169 Ga0395900_1750607 3300037418 Bacteria 532
170 Ga0395898_0041120 3300037466 Bacteria 4568
171 Ga0395898_0237564 3300037466 Bacteria 1738
172 Ga0395898_0442766 3300037466 Bacteria 1238
173 Ga0395898_0540359 3300037466 Bacteria 1107
174 Ga0395898_0811536 3300037466 Bacteria 876
175 Ga0395898_0896982 3300037466 Bacteria 825
176 Ga0395898_0996453 3300037466 Bacteria 774
177 Ga0395898_1611394 3300037466 Bacteria 573
178 Ga0395905_0142229 3300037471 Bacteria 2257
179 Ga0395905_1200898 3300037471 Bacteria 662
180 Ga0395901_0040699 3300038443 Bacteria 4814
181 Ga0395901_0086784 3300038443 Bacteria 3272
182 Ga0395901_0113379 3300038443 Bacteria 2847
183 Ga0395901_0334220 3300038443 Bacteria 1566
184 Ga0395901_0787280 3300038443 Bacteria 941
185 Ga0436365_1539587 3300039437 Unclassified 548
186 Ga0436363_1719452 3300039450 Bacteria 1921
187 Ga0451787_426113 3300041441 Unclassified 635
188 Ga0451789_1204516 3300041443 Bacteria 520
189 Ga0439454_065579 3300042011 Bacteria 636
190 Ga0439435_0274854 3300042436 Bacteria 572
191 Ga0439459_0057390 3300042438 Bacteria 871
192 Ga0466971_0070890 3300044719 Bacteria 1583
193 Ga0466971_0176824 3300044719 Bacteria 1002
194 Ga0466957_0001518 3300044842 Bacteria 12199
195 Ga0466957_0009417 3300044842 Bacteria 5578
196 Ga0466958_0097060 3300045836 Bacteria 1828
197 Ga0466958_0259838 3300045836 Bacteria 1111
198 Ga0466958_0604076 3300045836 Bacteria 714
199 Ga0495592_0118535 3300046454 Bacteria 1865
200 Ga0495629_0372841 3300046459 Bacteria 972
201 Ga0495594_0000005 3300046499 Bacteria 175437
202 Ga0495596_0354815 3300046500 Unclassified 571
203 Ga0495608_0144558 3300046511 Unclassified 1517
204 Ga0495608_0434740 3300046511 Bacteria 800
205 Ga0495587_0421156 3300046536 Bacteria 741
206 Ga0495667_0242035 3300046559 Unclassified 1149
207 Ga0495646_0593222 3300046680 Bacteria 563
208 Ga0495604_0432816 3300047317 Bacteria 862
209 Ga0495674_0638644 3300047319 Bacteria 840
210 Ga0495680_0243322 3300047322 Unclassified 1277
211 Ga0495593_0335401 3300047673 Unclassified 756
212 Ga0496100_0003219 3300048903 Bacteria 8479
213 Ga0496101_0031109 3300048904 Bacteria 3749
214 Ga0496101_0698157 3300048904 Bacteria 801
215 Ga0496102_1883062 3300048905 Bacteria 515
216 Ga0496107_0674781 3300048910 Bacteria 761
217 Ga0496108_0000110 3300048911 Bacteria 84585
218 Ga0496108_0119985 3300048911 Bacteria 2255
219 Ga0496109_0000087 3300048912 Bacteria 95196
220 Ga0496110_0654280 3300048913 Bacteria 951
221 Ga0496112_0056899 3300048915 Bacteria 3849
222 Ga0496112_1423515 3300048915 Bacteria 608
223 Ga0496113_0144817 3300048916 Bacteria 1871
224 Ga0501209_211591 3300049656 Bacteria 599
225 Ga0501223_150948 3300049663 Bacteria 504
226 nmdc:mga08y16_485195_c1 3300050511 Bacteria 1257
227 Ga0495595_0513098 3300053084 Bacteria 611
228 Ga0466962_0035682 3300061719 Bacteria 2379
229 Ga0466962_0323932 3300061719 Archaea 765
230 Ga0207683_10983508
231 JGI24745J21846_1042376
232 JGI25407J50210_10002416
233 JGI25407J50210_10007802
234 Ga0070683_100062401
235 Ga0068869_100923124
236 Ga0070682_100028675
237 Ga0070682_101376710
238 Ga0068868_101693425
239 Ga0070691_10914130
240 Ga0070692_10381024
241 Ga0070674_100714481
242 Ga0070688_101802276
243 Ga0070700_101187287
244 Ga0070694_101394320
245 Ga0070678_100006759
246 Ga0070662_100338831
247 Ga0068867_101231308
248 Ga0070685_10000030
249 Ga0070684_100383614
250 Ga0070684_100654762
251 Ga0070684_101696550
252 Ga0068853_100004033
253 Ga0068853_100107244
254 Ga0068853_100801579
255 Ga0070686_100140874
256 Ga0068855_100710764
257 Ga0070664_100521839
258 Ga0068854_100894635
259 Ga0070702_100615793
260 Ga0068852_100153532
261 Ga0068864_100735798
262 Ga0068866_10081814
263 Ga0068866_10145026
264 Ga0068861_101410954
265 Ga0068862_100373768
266 Ga0068862_102141991
267 Ga0081455_10054570
268 Ga0081538_10000669
269 Ga0081538_10004585
270 Ga0081538_10008498
271 Ga0081538_10012333
272 Ga0081538_10051708
273 Ga0081538_10159695
274 Ga0081540_1000051
275 Ga0070717_10017390
276 Ga0075432_10437351
277 Ga0070712_100513227
278 Ga0075428_100058029
279 Ga0075430_100001114
280 Ga0075430_100595888
281 Ga0075431_100067295
282 Ga0075433_11742487
283 Ga0075429_100120519
284 Ga0068865_100367578
285 Ga0105240_12748692
286 Ga0111539_10174434
287 Ga0105245_10000091
288 Ga0105245_10853013
289 Ga0105245_11717583
290 Ga0105247_10683313
291 Ga0114129_10106826
292 Ga0105243_10649650
293 Ga0105243_11104834
294 Ga0105242_10999541
295 Ga0105248_10000466
296 Ga0105237_10410056
297 Ga0105238_10214378
298 Ga0105249_10932888
299 Ga0105249_12013881
300 Ga0105239_10607386
301 Ga0105246_11443310
302 Ga0157370_10025302
303 Ga0157369_10000128
304 Ga0157369_10548019
305 Ga0157374_10001707
306 Ga0157378_10001813
307 Ga0163162_10986722
308 Ga0157372_10184628
309 Ga0157377_10575540
310 Ga0157376_10271010
311 Ga0163161_10758982
312 Ga0207688_10023202
313 Ga0207688_10181372
314 Ga0207645_10425513
315 Ga0207684_10172213
316 Ga0207671_10286805
317 Ga0207693_10586855
318 Ga0207662_10390950
319 Ga0207652_10597473
320 Ga0207681_10214459
321 Ga0207681_10243833
322 Ga0207694_10387857
323 Ga0207650_10727255
324 Ga0207687_10000042
325 Ga0207687_11066583
326 Ga0207700_10036000
327 Ga0207664_10052251
328 Ga0207690_10082918
329 Ga0207690_10919558
330 Ga0207706_10077033
331 Ga0207686_10781664
332 Ga0207704_10000012
333 Ga0207704_10217826
334 Ga0207704_10375987
335 Ga0207691_10152888
336 Ga0207711_10000085
337 Ga0207661_10118670
338 Ga0207661_10486325
339 Ga0207712_11013490
340 Ga0207668_11154753
341 Ga0207640_11205794
342 Ga0207677_10193558
343 Ga0207639_10086032
344 Ga0207639_10736862
345 Ga0207678_10085711
346 Ga0207708_10553828
347 Ga0207702_10745090
348 Ga0207702_12133469
349 Ga0207648_11661867
350 Ga0207676_10481042
351 Ga0207674_10184434
352 Ga0207674_10572535
353 Ga0207675_100013345
354 Ga0207675_100112409
355 Ga0207698_10102887
356 Ga0268266_11879963
357 Ga0268264_12257104
358 Ga0307408_100139893
359 Ga0307408_100186255
360 Ga0307408_100296352
361 Ga0307405_10054684
362 Ga0307410_10082005
363 Ga0307410_10153480
364 Ga0307410_10619946
365 Ga0307410_11595233
366 Ga0307406_10073519
367 Ga0307406_10169308
368 Ga0307406_10781457
369 Ga0307406_11753820
370 Ga0307407_10052130
371 Ga0307407_10317330
372 Ga0307412_10223091
373 Ga0307412_10660840
374 Ga0307412_10666135
375 Ga0307409_100029522
376 Ga0307409_100147937
377 Ga0307409_100408459
378 Ga0307409_100906935
379 Ga0307416_100103681
380 Ga0307416_100173288
381 Ga0307416_100290796
382 Ga0307416_100380843
383 Ga0307416_100589258
384 Ga0307416_100893757
385 Ga0307414_10765891
386 Ga0307411_10093026
387 Ga0307411_10439099
388 Ga0307411_10532491
389 Ga0307411_10709532
390 Ga0307415_100018859
391 Ga0307415_100064638
392 Ga0307415_100533583
393 Ga0307415_100645446
394 Ga0307415_100647664
395 Ga0307415_100903203
396 Ga0395899_0313411
397 Ga0395899_0676243
398 Ga0395900_1750607
399 Ga0395898_0041120
400 Ga0395898_0237564
401 Ga0395898_0442766
402 Ga0395898_0540359
403 Ga0395898_0811536
404 Ga0395898_0896982
405 Ga0395898_0996453
406 Ga0395898_1611394
407 Ga0395905_0142229
408 Ga0395905_1200898
409 Ga0395901_0040699
410 Ga0395901_0086784
411 Ga0395901_0113379
412 Ga0395901_0334220
413 Ga0395901_0787280
414 Ga0436365_1539587
415 Ga0436363_1719452
416 Ga0451787_426113
417 Ga0451789_1204516
418 Ga0439454_065579
419 Ga0439435_0274854
420 Ga0439459_0057390
421 Ga0466971_0070890
422 Ga0466971_0176824
423 Ga0466957_0001518
424 Ga0466957_0009417
425 Ga0466958_0097060
426 Ga0466958_0259838
427 Ga0466958_0604076
428 Ga0495592_0118535
429 Ga0495629_0372841
430 Ga0495594_0000005
431 Ga0495596_0354815
432 Ga0495608_0144558
433 Ga0495608_0434740
434 Ga0495587_0421156
435 Ga0495667_0242035
436 Ga0495646_0593222
437 Ga0495604_0432816
438 Ga0495674_0638644
439 Ga0495680_0243322
440 Ga0495593_0335401
441 Ga0496100_0003219
442 Ga0496101_0031109
443 Ga0496101_0698157
444 Ga0496102_1883062
445 Ga0496107_0674781
446 Ga0496108_0000110
447 Ga0496108_0119985
448 Ga0496109_0000087
449 Ga0496110_0654280
450 Ga0496112_0056899
451 Ga0496112_1423515
452 Ga0496113_0144817
453 Ga0501209_211591
454 Ga0501223_150948
455 nmdc:mga08y16_485195_c1
456 Ga0495595_0513098
457 Ga0466962_0035682
458 Ga0466962_0323932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

36

82

0.97

PF12840

HTH_20

Helix-turn-helix domain

34

83

0.97

PF12802

MarR_2

MarR family

38

91

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9286 25 97
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9264 25 103
7txo-assembly1.cif.gz_A selenomethionine labeled structure of rext 0.9024 25 94
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9018 25 106
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.8885 34 91
ID Description Score Start End Superfamily
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 25 99 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9264 25 103 1.10.10.10
af_Q8IL78_1923_2032_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9071 61 93 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9034 20 102 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8787 25 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1E4KRG1-F1-model_v4 deleted 0.9332 25 91
AF-A0A1G6YA57-F1-model_v4 Transcriptional regulator, ArsR family 0.9319 25 91 GO:0003700
AF-A0A1V5WG27-F1-model_v4 HTH-type transcriptional repressor AseR 0.9296 25 102 GO:0003700
AF-A0A812IR96-F1-model_v4 deleted 0.9267 25 94
AF-A0A1M3EJM6-F1-model_v4 Transcriptional regulator 0.9253 27 97 GO:0003700

Map