F341972

General Info

Members Datasets Scaffolds Average Seq Length
229 132 458 387

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10208369|Ga0105245_102083692
Length 402
Sequence VNLLDWLLVALVLTYALSGYWQGFVTGAAATAGLLLGGLTGVWLAPIALGDANPSVLVSLGALFIVILCATLGQAVFQYGGGRLRDTIQWQPFRAVDAVGGAVLSGVAVLLVAWALGVAIAGSGISGITPMVRESAILAKVDQTLPTGADGLLKTFNNVVGTTFFPRYLEPFAPERIVPVGPGPQRLLTDPDVVRAEPSVVKIQSVNSCGRGIEGSGFLYATDRVMTNAHVVAGVDEPSVEIDGNAVAATVVYYDPKVDVAVLAVESGETPPLTFDLQVEPTQGVAILGFPEDGPYDVQPARVRSEQRLRSPNIYGDGAVIRDVLSLRGKVRPGNSGGPVVSSAGEVVGLVFAASLTDSDTGYALTASQLSEAATLGIVGQDAVDTQDCASWARRPVSRRGS

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
50 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
51 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
66 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
69 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
70 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
71 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 2643221561 Nocardioides sp. Root151 Isolate Unclassified
121 2643221615 Nocardioides sp. Root224 Isolate Unclassified
122 2643221641 Nocardioides sp. Root122 Isolate Unclassified
123 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
124 2643221696 Nocardioides sp. Root140 Isolate Unclassified
125 2739367898 Nocardioides sp. CF479 Isolate Unclassified
126 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
127 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
128 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
129 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
130 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
131 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
132 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 0
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.73
Nodule 0.44
Rhizoplane 12.23
Rhizosphere 73.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10208369 3300009098 Bacteria 1881
2 LJQas_1002530 3300000549 Bacteria 2534
3 Ga0070658_10121646 3300005327 Bacteria 2169
4 Ga0070683_100021092 3300005329 Bacteria 5811
5 Ga0070682_100082779 3300005337 Bacteria 2081
6 Ga0068868_100184254 3300005338 Bacteria 1733
7 Ga0070674_100236853 3300005356 Bacteria 1427
8 Ga0070700_100032490 3300005441 Bacteria 3136
9 Ga0070681_10069579 3300005458 Bacteria 3486
10 Ga0070698_100043959 3300005471 Bacteria 4577
11 Ga0070679_100015457 3300005530 Bacteria 7334
12 Ga0070665_100349069 3300005548 Bacteria 1485
13 Ga0075365_10017618 3300006038 Bacteria 4375
14 Ga0075365_10034970 3300006038 Bacteria 3248
15 Ga0075365_10045601 3300006038 Bacteria 2876
16 Ga0075368_10002629 3300006042 Bacteria 5899
17 Ga0075363_100000342 3300006048 Bacteria 13938
18 Ga0075363_100008107 3300006048 Bacteria 4875
19 Ga0075363_100013336 3300006048 Bacteria 3979
20 Ga0075364_10012144 3300006051 Bacteria 5258
21 Ga0075364_10131548 3300006051 Bacteria 1679
22 Ga0075362_10010296 3300006177 Bacteria 3646
23 Ga0075367_10004544 3300006178 Bacteria 6788
24 Ga0075367_10005751 3300006178 Bacteria 6198
25 Ga0075370_10005070 3300006353 Bacteria 6492
26 Ga0105245_10021016 3300009098 Bacteria 5725
27 Ga0105243_10059928 3300009148 Bacteria 3039
28 Ga0105246_10173564 3300011119 Bacteria 1653
29 Ga0157372_10073567 3300013307 Bacteria 3852
30 Ga0157372_10460359 3300013307 Bacteria 1482
31 Ga0157375_10179712 3300013308 Bacteria 2267
32 Ga0163163_10093901 3300014325 Bacteria 3017
33 Ga0157380_10105935 3300014326 Bacteria 2352
34 Ga0207705_10023812 3300025909 Bacteria 4368
35 Ga0207657_10110459 3300025919 Bacteria 2271
36 Ga0207657_10250803 3300025919 Bacteria 1411
37 Ga0207652_10085680 3300025921 Bacteria 2761
38 Ga0207709_10053307 3300025935 Bacteria 2488
39 Ga0207670_10168624 3300025936 Bacteria 1640
40 Ga0207661_10022701 3300025944 Bacteria 4731
41 Ga0207712_10167100 3300025961 Bacteria 1716
42 Ga0207677_10053522 3300026023 Bacteria 2748
43 Ga0207708_10035734 3300026075 Bacteria 3781
44 Ga0207675_100091093 3300026118 Bacteria 2867
45 Ga0207683_10123363 3300026121 Bacteria 2327
46 Ga0307413_10019835 3300031824 Bacteria 3562
47 Ga0307410_10105694 3300031852 Bacteria 2027
48 Ga0307410_10121074 3300031852 Bacteria 1908
49 Ga0307410_10173389 3300031852 Bacteria 1627
50 Ga0307406_10074610 3300031901 Bacteria 2234
51 Ga0307407_10004960 3300031903 Bacteria 5723
52 Ga0307407_10205683 3300031903 Bacteria 1322
53 Ga0307412_10165952 3300031911 Bacteria 1646
54 Ga0307409_100002887 3300031995 Bacteria 9108
55 Ga0307409_100003456 3300031995 Bacteria 8578
56 Ga0307409_100007897 3300031995 Bacteria 6408
57 Ga0307409_100072818 3300031995 Bacteria 2738
58 Ga0307409_100169614 3300031995 Bacteria 1919
59 Ga0307409_100170366 3300031995 Bacteria 1916
60 Ga0307416_100003722 3300032002 Bacteria 9043
61 Ga0307416_100013696 3300032002 Bacteria 5522
62 Ga0307416_100059476 3300032002 Bacteria 3105
63 Ga0307414_10120920 3300032004 Bacteria 2013
64 Ga0307415_100021021 3300032126 Bacteria 4000
65 Ga0307415_100034939 3300032126 Bacteria 3278
66 Ga0307415_100181847 3300032126 Bacteria 1650
67 Ga0395898_0040263 3300037466 Bacteria 4621
68 Ga0395905_0175200 3300037471 Bacteria 2014
69 Ga0395901_0083289 3300038443 Bacteria 3343
70 Ga0395901_0114544 3300038443 Bacteria 2832
71 Ga0439442_005564 3300042002 Bacteria 2519
72 Ga0450907_009321 3300042146 Bacteria 1627
73 Ga0439434_0009936 3300042435 Bacteria 2801
74 Ga0466972_0038915 3300044658 Bacteria 2323
75 Ga0466965_0008563 3300044683 Bacteria 4734
76 Ga0466966_0021291 3300044684 Bacteria 4258
77 Ga0466966_0029432 3300044684 Bacteria 3573
78 Ga0466966_0104884 3300044684 Bacteria 1746
79 Ga0466961_0004439 3300044693 Bacteria 8785
80 Ga0466961_0064710 3300044693 Bacteria 2324
81 Ga0466963_0027647 3300044694 Bacteria 3634
82 Ga0466971_0024395 3300044719 Bacteria 2698
83 Ga0466968_0036996 3300044735 Bacteria 2046
84 Ga0466970_0020284 3300044765 Bacteria 3452
85 Ga0466970_0068369 3300044765 Bacteria 1908
86 Ga0466960_0004734 3300044901 Bacteria 5347
87 Ga0466960_0005326 3300044901 Bacteria 5088
88 Ga0466960_0021786 3300044901 Bacteria 2857
89 Ga0466960_0075495 3300044901 Bacteria 1686
90 Ga0466959_0036539 3300045049 Bacteria 3630
91 Ga0466958_0043736 3300045836 Bacteria 2698
92 Ga0466967_0072465 3300045976 Bacteria 3087
93 Ga0495603_0056314 3300046455 Bacteria 2328
94 Ga0496100_0147536 3300048903 Bacteria 1674
95 Ga0496101_0019156 3300048904 Bacteria 4667
96 Ga0496101_0117199 3300048904 Bacteria 2010
97 Ga0496102_0039261 3300048905 Bacteria 4277
98 Ga0496102_0049219 3300048905 Bacteria 3834
99 Ga0496103_0071743 3300048906 Bacteria 2168
100 Ga0496104_0023774 3300048907 Bacteria 5635
101 Ga0496105_0035894 3300048908 Bacteria 4083
102 Ga0496105_0110269 3300048908 Bacteria 2272
103 Ga0496107_0048586 3300048910 Bacteria 3057
104 Ga0496108_0114723 3300048911 Bacteria 2307
105 Ga0496109_0021188 3300048912 Bacteria 5746
106 Ga0496109_0029037 3300048912 Bacteria 4951
107 Ga0496109_0094889 3300048912 Bacteria 2761
108 Ga0496109_0117963 3300048912 Bacteria 2471
109 Ga0496110_0137162 3300048913 Bacteria 2211
110 Ga0496110_0165689 3300048913 Bacteria 2004
111 Ga0496110_0195051 3300048913 Bacteria 1839
112 Ga0496111_0073205 3300048914 Bacteria 2495
113 Ga0496111_0111550 3300048914 Bacteria 2014
114 Ga0496113_0108876 3300048916 Bacteria 2154
115 Ga0496114_0002623 3300048917 Bacteria 13721
116 Ga0496114_0039911 3300048917 Bacteria 3885
117 Ga0496114_0066214 3300048917 Bacteria 3028
118 Ga0496114_0159788 3300048917 Bacteria 1959
119 Ga0496115_0011423 3300048918 Bacteria 6656
120 Ga0496115_0022614 3300048918 Bacteria 4874
121 Ga0496115_0089609 3300048918 Bacteria 2512
122 Ga0501031_0007645 3300049568 Bacteria 7034
123 Ga0501031_0103251 3300049568 Bacteria 1860
124 Ga0501032_0050581 3300049569 Bacteria 2803
125 Ga0501033_0000584 3300049570 Bacteria 33796
126 Ga0501033_0102033 3300049570 Bacteria 2093
127 Ga0501034_0010438 3300049571 Bacteria 9674
128 Ga0501034_0018993 3300049571 Bacteria 7040
129 Ga0501034_0070540 3300049571 Bacteria 3505
130 Ga0501036_0002618 3300049572 Bacteria 14186
131 Ga0501036_0016568 3300049572 Bacteria 6155
132 Ga0501037_0084722 3300049573 Bacteria 2295
133 Ga0501038_0005427 3300049574 Bacteria 11848
134 Ga0501038_0008771 3300049574 Bacteria 9274
135 Ga0501038_0016954 3300049574 Bacteria 6590
136 Ga0501039_0013256 3300049575 Bacteria 6303
137 Ga0501039_0016774 3300049575 Bacteria 5613
138 Ga0501039_0044797 3300049575 Bacteria 3418
139 Ga0501040_0004060 3300049576 Bacteria 9516
140 Ga0501040_0074385 3300049576 Bacteria 2348
141 Ga0501042_0033875 3300049578 Bacteria 3621
142 Ga0501042_0079799 3300049578 Bacteria 2345
143 Ga0501043_0112177 3300049579 Bacteria 2141
144 Ga0501043_0134922 3300049579 Bacteria 1934
145 Ga0501046_0006437 3300049580 Bacteria 10403
146 Ga0501046_0027105 3300049580 Bacteria 4679
147 Ga0501047_0221959 3300049581 Bacteria 1746
148 Ga0501048_0010713 3300049582 Bacteria 6838
149 Ga0501048_0079585 3300049582 Bacteria 2313
150 Ga0501048_0091138 3300049582 Bacteria 2150
151 Ga0501067_0000820 3300049583 Bacteria 16779
152 Ga0501067_0012624 3300049583 Bacteria 4687
153 Ga0501067_0013348 3300049583 Bacteria 4549
154 Ga0501067_0023628 3300049583 Bacteria 3407
155 Ga0501068_0004078 3300049584 Bacteria 7927
156 Ga0501068_0010346 3300049584 Bacteria 5240
157 Ga0501068_0071953 3300049584 Bacteria 2111
158 Ga0501069_0015841 3300049585 Bacteria 4041
159 Ga0501069_0091651 3300049585 Bacteria 1719
160 Ga0501069_0222564 3300049585 Bacteria 1097
161 Ga0501070_0001754 3300049586 Bacteria 19172
162 Ga0501070_0004682 3300049586 Bacteria 11717
163 Ga0501070_0050388 3300049586 Bacteria 3457
164 Ga0501070_0265712 3300049586 Bacteria 1402
165 Ga0501071_0008265 3300049587 Bacteria 6871
166 Ga0501071_0008443 3300049587 Bacteria 6809
167 Ga0501071_0041186 3300049587 Bacteria 3308
168 Ga0501072_0013130 3300049588 Bacteria 6340
169 Ga0501072_0016474 3300049588 Bacteria 5676
170 Ga0501072_0044833 3300049588 Bacteria 3477
171 Ga0501073_0004149 3300049589 Bacteria 10866
172 Ga0501073_0035708 3300049589 Bacteria 3531
173 Ga0501073_0213585 3300049589 Bacteria 1333
174 Ga0501074_0004855 3300049590 Bacteria 9643
175 Ga0501074_0006976 3300049590 Bacteria 8161
176 Ga0501074_0028128 3300049590 Bacteria 4074
177 Ga0501074_0115059 3300049590 Bacteria 1924
178 Ga0501076_0011994 3300049592 Bacteria 6474
179 Ga0501077_0013740 3300049593 Bacteria 5076
180 Ga0501077_0022056 3300049593 Bacteria 4033
181 Ga0501079_0024113 3300049741 Bacteria 4668
182 Ga0501079_0027435 3300049741 Bacteria 4366
183 Ga0501079_0154734 3300049741 Bacteria 1787
184 Ga0501080_0007186 3300049742 Bacteria 10050
185 Ga0501080_0012216 3300049742 Bacteria 7869
186 Ga0501080_0037954 3300049742 Bacteria 4499
187 Ga0501080_0044190 3300049742 Bacteria 4148
188 Ga0501083_0012271 3300049744 Bacteria 5996
189 Ga0501083_0031755 3300049744 Bacteria 3624
190 Ga0501035_0007262 3300049822 Bacteria 10366
191 Ga0501035_0022020 3300049822 Bacteria 5855
192 Ga0501035_0136215 3300049822 Bacteria 2138
193 Ga0501035_0328548 3300049822 Bacteria 1283
194 Ga0501044_0011512 3300049823 Bacteria 9584
195 Ga0501044_0096618 3300049823 Bacteria 2975
196 Ga0501044_0214130 3300049823 Bacteria 1880
197 Ga0501045_0014700 3300049824 Bacteria 5550
198 Ga0501045_0040016 3300049824 Bacteria 3411
199 Ga0501045_0089334 3300049824 Bacteria 2276
200 nmdc:mga03n38_57429_c1 3300050490 Bacteria 1759
201 nmdc:mga00v17_72312_c1 3300050491 Bacteria 2139
202 nmdc:mga0yw44_2712_c1 3300050492 Bacteria 7648
203 nmdc:mga0yw44_33170_c1 3300050492 Bacteria 3015
204 nmdc:mga04h51_11300_c1 3300050495 Bacteria 2475
205 Ga0495619_0014986 3300053085 Bacteria 4898
206 Ga0500593_006236 3300053117 Bacteria 4759
207 Ga0500573_0013416 3300053140 Bacteria 4618
208 Ga0501084_0007955 3300054114 Bacteria 8729
209 Ga0501084_0022556 3300054114 Bacteria 5254
210 Ga0501082_0030009 3300060353 Bacteria 4685
211 Ga0501082_0059901 3300060353 Bacteria 3280
212 Ga0501082_0086780 3300060353 Bacteria 2699
213 Ga0501082_0264386 3300060353 Bacteria 1497
214 Ga0466962_0017217 3300061719 Bacteria 3482
215 Ga0466962_0034968 3300061719 Bacteria 2406
216 Ga0530510_0010160 3300061734 Bacteria 6598
217 2643824862 2643221561 Bacteria 4984412
218 2644093301 2643221615 Bacteria 5487866
219 2644232099 2643221641 Bacteria 4490190
220 2644322911 2643221657 Bacteria 5490246
221 2644532587 2643221696 Bacteria 5431823
222 2740168536 2739367898 Bacteria 4367674
223 2774395058 2773857762 Bacteria 5971770
224 2809194111 2808606439 Bacteria 5952208
225 2812348840 2811994878 Bacteria 5992952
226 2855390117 2855386786 Bacteria 4752232
227 2857484940 2857481737 Bacteria 4761446
228 2891973396 2891968417 Bacteria 5821697
229 8054614041 8054609563 Bacteria 5170090
230 Ga0105245_10208369
231 LJQas_1002530
232 Ga0070658_10121646
233 Ga0070683_100021092
234 Ga0070682_100082779
235 Ga0068868_100184254
236 Ga0070674_100236853
237 Ga0070700_100032490
238 Ga0070681_10069579
239 Ga0070698_100043959
240 Ga0070679_100015457
241 Ga0070665_100349069
242 Ga0075365_10017618
243 Ga0075365_10034970
244 Ga0075365_10045601
245 Ga0075368_10002629
246 Ga0075363_100000342
247 Ga0075363_100008107
248 Ga0075363_100013336
249 Ga0075364_10012144
250 Ga0075364_10131548
251 Ga0075362_10010296
252 Ga0075367_10004544
253 Ga0075367_10005751
254 Ga0075370_10005070
255 Ga0105245_10021016
256 Ga0105243_10059928
257 Ga0105246_10173564
258 Ga0157372_10073567
259 Ga0157372_10460359
260 Ga0157375_10179712
261 Ga0163163_10093901
262 Ga0157380_10105935
263 Ga0207705_10023812
264 Ga0207657_10110459
265 Ga0207657_10250803
266 Ga0207652_10085680
267 Ga0207709_10053307
268 Ga0207670_10168624
269 Ga0207661_10022701
270 Ga0207712_10167100
271 Ga0207677_10053522
272 Ga0207708_10035734
273 Ga0207675_100091093
274 Ga0207683_10123363
275 Ga0307413_10019835
276 Ga0307410_10105694
277 Ga0307410_10121074
278 Ga0307410_10173389
279 Ga0307406_10074610
280 Ga0307407_10004960
281 Ga0307407_10205683
282 Ga0307412_10165952
283 Ga0307409_100002887
284 Ga0307409_100003456
285 Ga0307409_100007897
286 Ga0307409_100072818
287 Ga0307409_100169614
288 Ga0307409_100170366
289 Ga0307416_100003722
290 Ga0307416_100013696
291 Ga0307416_100059476
292 Ga0307414_10120920
293 Ga0307415_100021021
294 Ga0307415_100034939
295 Ga0307415_100181847
296 Ga0395898_0040263
297 Ga0395905_0175200
298 Ga0395901_0083289
299 Ga0395901_0114544
300 Ga0439442_005564
301 Ga0450907_009321
302 Ga0439434_0009936
303 Ga0466972_0038915
304 Ga0466965_0008563
305 Ga0466966_0021291
306 Ga0466966_0029432
307 Ga0466966_0104884
308 Ga0466961_0004439
309 Ga0466961_0064710
310 Ga0466963_0027647
311 Ga0466971_0024395
312 Ga0466968_0036996
313 Ga0466970_0020284
314 Ga0466970_0068369
315 Ga0466960_0004734
316 Ga0466960_0005326
317 Ga0466960_0021786
318 Ga0466960_0075495
319 Ga0466959_0036539
320 Ga0466958_0043736
321 Ga0466967_0072465
322 Ga0495603_0056314
323 Ga0496100_0147536
324 Ga0496101_0019156
325 Ga0496101_0117199
326 Ga0496102_0039261
327 Ga0496102_0049219
328 Ga0496103_0071743
329 Ga0496104_0023774
330 Ga0496105_0035894
331 Ga0496105_0110269
332 Ga0496107_0048586
333 Ga0496108_0114723
334 Ga0496109_0021188
335 Ga0496109_0029037
336 Ga0496109_0094889
337 Ga0496109_0117963
338 Ga0496110_0137162
339 Ga0496110_0165689
340 Ga0496110_0195051
341 Ga0496111_0073205
342 Ga0496111_0111550
343 Ga0496113_0108876
344 Ga0496114_0002623
345 Ga0496114_0039911
346 Ga0496114_0066214
347 Ga0496114_0159788
348 Ga0496115_0011423
349 Ga0496115_0022614
350 Ga0496115_0089609
351 Ga0501031_0007645
352 Ga0501031_0103251
353 Ga0501032_0050581
354 Ga0501033_0000584
355 Ga0501033_0102033
356 Ga0501034_0010438
357 Ga0501034_0018993
358 Ga0501034_0070540
359 Ga0501036_0002618
360 Ga0501036_0016568
361 Ga0501037_0084722
362 Ga0501038_0005427
363 Ga0501038_0008771
364 Ga0501038_0016954
365 Ga0501039_0013256
366 Ga0501039_0016774
367 Ga0501039_0044797
368 Ga0501040_0004060
369 Ga0501040_0074385
370 Ga0501042_0033875
371 Ga0501042_0079799
372 Ga0501043_0112177
373 Ga0501043_0134922
374 Ga0501046_0006437
375 Ga0501046_0027105
376 Ga0501047_0221959
377 Ga0501048_0010713
378 Ga0501048_0079585
379 Ga0501048_0091138
380 Ga0501067_0000820
381 Ga0501067_0012624
382 Ga0501067_0013348
383 Ga0501067_0023628
384 Ga0501068_0004078
385 Ga0501068_0010346
386 Ga0501068_0071953
387 Ga0501069_0015841
388 Ga0501069_0091651
389 Ga0501069_0222564
390 Ga0501070_0001754
391 Ga0501070_0004682
392 Ga0501070_0050388
393 Ga0501070_0265712
394 Ga0501071_0008265
395 Ga0501071_0008443
396 Ga0501071_0041186
397 Ga0501072_0013130
398 Ga0501072_0016474
399 Ga0501072_0044833
400 Ga0501073_0004149
401 Ga0501073_0035708
402 Ga0501073_0213585
403 Ga0501074_0004855
404 Ga0501074_0006976
405 Ga0501074_0028128
406 Ga0501074_0115059
407 Ga0501076_0011994
408 Ga0501077_0013740
409 Ga0501077_0022056
410 Ga0501079_0024113
411 Ga0501079_0027435
412 Ga0501079_0154734
413 Ga0501080_0007186
414 Ga0501080_0012216
415 Ga0501080_0037954
416 Ga0501080_0044190
417 Ga0501083_0012271
418 Ga0501083_0031755
419 Ga0501035_0007262
420 Ga0501035_0022020
421 Ga0501035_0136215
422 Ga0501035_0328548
423 Ga0501044_0011512
424 Ga0501044_0096618
425 Ga0501044_0214130
426 Ga0501045_0014700
427 Ga0501045_0040016
428 Ga0501045_0089334
429 nmdc:mga03n38_57429_c1
430 nmdc:mga00v17_72312_c1
431 nmdc:mga0yw44_2712_c1
432 nmdc:mga0yw44_33170_c1
433 nmdc:mga04h51_11300_c1
434 Ga0495619_0014986
435 Ga0500593_006236
436 Ga0500573_0013416
437 Ga0501084_0007955
438 Ga0501084_0022556
439 Ga0501082_0030009
440 Ga0501082_0059901
441 Ga0501082_0086780
442 Ga0501082_0264386
443 Ga0466962_0017217
444 Ga0466962_0034968
445 Ga0530510_0010160
446 2643824862
447 2644093301
448 2644232099
449 2644322911
450 2644532587
451 2740168536
452 2774395058
453 2809194111
454 2812348840
455 2855390117
456 2857484940
457 2891973396
458 8054614041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13365

Trypsin_2

Trypsin-like peptidase domain

215

350

0.91

PF02674

Colicin_V

Colicin V production protein

4

146

0.87

PF00089

Trypsin

Trypsin

189

374

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6y-assembly1.cif.gz_A crystal structure of rv3671c protease from m. tuberculosis, active form 0.9428 156 378
3k6y-assembly1.cif.gz_A crystal structure of rv3671c protease from m. tuberculosis, active form 0.9226 156 378
3k6z-assembly1.cif.gz_A crystal structure of rv3671c protease, inactive form 0.9208 165 362
3k6z-assembly1.cif.gz_B crystal structure of rv3671c protease, inactive form 0.9132 165 362
3lt3-assembly3.cif.gz_B-2 crystal structure of rv3671c from m. tuberculosis h37rv, ser343ala mutant, inactive form 0.9001 164 365
ID Description Score Start End Superfamily
3stjA01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9137 178 253 2.40.10.10
3lt3B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9022 164 260 2.40.10.10
af_O07175_48_145_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8994 180 263 2.40.10.10
af_A0A1D8PCD2_46_263_2.40.10.120 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8972 179 367 2.40.10.120
3lt3B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8934 164 260 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A4Q5T241-F1-model_v4 MarP family serine protease 0.9894 166 377 GO:0004252
GO:0006508
GO:0016020
AF-A0A4Q4CLD0-F1-model_v4 Serine protease 0.9888 234 378 GO:0006508
GO:0008233
AF-A0A6B3HHT9-F1-model_v4 MarP family serine protease 0.9815 202 378 GO:0004252
GO:0006508
GO:0016020
AF-A0A1M7V130-F1-model_v4 Trypsin-like peptidase domain-containing protein 0.9794 196 376 GO:0004252
GO:0006508
GO:0016020
AF-A0A7W1JJF5-F1-model_v4 Serine protease 0.9768 272 377 GO:0006508
GO:0008233

Map