F341939

General Info

Members Datasets Scaffolds Average Seq Length
229 164 458 322

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10002817|Ga0099794_100028172
Length 357
Sequence MGHRASGMACNGKRELIIQLNESHEEKFMRKRQLGKSGPLVSAMGLGCMGMSEFYGERDDPESIATIHRSIELGITFLDTADVYGYGDNEILVGMAIRSLRNKVFLATKFGIVRSKADPAVRGFNGRPEYVRKSCDASLKRLGVEIIDLYYQHRVDPTVPIEETVGAMAELVKAGKVRYLGLSEASAGTIRRAHKVHPIAALQTEYSLWSRDPEDDILAATRELGIAFVAYSPLGRGFLTGQIKRFEDFAPEDYRRNSPRFQGENFEKNLELVRRVEAIAKEKKCTPGQLALAWLLAQGEDIIPIPGTKRRAYLEENAAALNVSLTKDDLRRIDEVAPRGAAAGMRYPEQMMKAVGR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
162 2858868258 Micromonospora sp. MH33 Isolate Unclassified
163 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
164 2996221748 Micromonospora veneta CAP181 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0.44
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0.44
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10002817 3300007265 Bacteria 6507
2 Ga0070670_100028201 3300005331 Bacteria 4832
3 Ga0070666_10001352 3300005335 Bacteria 14886
4 Ga0070680_100008577 3300005336 Bacteria 7831
5 Ga0070680_100093552 3300005336 Bacteria 2490
6 Ga0068868_100236760 3300005338 Bacteria 1533
7 Ga0070660_100001365 3300005339 Bacteria 16588
8 Ga0070660_100040170 3300005339 Bacteria 3559
9 Ga0070661_100000629 3300005344 Bacteria 26232
10 Ga0070661_100020933 3300005344 Bacteria 4668
11 Ga0070668_100016995 3300005347 Bacteria 5442
12 Ga0070659_100090908 3300005366 Bacteria 2446
13 Ga0070667_100154260 3300005367 Bacteria 2019
14 Ga0070711_100030562 3300005439 Bacteria 3567
15 Ga0070708_100000328 3300005445 Bacteria 35692
16 Ga0070708_100167288 3300005445 Bacteria 2051
17 Ga0070663_100052195 3300005455 Bacteria 2916
18 Ga0070662_100056990 3300005457 Bacteria 2838
19 Ga0070681_10003385 3300005458 Bacteria 14919
20 Ga0070681_10028692 3300005458 Bacteria 5594
21 Ga0070681_10046089 3300005458 Bacteria 4359
22 Ga0070706_100132487 3300005467 Bacteria 2326
23 Ga0070707_100060046 3300005468 Bacteria 3646
24 Ga0070698_100004834 3300005471 Bacteria 14787
25 Ga0070699_100001961 3300005518 Bacteria 18583
26 Ga0070679_100019356 3300005530 Bacteria 6615
27 Ga0070679_100019844 3300005530 Bacteria 6545
28 Ga0070697_100012275 3300005536 Bacteria 6709
29 Ga0068853_100044422 3300005539 Bacteria 3804
30 Ga0070665_100000068 3300005548 Bacteria 204531
31 Ga0070665_100000235 3300005548 Bacteria 91903
32 Ga0070665_100004912 3300005548 Bacteria 13868
33 Ga0068855_100003375 3300005563 Bacteria 19559
34 Ga0070664_100002907 3300005564 Bacteria 13860
35 Ga0068857_100001004 3300005577 Bacteria 21709
36 Ga0068854_100033387 3300005578 Bacteria 3588
37 Ga0068854_100070301 3300005578 Bacteria 2558
38 Ga0068856_100013278 3300005614 Bacteria 7978
39 Ga0068852_100046012 3300005616 Bacteria 3715
40 Ga0068852_100059457 3300005616 Bacteria 3314
41 Ga0068861_100014207 3300005719 Bacteria 5586
42 Ga0068851_10000568 3300005834 Bacteria 16077
43 Ga0068858_100000012 3300005842 Bacteria 216931
44 Ga0068858_100034106 3300005842 Bacteria 4721
45 Ga0081538_10008532 3300005981 Bacteria 8682
46 Ga0070717_10322736 3300006028 Bacteria 1376
47 Ga0075433_10075950 3300006852 Bacteria 2958
48 Ga0075435_100078291 3300007076 Bacteria 2711
49 Ga0075435_100244062 3300007076 Bacteria 1528
50 Ga0099794_10002091 3300007265 Bacteria 7255
51 Ga0099794_10026035 3300007265 Bacteria 2700
52 Ga0105240_10002432 3300009093 Bacteria 29938
53 Ga0105240_10019224 3300009093 Bacteria 9132
54 Ga0105240_10168866 3300009093 Bacteria 2592
55 Ga0114129_10175430 3300009147 Bacteria 2919
56 Ga0114129_10209824 3300009147 Bacteria 2634
57 Ga0114129_10260790 3300009147 Bacteria 2323
58 Ga0105241_10008025 3300009174 Bacteria 7767
59 Ga0105241_10010769 3300009174 Bacteria 6709
60 Ga0105237_10509323 3300009545 Bacteria 1210
61 Ga0105238_10000865 3300009551 Bacteria 31282
62 Ga0105238_10009085 3300009551 Bacteria 9945
63 Ga0105238_10040357 3300009551 Bacteria 4729
64 Ga0105249_10000023 3300009553 Bacteria 238850
65 Ga0105249_10029273 3300009553 Bacteria 4973
66 Ga0105246_10552202 3300011119 Bacteria 987
67 Ga0157373_10065809 3300013100 Bacteria 2565
68 Ga0157370_10001715 3300013104 Bacteria 26992
69 Ga0157370_10019330 3300013104 Bacteria 6837
70 Ga0157370_10032638 3300013104 Bacteria 5082
71 Ga0157369_10006881 3300013105 Bacteria 13122
72 Ga0157369_10018803 3300013105 Bacteria 7744
73 Ga0157369_10098838 3300013105 Bacteria 3111
74 Ga0157369_10517163 3300013105 Bacteria 1235
75 Ga0157374_10030749 3300013296 Bacteria 4878
76 Ga0163162_10057249 3300013306 Bacteria 3926
77 Ga0157372_10023399 3300013307 Bacteria 6696
78 Ga0157372_10060075 3300013307 Bacteria 4253
79 Ga0157372_10135567 3300013307 Bacteria 2835
80 Ga0157372_10780750 3300013307 Bacteria 1110
81 Ga0182008_10007343 3300014497 Bacteria 6092
82 Ga0182008_10020824 3300014497 Bacteria 3373
83 Ga0157377_10158794 3300014745 Bacteria 1404
84 Ga0157379_10008710 3300014968 Bacteria 8840
85 Ga0213872_10002177 3300021361 Bacteria 11737
86 Ga0213875_10002441 3300021388 Bacteria 11114
87 Ga0228598_1000121 3300024227 Bacteria 13170
88 Ga0207682_10000934 3300025893 Bacteria 13543
89 Ga0207680_10002637 3300025903 Bacteria 8379
90 Ga0207647_10000186 3300025904 Bacteria 50154
91 Ga0207647_10204264 3300025904 Bacteria 1142
92 Ga0207684_10009990 3300025910 Bacteria 8367
93 Ga0207654_10003621 3300025911 Bacteria 7790
94 Ga0207707_10050027 3300025912 Bacteria 3641
95 Ga0207707_10199593 3300025912 Bacteria 1744
96 Ga0207695_10010628 3300025913 Bacteria 11246
97 Ga0207695_10013842 3300025913 Bacteria 9596
98 Ga0207695_10015453 3300025913 Bacteria 8987
99 Ga0207695_10117441 3300025913 Bacteria 2633
100 Ga0207671_10105930 3300025914 Bacteria 2134
101 Ga0207660_10117648 3300025917 Bacteria 2009
102 Ga0207657_10003553 3300025919 Bacteria 16648
103 Ga0207657_10023369 3300025919 Bacteria 5756
104 Ga0207649_10003952 3300025920 Bacteria 8082
105 Ga0207646_10066925 3300025922 Bacteria 3207
106 Ga0207694_10005113 3300025924 Bacteria 10126
107 Ga0207694_10009922 3300025924 Bacteria 7185
108 Ga0207694_10013567 3300025924 Bacteria 6139
109 Ga0207650_10018732 3300025925 Bacteria 4861
110 Ga0207664_10070739 3300025929 Bacteria 2808
111 Ga0207664_10271656 3300025929 Bacteria 1485
112 Ga0207644_10030474 3300025931 Bacteria 3752
113 Ga0207706_10025798 3300025933 Bacteria 5265
114 Ga0207661_10017400 3300025944 Bacteria 5319
115 Ga0207661_10106278 3300025944 Bacteria 2366
116 Ga0207679_10008479 3300025945 Bacteria 6546
117 Ga0207679_10367812 3300025945 Bacteria 1258
118 Ga0207667_10016209 3300025949 Bacteria 8422
119 Ga0207712_10000155 3300025961 Bacteria 70305
120 Ga0207712_10000254 3300025961 Bacteria 51558
121 Ga0207668_10089454 3300025972 Bacteria 2257
122 Ga0207668_10302371 3300025972 Bacteria 1321
123 Ga0207703_10000310 3300026035 Bacteria 52770
124 Ga0207703_10001652 3300026035 Bacteria 20054
125 Ga0207639_10007245 3300026041 Bacteria 7558
126 Ga0207639_10053706 3300026041 Bacteria 3076
127 Ga0207678_10014784 3300026067 Bacteria 6869
128 Ga0207678_10042491 3300026067 Bacteria 3937
129 Ga0207678_10173981 3300026067 Bacteria 1838
130 Ga0207678_10185678 3300026067 Bacteria 1776
131 Ga0207702_10005374 3300026078 Bacteria 11220
132 Ga0207702_10088511 3300026078 Bacteria 2705
133 Ga0207702_10096236 3300026078 Bacteria 2603
134 Ga0207641_10143429 3300026088 Bacteria 2158
135 Ga0207674_10000465 3300026116 Bacteria 53128
136 Ga0207675_100048605 3300026118 Bacteria 3960
137 Ga0207675_100140499 3300026118 Bacteria 2294
138 Ga0207698_10007693 3300026142 Bacteria 6759
139 Ga0207698_10078994 3300026142 Bacteria 2644
140 Ga0209588_1005939 3300027671 Bacteria 3520
141 Ga0209588_1009923 3300027671 Bacteria 2854
142 Ga0268266_10000006 3300028379 Bacteria 1410021
143 Ga0268266_10000020 3300028379 Bacteria 527065
144 Ga0268266_10000147 3300028379 Bacteria 135216
145 Ga0268265_10221421 3300028380 Bacteria 1656
146 Ga0265334_10000013 3300028573 Bacteria 155968
147 Ga0265338_10000060 3300028800 Bacteria 197991
148 Ga0265760_10020215 3300031090 Bacteria 1921
149 Ga0265340_10000241 3300031247 Bacteria 28285
150 Ga0265339_10070113 3300031249 Bacteria 1870
151 Ga0265316_10000054 3300031344 Bacteria 124687
152 Ga0307408_100253126 3300031548 Bacteria 1454
153 Ga0316577_10024369 3300031733 Bacteria 3364
154 Ga0373934_0004544 3300035086 Bacteria 5128
155 Ga0373939_0042801 3300035114 Bacteria 1371
156 Ga0373954_0000937 3300035118 Bacteria 11355
157 Ga0373956_0000858 3300035119 Bacteria 12654
158 Ga0373957_0026205 3300035120 Bacteria 2107
159 Ga0373955_0000656 3300035172 Bacteria 14739
160 Ga0316574_0023645 3300035398 Bacteria 3671
161 Ga0373931_0298836 3300035691 Bacteria 994
162 Ga0373927_0003492 3300035695 Bacteria 11257
163 Ga0373933_0001840 3300035724 Bacteria 12281
164 Ga0373947_0006694 3300035725 Bacteria 6689
165 Ga0373937_0003910 3300036401 Bacteria 12603
166 Ga0316582_0065523 3300036647 Bacteria 2339
167 Ga0373925_0003253 3300037068 Bacteria 12663
168 Ga0395899_0003084 3300037312 Bacteria 13276
169 Ga0395900_0121499 3300037418 Bacteria 2679
170 Ga0395898_0082090 3300037466 Bacteria 3107
171 Ga0395905_0115475 3300037471 Bacteria 2523
172 Ga0395905_0135239 3300037471 Bacteria 2319
173 Ga0436364_0165626 3300037853 Bacteria 37875
174 Ga0395901_0149761 3300038443 Bacteria 2452
175 Ga0237819_00214 3300038705 Bacteria 21030
176 Ga0436361_0410458 3300039447 Bacteria 41052
177 Ga0436363_0029937 3300039450 Bacteria 1173
178 Ga0436362_0077921 3300039453 Bacteria 1390
179 Ga0451577_0110449 3300042876 Bacteria 2460
180 Ga0453683_0000255 3300044673 Bacteria 70114
181 Ga0453683_0005973 3300044673 Bacteria 8394
182 Ga0466961_0043585 3300044693 Bacteria 2873
183 Ga0466963_0108230 3300044694 Bacteria 1906
184 Ga0466964_0092370 3300044706 Bacteria 1320
185 Ga0466970_0107173 3300044765 Bacteria 1525
186 Ga0466957_0004816 3300044842 Bacteria 7554
187 Ga0466960_0047178 3300044901 Bacteria 2065
188 Ga0466960_0099961 3300044901 Bacteria 1492
189 Ga0466959_0009225 3300045049 Bacteria 7009
190 Ga0466959_0024712 3300045049 Bacteria 4451
191 Ga0466967_0014241 3300045976 Bacteria 6186
192 Ga0495650_0000053 3300046471 Bacteria 316684
193 Ga0495607_0002309 3300046501 Bacteria 15654
194 Ga0495608_0134112 3300046511 Bacteria 1583
195 Ga0495630_0001753 3300046517 Bacteria 15153
196 Ga0495630_0075901 3300046517 Bacteria 2532
197 Ga0495643_0000045 3300046522 Bacteria 224043
198 Ga0495666_0076516 3300046526 Bacteria 1586
199 Ga0495587_0004686 3300046536 Bacteria 8976
200 Ga0495624_0063473 3300046690 Bacteria 2309
201 Ga0495604_0000247 3300047317 Bacteria 48399
202 Ga0495602_0001794 3300048088 Bacteria 21461
203 Ga0496109_0265004 3300048912 Bacteria 1619
204 Ga0501032_0000176 3300049569 Bacteria 52456
205 Ga0501036_0002947 3300049572 Bacteria 13520
206 Ga0501037_0000137 3300049573 Bacteria 68308
207 Ga0501038_0002398 3300049574 Bacteria 17462
208 Ga0501039_0497597 3300049575 Bacteria 957
209 Ga0501042_0011904 3300049578 Bacteria 5879
210 Ga0501043_0000062 3300049579 Bacteria 95664
211 Ga0501046_0000059 3300049580 Bacteria 126801
212 Ga0501048_0000001 3300049582 Bacteria 132132
213 Ga0501070_0095110 3300049586 Bacteria 2465
214 Ga0501073_0004181 3300049589 Bacteria 10830
215 Ga0501080_0496486 3300049742 Bacteria 1091
216 Ga0501083_0126884 3300049744 Bacteria 1672
217 Ga0501035_0021549 3300049822 Bacteria 5924
218 Ga0501044_0141994 3300049823 Bacteria 2389
219 nmdc:mga05p37_149358_c1 3300050507 Bacteria 2859
220 nmdc:mga05p37_184232_c1 3300050507 Bacteria 2539
221 nmdc:mga05p37_227670_c1 3300050507 Bacteria 2247
222 nmdc:mga0a205_247404_c1 3300050515 Bacteria 1663
223 nmdc:mga0a205_90612_c1 3300050515 Bacteria 2955
224 Ga0500628_000376 3300053129 Bacteria 8444
225 Ga0466962_0012061 3300061719 Bacteria 4156
226 2846039902 2846037992 Bacteria 4526407
227 2858875564 2858868258 Bacteria 7683772
228 2858905703 2858902515 Bacteria 7086037
229 2996227627 2996221748 Bacteria 6799777
230 Ga0099794_10002817
231 Ga0070670_100028201
232 Ga0070666_10001352
233 Ga0070680_100008577
234 Ga0070680_100093552
235 Ga0068868_100236760
236 Ga0070660_100001365
237 Ga0070660_100040170
238 Ga0070661_100000629
239 Ga0070661_100020933
240 Ga0070668_100016995
241 Ga0070659_100090908
242 Ga0070667_100154260
243 Ga0070711_100030562
244 Ga0070708_100000328
245 Ga0070708_100167288
246 Ga0070663_100052195
247 Ga0070662_100056990
248 Ga0070681_10003385
249 Ga0070681_10028692
250 Ga0070681_10046089
251 Ga0070706_100132487
252 Ga0070707_100060046
253 Ga0070698_100004834
254 Ga0070699_100001961
255 Ga0070679_100019356
256 Ga0070679_100019844
257 Ga0070697_100012275
258 Ga0068853_100044422
259 Ga0070665_100000068
260 Ga0070665_100000235
261 Ga0070665_100004912
262 Ga0068855_100003375
263 Ga0070664_100002907
264 Ga0068857_100001004
265 Ga0068854_100033387
266 Ga0068854_100070301
267 Ga0068856_100013278
268 Ga0068852_100046012
269 Ga0068852_100059457
270 Ga0068861_100014207
271 Ga0068851_10000568
272 Ga0068858_100000012
273 Ga0068858_100034106
274 Ga0081538_10008532
275 Ga0070717_10322736
276 Ga0075433_10075950
277 Ga0075435_100078291
278 Ga0075435_100244062
279 Ga0099794_10002091
280 Ga0099794_10026035
281 Ga0105240_10002432
282 Ga0105240_10019224
283 Ga0105240_10168866
284 Ga0114129_10175430
285 Ga0114129_10209824
286 Ga0114129_10260790
287 Ga0105241_10008025
288 Ga0105241_10010769
289 Ga0105237_10509323
290 Ga0105238_10000865
291 Ga0105238_10009085
292 Ga0105238_10040357
293 Ga0105249_10000023
294 Ga0105249_10029273
295 Ga0105246_10552202
296 Ga0157373_10065809
297 Ga0157370_10001715
298 Ga0157370_10019330
299 Ga0157370_10032638
300 Ga0157369_10006881
301 Ga0157369_10018803
302 Ga0157369_10098838
303 Ga0157369_10517163
304 Ga0157374_10030749
305 Ga0163162_10057249
306 Ga0157372_10023399
307 Ga0157372_10060075
308 Ga0157372_10135567
309 Ga0157372_10780750
310 Ga0182008_10007343
311 Ga0182008_10020824
312 Ga0157377_10158794
313 Ga0157379_10008710
314 Ga0213872_10002177
315 Ga0213875_10002441
316 Ga0228598_1000121
317 Ga0207682_10000934
318 Ga0207680_10002637
319 Ga0207647_10000186
320 Ga0207647_10204264
321 Ga0207684_10009990
322 Ga0207654_10003621
323 Ga0207707_10050027
324 Ga0207707_10199593
325 Ga0207695_10010628
326 Ga0207695_10013842
327 Ga0207695_10015453
328 Ga0207695_10117441
329 Ga0207671_10105930
330 Ga0207660_10117648
331 Ga0207657_10003553
332 Ga0207657_10023369
333 Ga0207649_10003952
334 Ga0207646_10066925
335 Ga0207694_10005113
336 Ga0207694_10009922
337 Ga0207694_10013567
338 Ga0207650_10018732
339 Ga0207664_10070739
340 Ga0207664_10271656
341 Ga0207644_10030474
342 Ga0207706_10025798
343 Ga0207661_10017400
344 Ga0207661_10106278
345 Ga0207679_10008479
346 Ga0207679_10367812
347 Ga0207667_10016209
348 Ga0207712_10000155
349 Ga0207712_10000254
350 Ga0207668_10089454
351 Ga0207668_10302371
352 Ga0207703_10000310
353 Ga0207703_10001652
354 Ga0207639_10007245
355 Ga0207639_10053706
356 Ga0207678_10014784
357 Ga0207678_10042491
358 Ga0207678_10173981
359 Ga0207678_10185678
360 Ga0207702_10005374
361 Ga0207702_10088511
362 Ga0207702_10096236
363 Ga0207641_10143429
364 Ga0207674_10000465
365 Ga0207675_100048605
366 Ga0207675_100140499
367 Ga0207698_10007693
368 Ga0207698_10078994
369 Ga0209588_1005939
370 Ga0209588_1009923
371 Ga0268266_10000006
372 Ga0268266_10000020
373 Ga0268266_10000147
374 Ga0268265_10221421
375 Ga0265334_10000013
376 Ga0265338_10000060
377 Ga0265760_10020215
378 Ga0265340_10000241
379 Ga0265339_10070113
380 Ga0265316_10000054
381 Ga0307408_100253126
382 Ga0316577_10024369
383 Ga0373934_0004544
384 Ga0373939_0042801
385 Ga0373954_0000937
386 Ga0373956_0000858
387 Ga0373957_0026205
388 Ga0373955_0000656
389 Ga0316574_0023645
390 Ga0373931_0298836
391 Ga0373927_0003492
392 Ga0373933_0001840
393 Ga0373947_0006694
394 Ga0373937_0003910
395 Ga0316582_0065523
396 Ga0373925_0003253
397 Ga0395899_0003084
398 Ga0395900_0121499
399 Ga0395898_0082090
400 Ga0395905_0115475
401 Ga0395905_0135239
402 Ga0436364_0165626
403 Ga0395901_0149761
404 Ga0237819_00214
405 Ga0436361_0410458
406 Ga0436363_0029937
407 Ga0436362_0077921
408 Ga0451577_0110449
409 Ga0453683_0000255
410 Ga0453683_0005973
411 Ga0466961_0043585
412 Ga0466963_0108230
413 Ga0466964_0092370
414 Ga0466970_0107173
415 Ga0466957_0004816
416 Ga0466960_0047178
417 Ga0466960_0099961
418 Ga0466959_0009225
419 Ga0466959_0024712
420 Ga0466967_0014241
421 Ga0495650_0000053
422 Ga0495607_0002309
423 Ga0495608_0134112
424 Ga0495630_0001753
425 Ga0495630_0075901
426 Ga0495643_0000045
427 Ga0495666_0076516
428 Ga0495587_0004686
429 Ga0495624_0063473
430 Ga0495604_0000247
431 Ga0495602_0001794
432 Ga0496109_0265004
433 Ga0501032_0000176
434 Ga0501036_0002947
435 Ga0501037_0000137
436 Ga0501038_0002398
437 Ga0501039_0497597
438 Ga0501042_0011904
439 Ga0501043_0000062
440 Ga0501046_0000059
441 Ga0501048_0000001
442 Ga0501070_0095110
443 Ga0501073_0004181
444 Ga0501080_0496486
445 Ga0501083_0126884
446 Ga0501035_0021549
447 Ga0501044_0141994
448 nmdc:mga05p37_149358_c1
449 nmdc:mga05p37_184232_c1
450 nmdc:mga05p37_227670_c1
451 nmdc:mga0a205_247404_c1
452 nmdc:mga0a205_90612_c1
453 Ga0500628_000376
454 Ga0466962_0012061
455 2846039902
456 2858875564
457 2858905703
458 2996227627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

43

338

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8593 2 297
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.8482 1 310
7wf3-assembly1.cif.gz_C composite map of human kv1.3 channel in apo state with beta subunits 0.8398 3 295
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8355 1 296
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.833 1 310
ID Description Score Start End Superfamily
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9555 58 314 3.20.20.100
af_P97382_23_247_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9001 91 295 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8992 4 314 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8871 58 314 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8855 4 314 3.20.20.100
ID Description Score Start End GO Terms
AF-W9VHQ2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9881 82 184 GO:0004033
GO:0005737
AF-A0A7J8U949-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9864 80 186 GO:0004033
GO:0005737
GO:0016020
AF-A0A7Y5WXJ2-F1-model_v4 Aldo/keto reductase 0.9815 47 315 GO:0004033
GO:0005737
AF-A0A414PN53-F1-model_v4 Aldo/keto reductase 0.9804 82 202 GO:0004033
GO:0005737
AF-A0A7C2A0S3-F1-model_v4 Aldo/keto reductase 0.9783 107 315 GO:0004033
GO:0005737

Map