F341776

General Info

Members Datasets Scaffolds Average Seq Length
229 144 458 187

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100422136|Ga0070708_1004221361
Length 204
Sequence MARPKSEDKRNAILSAATEVFAERGLGAATLAISNAAAVAEGTLFTYFKTKDDLVNELYRQIKLELADAMMSEFPRRKSVRHRLQHIWDCFVNWGVANPVQRKALAQLEVSNRLSAESKKAGSAPFVEIQTMAQDAIARHILRDLPQEFIGAVMRALAETTMEFMASNPEAADRYRQLGFAVLWAGITKKKQDCFCIDNACLLT

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
68 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
141 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
142 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 2.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 1.31
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 31.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100422136 3300005445 Bacteria 1258
2 MBSR1b_contig_12606117 2162886012 Unclassified 828
3 Ga0065715_10258975 3300005293 Bacteria 1144
4 Ga0070658_10373795 3300005327 Bacteria 1222
5 Ga0070676_10582616 3300005328 Unclassified 805
6 Ga0070683_100025078 3300005329 Bacteria 5350
7 Ga0070683_100053015 3300005329 Bacteria 3759
8 Ga0068868_100042001 3300005338 Unclassified 3565
9 Ga0070660_100266202 3300005339 Unclassified 1400
10 Ga0070691_10585691 3300005341 Unclassified 656
11 Ga0070661_100095642 3300005344 Unclassified 2203
12 Ga0070671_100010859 3300005355 Bacteria 7309
13 Ga0070673_100931377 3300005364 Unclassified 807
14 Ga0070659_100058623 3300005366 Unclassified 3039
15 Ga0070667_100590706 3300005367 Unclassified 1022
16 Ga0070713_100187172 3300005436 Bacteria 1864
17 Ga0070713_100361074 3300005436 Bacteria 1349
18 Ga0070711_100074670 3300005439 Bacteria 2398
19 Ga0070711_100493145 3300005439 Unclassified 1009
20 Ga0070711_100534385 3300005439 Bacteria 971
21 Ga0070711_100593159 3300005439 Unclassified 923
22 Ga0070708_100089034 3300005445 Bacteria 2808
23 Ga0070708_100618142 3300005445 Bacteria 1021
24 Ga0070708_100928648 3300005445 Unclassified 817
25 Ga0070663_100338550 3300005455 Bacteria 1215
26 Ga0070706_100036800 3300005467 Bacteria 4521
27 Ga0070706_100066299 3300005467 Unclassified 3340
28 Ga0070707_100010351 3300005468 Bacteria 8684
29 Ga0070707_100046880 3300005468 Bacteria 4137
30 Ga0070698_100002964 3300005471 Bacteria 18671
31 Ga0070699_100010604 3300005518 Bacteria 7975
32 Ga0070699_100087443 3300005518 Bacteria 2721
33 Ga0070699_100376281 3300005518 Bacteria 1282
34 Ga0070697_100187331 3300005536 Bacteria 1755
35 Ga0070697_100340320 3300005536 Bacteria 1294
36 Ga0070697_100752034 3300005536 Unclassified 861
37 Ga0070697_100915876 3300005536 Unclassified 778
38 Ga0068853_100027902 3300005539 Bacteria 4747
39 Ga0068853_100088316 3300005539 Unclassified 2721
40 Ga0068853_100215695 3300005539 Unclassified 1751
41 Ga0070665_100012128 3300005548 Bacteria 8695
42 Ga0070665_100527010 3300005548 Bacteria 1193
43 Ga0070704_100332128 3300005549 Bacteria 1277
44 Ga0068855_100002486 3300005563 Bacteria 22705
45 Ga0068855_100205609 3300005563 Bacteria 2215
46 Ga0068855_100219293 3300005563 Bacteria 2134
47 Ga0070664_100809835 3300005564 Unclassified 876
48 Ga0068857_100000578 3300005577 Bacteria 26753
49 Ga0068854_100071284 3300005578 Bacteria 2542
50 Ga0068856_100016672 3300005614 Bacteria 7115
51 Ga0068856_100037266 3300005614 Bacteria 4771
52 Ga0068856_100065589 3300005614 Bacteria 3588
53 Ga0068852_100087875 3300005616 Bacteria 2774
54 Ga0068859_100245474 3300005617 Bacteria 1880
55 Ga0068866_10180575 3300005718 Unclassified 1246
56 Ga0068861_101271499 3300005719 Unclassified 714
57 Ga0068863_100116908 3300005841 Bacteria 2541
58 Ga0068858_100040900 3300005842 Bacteria 4299
59 Ga0081540_1146293 3300005983 Unclassified 940
60 Ga0070717_10004809 3300006028 Bacteria 9823
61 Ga0070717_10025442 3300006028 Bacteria 4708
62 Ga0070717_10388566 3300006028 Bacteria 1252
63 Ga0070716_101094069 3300006173 Bacteria 635
64 Ga0070712_100048555 3300006175 Bacteria 2942
65 Ga0097621_100037941 3300006237 Bacteria 3864
66 Ga0097621_100173516 3300006237 Unclassified 1860
67 Ga0068871_100037013 3300006358 Bacteria 3889
68 Ga0097620_100245480 3300006931 Bacteria 1880
69 Ga0099794_10133481 3300007265 Bacteria 1255
70 Ga0099794_10163476 3300007265 Bacteria 1133
71 Ga0099794_10340317 3300007265 Unclassified 779
72 Ga0099795_10057892 3300007788 Bacteria 1430
73 Ga0099795_10071497 3300007788 Bacteria 1310
74 Ga0099795_10156167 3300007788 Bacteria 938
75 Ga0105240_10004090 3300009093 Bacteria 22417
76 Ga0105240_10004686 3300009093 Bacteria 20679
77 Ga0105240_10186209 3300009093 Bacteria 2445
78 Ga0105245_10020642 3300009098 Bacteria 5776
79 Ga0105243_10392818 3300009148 Bacteria 1286
80 Ga0105241_10004724 3300009174 Bacteria 10047
81 Ga0105241_10024410 3300009174 Bacteria 4489
82 Ga0105241_10062431 3300009174 Plasmid 2872
83 Ga0105241_10338672 3300009174 Unclassified 1302
84 Ga0105242_10054237 3300009176 Bacteria 3276
85 Ga0105242_10146354 3300009176 Unclassified 2056
86 Ga0105242_10319570 3300009176 Unclassified 1423
87 Ga0105248_10001736 3300009177 Bacteria 24224
88 Ga0105248_10123899 3300009177 Bacteria 2915
89 Ga0105248_10383242 3300009177 Unclassified 1583
90 Ga0105248_11630502 3300009177 Unclassified 731
91 Ga0105237_10074191 3300009545 Bacteria 3394
92 Ga0105237_10113759 3300009545 Bacteria 2698
93 Ga0105238_10004489 3300009551 Bacteria 13826
94 Ga0105238_10009778 3300009551 Bacteria 9602
95 Ga0105238_10140024 3300009551 Bacteria 2396
96 Ga0105238_10200238 3300009551 Unclassified 1972
97 Ga0105238_11177686 3300009551 Unclassified 790
98 Ga0105249_10174509 3300009553 Bacteria 2087
99 Ga0099796_10117204 3300010159 Bacteria 1020
100 Ga0105239_10006366 3300010375 Bacteria 13718
101 Ga0105239_10008888 3300010375 Bacteria 11372
102 Ga0105239_10180817 3300010375 Unclassified 2360
103 Ga0105246_10442104 3300011119 Unclassified 1091
104 Ga0157369_10003301 3300013105 Bacteria 19186
105 Ga0157369_10030083 3300013105 Bacteria 5992
106 Ga0157369_10101345 3300013105 Bacteria 3068
107 Ga0157369_10138579 3300013105 Unclassified 2575
108 Ga0157374_10005571 3300013296 Bacteria 10601
109 Ga0157374_10401304 3300013296 Unclassified 1368
110 Ga0157374_10548796 3300013296 Unclassified 1163
111 Ga0157378_10016133 3300013297 Bacteria 6541
112 Ga0157378_10045058 3300013297 Bacteria 3918
113 Ga0157378_10289395 3300013297 Bacteria 1582
114 Ga0163162_10006322 3300013306 Bacteria 11470
115 Ga0163162_10158689 3300013306 Bacteria 2383
116 Ga0163162_10889696 3300013306 Unclassified 1004
117 Ga0157372_10005679 3300013307 Bacteria 13273
118 Ga0157372_10138715 3300013307 Unclassified 2801
119 Ga0157372_10149124 3300013307 Bacteria 2698
120 Ga0157375_10707786 3300013308 Bacteria 1160
121 Ga0157375_10858403 3300013308 Bacteria 1054
122 Ga0163163_10151498 3300014325 Unclassified 2363
123 Ga0157379_10047212 3300014968 Bacteria 3841
124 Ga0157379_11494665 3300014968 Unclassified 657
125 Ga0157376_10208292 3300014969 Unclassified 1803
126 Ga0224569_100851 3300022732 Bacteria 2580
127 Ga0224572_1008739 3300024225 Bacteria 1878
128 Ga0228598_1002393 3300024227 Bacteria 4097
129 Ga0209026_1005991 3300025250 Bacteria 3106
130 Ga0207688_10303090 3300025901 Unclassified 977
131 Ga0207699_10059309 3300025906 Bacteria 2293
132 Ga0207699_10207497 3300025906 Bacteria 1331
133 Ga0207645_10042194 3300025907 Unclassified 2919
134 Ga0207705_10229176 3300025909 Unclassified 1413
135 Ga0207684_10014370 3300025910 Bacteria 6828
136 Ga0207684_10109451 3300025910 Unclassified 2365
137 Ga0207684_10463043 3300025910 Bacteria 1088
138 Ga0207654_10005909 3300025911 Bacteria 6160
139 Ga0207654_10215587 3300025911 Unclassified 1271
140 Ga0207695_10000911 3300025913 Bacteria 53168
141 Ga0207695_10021084 3300025913 Bacteria 7442
142 Ga0207695_10077369 3300025913 Bacteria 3379
143 Ga0207671_10048115 3300025914 Unclassified 3156
144 Ga0207671_10060522 3300025914 Bacteria 2809
145 Ga0207693_10038427 3300025915 Bacteria 3770
146 Ga0207663_10679168 3300025916 Unclassified 814
147 Ga0207646_10068327 3300025922 Bacteria 3173
148 Ga0207646_10109385 3300025922 Bacteria 2480
149 Ga0207646_10427864 3300025922 Unclassified 1195
150 Ga0207646_10435299 3300025922 Bacteria 1183
151 Ga0207694_10003300 3300025924 Bacteria 12835
152 Ga0207694_10009885 3300025924 Bacteria 7199
153 Ga0207694_10215983 3300025924 Unclassified 1563
154 Ga0207694_10624049 3300025924 Unclassified 907
155 Ga0207650_10475495 3300025925 Bacteria 1042
156 Ga0207687_10059602 3300025927 Bacteria 2690
157 Ga0207700_10860321 3300025928 Unclassified 811
158 Ga0207664_11021569 3300025929 Unclassified 741
159 Ga0207644_10017489 3300025931 Bacteria 4843
160 Ga0207706_10068479 3300025933 Unclassified 3123
161 Ga0207686_10376367 3300025934 Bacteria 1076
162 Ga0207665_10440498 3300025939 Bacteria 998
163 Ga0207711_10004298 3300025941 Bacteria 12176
164 Ga0207661_10043833 3300025944 Bacteria 3532
165 Ga0207661_10076394 3300025944 Bacteria 2751
166 Ga0207667_10010351 3300025949 Bacteria 10902
167 Ga0207667_10226760 3300025949 Bacteria 1914
168 Ga0207667_10515506 3300025949 Unclassified 1211
169 Ga0207712_10260243 3300025961 Bacteria 1407
170 Ga0207668_10174095 3300025972 Unclassified 1691
171 Ga0207640_10067970 3300025981 Unclassified 2386
172 Ga0207677_10015055 3300026023 Unclassified 4536
173 Ga0207703_10123059 3300026035 Unclassified 2229
174 Ga0207639_10393953 3300026041 Unclassified 1246
175 Ga0207678_10108365 3300026067 Bacteria 2370
176 Ga0207702_10012920 3300026078 Bacteria 6945
177 Ga0207702_10099118 3300026078 Unclassified 2568
178 Ga0207641_10523980 3300026088 Unclassified 1153
179 Ga0207648_10127853 3300026089 Bacteria 2235
180 Ga0207674_10000232 3300026116 Bacteria 69316
181 Ga0207675_101419665 3300026118 Unclassified 715
182 Ga0207683_10001989 3300026121 Bacteria 18097
183 Ga0207698_10127532 3300026142 Unclassified 2167
184 Ga0207698_10136038 3300026142 Bacteria 2108
185 Ga0207698_11195340 3300026142 Unclassified 774
186 Ga0209588_1040151 3300027671 Bacteria 1510
187 Ga0209588_1052812 3300027671 Bacteria 1315
188 Ga0268266_10030801 3300028379 Bacteria 4556
189 Ga0268266_10629347 3300028379 Bacteria 1032
190 Ga0265338_10102530 3300028800 Bacteria 2326
191 Ga0265762_1000388 3300030760 Bacteria 7542
192 Ga0265763_1006053 3300030763 Bacteria 1030
193 Ga0265773_1004887 3300031018 Unclassified 951
194 Ga0265760_10032603 3300031090 Bacteria 1538
195 Ga0265760_10158159 3300031090 Unclassified 746
196 Ga0265325_10076599 3300031241 Unclassified 1669
197 Ga0265314_10081494 3300031711 Bacteria 2132
198 Ga0436361_0516054 3300039447 Unclassified 666
199 Ga0453683_0000801 3300044673 Bacteria 30773
200 Ga0466963_0001443 3300044694 Bacteria 12802
201 Ga0453684_0154823 3300044712 Bacteria 2719
202 Ga0451576_0443762 3300045051 Bacteria 1362
203 Ga0466967_0000243 3300045976 Bacteria 23902
204 Ga0495638_0006660 3300046460 Bacteria 8383
205 Ga0495650_0173763 3300046471 Bacteria 761
206 Ga0495643_0000074 3300046522 Bacteria 167277
207 Ga0495587_0201779 3300046536 Unclassified 1124
208 Ga0495667_0355831 3300046559 Unclassified 925
209 Ga0495599_0023630 3300046678 Bacteria 3843
210 Ga0495674_0056299 3300047319 Bacteria 3444
211 Ga0495674_0144748 3300047319 Bacteria 1996
212 Ga0495672_0083395 3300047320 Bacteria 1775
213 Ga0495686_0000002 3300047472 Bacteria 1050777
214 Ga0495602_0645888 3300048088 Unclassified 723
215 Ga0496106_0352130 3300048909 Unclassified 1183
216 Ga0496115_0086481 3300048918 Unclassified 2558
217 Ga0496115_0313116 3300048918 Bacteria 1285
218 Ga0496126_0003251 3300048929 Bacteria 20768
219 Ga0496126_0025567 3300048929 Bacteria 5677
220 Ga0496126_0038289 3300048929 Bacteria 4464
221 Ga0501219_012240 3300049703 Bacteria 663
222 Ga0501083_0281983 3300049744 Bacteria 1081
223 nmdc:mga08y16_187719_c1 3300050511 Bacteria 2145
224 Ga0500641_0013568 3300053096 Bacteria 2994
225 Ga0500555_000123 3300053103 Bacteria 37241
226 Ga0500592_005670 3300053116 Bacteria 1987
227 Ga0500595_049274 3300053119 Bacteria 1312
228 Ga0500637_0365970 3300053178 Bacteria 761
229 Ga0500645_000021 3300053730 Bacteria 133415
230 Ga0070708_100422136
231 MBSR1b_contig_12606117
232 Ga0065715_10258975
233 Ga0070658_10373795
234 Ga0070676_10582616
235 Ga0070683_100025078
236 Ga0070683_100053015
237 Ga0068868_100042001
238 Ga0070660_100266202
239 Ga0070691_10585691
240 Ga0070661_100095642
241 Ga0070671_100010859
242 Ga0070673_100931377
243 Ga0070659_100058623
244 Ga0070667_100590706
245 Ga0070713_100187172
246 Ga0070713_100361074
247 Ga0070711_100074670
248 Ga0070711_100493145
249 Ga0070711_100534385
250 Ga0070711_100593159
251 Ga0070708_100089034
252 Ga0070708_100618142
253 Ga0070708_100928648
254 Ga0070663_100338550
255 Ga0070706_100036800
256 Ga0070706_100066299
257 Ga0070707_100010351
258 Ga0070707_100046880
259 Ga0070698_100002964
260 Ga0070699_100010604
261 Ga0070699_100087443
262 Ga0070699_100376281
263 Ga0070697_100187331
264 Ga0070697_100340320
265 Ga0070697_100752034
266 Ga0070697_100915876
267 Ga0068853_100027902
268 Ga0068853_100088316
269 Ga0068853_100215695
270 Ga0070665_100012128
271 Ga0070665_100527010
272 Ga0070704_100332128
273 Ga0068855_100002486
274 Ga0068855_100205609
275 Ga0068855_100219293
276 Ga0070664_100809835
277 Ga0068857_100000578
278 Ga0068854_100071284
279 Ga0068856_100016672
280 Ga0068856_100037266
281 Ga0068856_100065589
282 Ga0068852_100087875
283 Ga0068859_100245474
284 Ga0068866_10180575
285 Ga0068861_101271499
286 Ga0068863_100116908
287 Ga0068858_100040900
288 Ga0081540_1146293
289 Ga0070717_10004809
290 Ga0070717_10025442
291 Ga0070717_10388566
292 Ga0070716_101094069
293 Ga0070712_100048555
294 Ga0097621_100037941
295 Ga0097621_100173516
296 Ga0068871_100037013
297 Ga0097620_100245480
298 Ga0099794_10133481
299 Ga0099794_10163476
300 Ga0099794_10340317
301 Ga0099795_10057892
302 Ga0099795_10071497
303 Ga0099795_10156167
304 Ga0105240_10004090
305 Ga0105240_10004686
306 Ga0105240_10186209
307 Ga0105245_10020642
308 Ga0105243_10392818
309 Ga0105241_10004724
310 Ga0105241_10024410
311 Ga0105241_10062431
312 Ga0105241_10338672
313 Ga0105242_10054237
314 Ga0105242_10146354
315 Ga0105242_10319570
316 Ga0105248_10001736
317 Ga0105248_10123899
318 Ga0105248_10383242
319 Ga0105248_11630502
320 Ga0105237_10074191
321 Ga0105237_10113759
322 Ga0105238_10004489
323 Ga0105238_10009778
324 Ga0105238_10140024
325 Ga0105238_10200238
326 Ga0105238_11177686
327 Ga0105249_10174509
328 Ga0099796_10117204
329 Ga0105239_10006366
330 Ga0105239_10008888
331 Ga0105239_10180817
332 Ga0105246_10442104
333 Ga0157369_10003301
334 Ga0157369_10030083
335 Ga0157369_10101345
336 Ga0157369_10138579
337 Ga0157374_10005571
338 Ga0157374_10401304
339 Ga0157374_10548796
340 Ga0157378_10016133
341 Ga0157378_10045058
342 Ga0157378_10289395
343 Ga0163162_10006322
344 Ga0163162_10158689
345 Ga0163162_10889696
346 Ga0157372_10005679
347 Ga0157372_10138715
348 Ga0157372_10149124
349 Ga0157375_10707786
350 Ga0157375_10858403
351 Ga0163163_10151498
352 Ga0157379_10047212
353 Ga0157379_11494665
354 Ga0157376_10208292
355 Ga0224569_100851
356 Ga0224572_1008739
357 Ga0228598_1002393
358 Ga0209026_1005991
359 Ga0207688_10303090
360 Ga0207699_10059309
361 Ga0207699_10207497
362 Ga0207645_10042194
363 Ga0207705_10229176
364 Ga0207684_10014370
365 Ga0207684_10109451
366 Ga0207684_10463043
367 Ga0207654_10005909
368 Ga0207654_10215587
369 Ga0207695_10000911
370 Ga0207695_10021084
371 Ga0207695_10077369
372 Ga0207671_10048115
373 Ga0207671_10060522
374 Ga0207693_10038427
375 Ga0207663_10679168
376 Ga0207646_10068327
377 Ga0207646_10109385
378 Ga0207646_10427864
379 Ga0207646_10435299
380 Ga0207694_10003300
381 Ga0207694_10009885
382 Ga0207694_10215983
383 Ga0207694_10624049
384 Ga0207650_10475495
385 Ga0207687_10059602
386 Ga0207700_10860321
387 Ga0207664_11021569
388 Ga0207644_10017489
389 Ga0207706_10068479
390 Ga0207686_10376367
391 Ga0207665_10440498
392 Ga0207711_10004298
393 Ga0207661_10043833
394 Ga0207661_10076394
395 Ga0207667_10010351
396 Ga0207667_10226760
397 Ga0207667_10515506
398 Ga0207712_10260243
399 Ga0207668_10174095
400 Ga0207640_10067970
401 Ga0207677_10015055
402 Ga0207703_10123059
403 Ga0207639_10393953
404 Ga0207678_10108365
405 Ga0207702_10012920
406 Ga0207702_10099118
407 Ga0207641_10523980
408 Ga0207648_10127853
409 Ga0207674_10000232
410 Ga0207675_101419665
411 Ga0207683_10001989
412 Ga0207698_10127532
413 Ga0207698_10136038
414 Ga0207698_11195340
415 Ga0209588_1040151
416 Ga0209588_1052812
417 Ga0268266_10030801
418 Ga0268266_10629347
419 Ga0265338_10102530
420 Ga0265762_1000388
421 Ga0265763_1006053
422 Ga0265773_1004887
423 Ga0265760_10032603
424 Ga0265760_10158159
425 Ga0265325_10076599
426 Ga0265314_10081494
427 Ga0436361_0516054
428 Ga0453683_0000801
429 Ga0466963_0001443
430 Ga0453684_0154823
431 Ga0451576_0443762
432 Ga0466967_0000243
433 Ga0495638_0006660
434 Ga0495650_0173763
435 Ga0495643_0000074
436 Ga0495587_0201779
437 Ga0495667_0355831
438 Ga0495599_0023630
439 Ga0495674_0056299
440 Ga0495674_0144748
441 Ga0495672_0083395
442 Ga0495686_0000002
443 Ga0495602_0645888
444 Ga0496106_0352130
445 Ga0496115_0086481
446 Ga0496115_0313116
447 Ga0496126_0003251
448 Ga0496126_0025567
449 Ga0496126_0038289
450 Ga0501219_012240
451 Ga0501083_0281983
452 nmdc:mga08y16_187719_c1
453 Ga0500641_0013568
454 Ga0500555_000123
455 Ga0500592_005670
456 Ga0500595_049274
457 Ga0500637_0365970
458 Ga0500645_000021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

13

58

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ppb-assembly1.cif.gz_B crystal structure of a putative tetr family transcription regulator (shew_3104) from shewanella sp. pv-4 at 2.10 a resolution 0.8845 9 189
3pas-assembly1.cif.gz_A crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution 0.8746 6 189
4me9-assembly1.cif.gz_B crystal structure of a transcriptional regulator, tetr family (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution 0.8643 9 188
3ppb-assembly1.cif.gz_B crystal structure of a putative tetr family transcription regulator (shew_3104) from shewanella sp. pv-4 at 2.10 a resolution 0.85 9 189
3pas-assembly1.cif.gz_A crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution 0.8406 6 189
ID Description Score Start End Superfamily
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.957 9 57 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9556 9 57 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9545 9 57 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9525 6 57 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9475 12 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1G7P786-F1-model_v4 DNA-binding transcriptional regulator, AcrR family 0.9614 1 189 GO:0003677
AF-H1S782-F1-model_v4 TetR family transcriptional regulator 0.9586 28 188 GO:0003677
AF-A0A560EII9-F1-model_v4 TetR family transcriptional regulator 0.9574 1 188 GO:0003677
AF-A0A4R1MFZ3-F1-model_v4 deleted 0.955 1 188
AF-A0A1H8MMS9-F1-model_v4 deleted 0.955 1 188

Map