F341420

General Info

Members Datasets Scaffolds Average Seq Length
228 170 217 287

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0168257|Ga0501047_0168257_628_1653
Length 341
Sequence LRSVAERVPGGLDGPGLLTFARVANGSFILCRSWARRYTPTPAFIEQGNAMTRDLQTDIANVFSRMELNRRRMMASSLAAAGFALAVQPIGAATITTDTDGLDAGDVKIPVGDETIPGYRAMPAKGGPFPVILVVQEIFGVHEHIKDICRRFAKLGYFAIAPELYYRQGDVSKLKSIDEIRPIVAKVPDEQVMGDLDAAVELAQKSGKGDVAKLGITGFCWGGRIVWLYAAHSKQLKAGVAWYGRLVGEPSENQPKHPIDIAADLNAPVLGLYGGKDQGIPLDTIEQMRAALKKAKVASEIVVFPNSPHAFFADYRPSYVEADARDAWQKALAWFKKNGVV

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
3 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
4 2831426010 Nostoc sp. 106C Isolate Unclassified
5 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
6 2849660919 Nostoc sp. T09 Isolate Unclassified
7 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
8 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
9 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
10 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
162 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
163 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
167 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.09
Nodule 0.44
Rhizoplane 3.07
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 8.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100000007 3300005331 Bacteria 318672
2 Ga0070670_100254840 3300005331 Bacteria 1529
3 Ga0070680_100000332 3300005336 Bacteria 31618
4 Ga0070680_100182830 3300005336 Bacteria 1766
5 Ga0070661_100000476 3300005344 Bacteria 30589
6 Ga0070668_100003206 3300005347 Bacteria 12052
7 Ga0070668_100004735 3300005347 Bacteria 10092
8 Ga0070669_100036979 3300005353 Bacteria 3540
9 Ga0070669_100434957 3300005353 Bacteria 1079
10 Ga0070671_100009160 3300005355 Bacteria 7948
11 Ga0070667_100000291 3300005367 Bacteria 56512
12 Ga0070667_100004267 3300005367 Bacteria 12069
13 Ga0070667_100313200 3300005367 Bacteria 1415
14 Ga0070711_100025722 3300005439 Bacteria 3853
15 Ga0070705_100052330 3300005440 Bacteria 2385
16 Ga0070708_100001584 3300005445 Bacteria 17434
17 Ga0070663_100149899 3300005455 Bacteria 1788
18 Ga0070681_10000123 3300005458 Bacteria 57938
19 Ga0070706_100000006 3300005467 Bacteria 262251
20 Ga0070706_100671911 3300005467 Bacteria 961
21 Ga0070707_100009448 3300005468 Bacteria 9052
22 Ga0070679_100000490 3300005530 Bacteria 33743
23 Ga0070697_100005910 3300005536 Bacteria 9448
24 Ga0070697_100071343 3300005536 Bacteria 2849
25 Ga0070695_100035137 3300005545 Bacteria 3147
26 Ga0070696_100161637 3300005546 Bacteria 1650
27 Ga0070665_100000395 3300005548 Bacteria 64323
28 Ga0070665_100011602 3300005548 Bacteria 8909
29 Ga0068855_100152766 3300005563 Bacteria 2624
30 Ga0068855_100248925 3300005563 Bacteria 1983
31 Ga0070664_100008373 3300005564 Bacteria 8361
32 Ga0068854_100276914 3300005578 Bacteria 1349
33 Ga0068856_100292370 3300005614 Bacteria 1646
34 Ga0068859_100022849 3300005617 Bacteria 6271
35 Ga0068864_100002407 3300005618 Bacteria 15450
36 Ga0068864_100003084 3300005618 Bacteria 13759
37 Ga0068864_100076177 3300005618 Bacteria 2930
38 Ga0068864_100155702 3300005618 Bacteria 2074
39 Ga0068863_100000262 3300005841 Bacteria 55027
40 Ga0068863_100003720 3300005841 Bacteria 15086
41 Ga0068863_100065050 3300005841 Bacteria 3449
42 Ga0068858_100001577 3300005842 Bacteria 23351
43 Ga0068858_100027494 3300005842 Bacteria 5284
44 Ga0068860_100000047 3300005843 Bacteria 213287
45 Ga0068862_100068594 3300005844 Bacteria 3059
46 Ga0068862_100105618 3300005844 Bacteria 2468
47 Ga0075368_10049671 3300006042 Bacteria 1665
48 Ga0075364_10003612 3300006051 Bacteria 8817
49 Ga0075367_10012470 3300006178 Bacteria 4534
50 Ga0097620_100022849 3300006931 Bacteria 6271
51 Ga0099826_10103783 3300006948 Bacteria 1708
52 Ga0105240_10000314 3300009093 Bacteria 93043
53 Ga0105242_10009784 3300009176 Bacteria 7348
54 Ga0105248_10001254 3300009177 Bacteria 28372
55 Ga0105248_10001682 3300009177 Bacteria 24633
56 Ga0105248_10014621 3300009177 Bacteria 8636
57 Ga0105248_10075059 3300009177 Bacteria 3800
58 Ga0105248_10075205 3300009177 Bacteria 3796
59 Ga0105238_10003146 3300009551 Bacteria 16471
60 Ga0105249_10002418 3300009553 Bacteria 16212
61 Ga0105239_10102783 3300010375 Bacteria 3163
62 Ga0157375_10089558 3300013308 Bacteria 3134
63 Ga0163163_10065138 3300014325 Bacteria 3616
64 Ga0157379_10172728 3300014968 Bacteria 1951
65 Ga0213876_10000344 3300021384 Bacteria 40281
66 Ga0213876_10089516 3300021384 Bacteria 1630
67 Ga0207697_10103779 3300025315 Bacteria 1213
68 Ga0207680_10048654 3300025903 Bacteria 2520
69 Ga0207684_10000004 3300025910 Bacteria 755956
70 Ga0207707_10000002 3300025912 Bacteria 1142054
71 Ga0207695_10000012 3300025913 Bacteria 840961
72 Ga0207695_10405494 3300025913 Bacteria 1248
73 Ga0207663_10029013 3300025916 Bacteria 3245
74 Ga0207660_10001354 3300025917 Bacteria 16430
75 Ga0207649_10000060 3300025920 Bacteria 99202
76 Ga0207652_10002287 3300025921 Bacteria 16253
77 Ga0207646_10040798 3300025922 Bacteria 4173
78 Ga0207694_10000006 3300025924 Bacteria 631109
79 Ga0207650_10000033 3300025925 Bacteria 226809
80 Ga0207650_10043346 3300025925 Bacteria 3302
81 Ga0207659_10069847 3300025926 Bacteria 2560
82 Ga0207644_10022140 3300025931 Bacteria 4339
83 Ga0207686_10009190 3300025934 Bacteria 5360
84 Ga0207711_10000764 3300025941 Bacteria 31611
85 Ga0207711_10012738 3300025941 Bacteria 6986
86 Ga0207711_10019415 3300025941 Bacteria 5661
87 Ga0207711_10038284 3300025941 Bacteria 4077
88 Ga0207711_10060581 3300025941 Bacteria 3262
89 Ga0207667_10000026 3300025949 Bacteria 343713
90 Ga0207667_10119159 3300025949 Bacteria 2720
91 Ga0207667_10302310 3300025949 Bacteria 1635
92 Ga0207712_10001293 3300025961 Bacteria 17165
93 Ga0207668_10000013 3300025972 Bacteria 167989
94 Ga0207668_10001021 3300025972 Bacteria 16758
95 Ga0207640_10324623 3300025981 Bacteria 1227
96 Ga0207658_10000323 3300025986 Bacteria 48151
97 Ga0207658_10002054 3300025986 Bacteria 15002
98 Ga0207658_10109816 3300025986 Bacteria 2178
99 Ga0207703_10000027 3300026035 Bacteria 209608
100 Ga0207639_10001316 3300026041 Bacteria 16801
101 Ga0207702_10205488 3300026078 Bacteria 1828
102 Ga0207641_10000003 3300026088 Bacteria 496984
103 Ga0207641_10004327 3300026088 Bacteria 12331
104 Ga0207648_10291406 3300026089 Bacteria 1461
105 Ga0207676_10000135 3300026095 Bacteria 64914
106 Ga0207676_10000203 3300026095 Bacteria 51550
107 Ga0207676_10044481 3300026095 Bacteria 3426
108 Ga0207676_10101855 3300026095 Bacteria 2382
109 Ga0207698_10013720 3300026142 Bacteria 5359
110 Ga0268266_10003032 3300028379 Bacteria 17238
111 Ga0268266_10011732 3300028379 Bacteria 7602
112 Ga0268266_10274177 3300028379 Bacteria 1567
113 Ga0268265_10008654 3300028380 Bacteria 6877
114 Ga0268265_10038495 3300028380 Bacteria 3518
115 Ga0268264_10000032 3300028381 Bacteria 408337
116 Ga0265330_10033816 3300031235 Bacteria 2285
117 Ga0265325_10012015 3300031241 Bacteria 4961
118 Ga0265325_10093232 3300031241 Bacteria 1482
119 Ga0265339_10020912 3300031249 Bacteria 3816
120 Ga0265331_10000049 3300031250 Bacteria 182618
121 Ga0265331_10000303 3300031250 Bacteria 53811
122 Ga0265327_10000007 3300031251 Bacteria 678515
123 Ga0265314_10002708 3300031711 Bacteria 17734
124 Ga0265314_10111744 3300031711 Bacteria 1735
125 Ga0307413_10206572 3300031824 Bacteria 1423
126 Ga0307407_10245441 3300031903 Bacteria 1224
127 Ga0307415_100244489 3300032126 Bacteria 1454
128 Ga0307510_10072572 3300033180 Bacteria 3419
129 Ga0373934_0194642 3300035086 Bacteria 834
130 Ga0373954_0131537 3300035118 Bacteria 1218
131 Ga0373937_0000338 3300036401 Bacteria 44355
132 Ga0395905_0388120 3300037471 Bacteria 1291
133 Ga0436364_1466000 3300037853 Bacteria 1855
134 Ga0436365_0105608 3300039437 Bacteria 3153
135 Ga0436365_1653371 3300039437 Bacteria 7140
136 Ga0436361_0203198 3300039447 Bacteria 3815
137 Ga0436363_1148710 3300039450 Bacteria 1067
138 Ga0451853_1626336 3300041512 Bacteria 1255
139 Ga0451577_0126124 3300042876 Bacteria 2294
140 Ga0451577_0208890 3300042876 Bacteria 1763
141 Ga0453684_0868618 3300044712 Bacteria 968
142 Ga0451576_0631048 3300045051 Bacteria 1126
143 Ga0451576_0645781 3300045051 Bacteria 1112
144 Ga0466967_0325870 3300045976 Bacteria 1482
145 Ga0495629_0159992 3300046459 Bacteria 1564
146 Ga0495580_0103750 3300046472 Bacteria 1976
147 Ga0495620_0053019 3300046515 Bacteria 1719
148 Ga0495643_0077805 3300046522 Bacteria 1732
149 Ga0495609_0104510 3300046538 Bacteria 1225
150 Ga0495597_0020593 3300046542 Bacteria 3070
151 Ga0495622_0012894 3300046557 Bacteria 3876
152 Ga0495668_0077728 3300046616 Bacteria 1822
153 Ga0495625_0247111 3300046660 Bacteria 1159
154 Ga0495669_0000007 3300046684 Bacteria 180797
155 Ga0495624_0165260 3300046690 Bacteria 1351
156 Ga0495649_0124690 3300046694 Bacteria 1361
157 Ga0495581_0061052 3300047315 Bacteria 2178
158 Ga0495672_0049657 3300047320 Bacteria 2482
159 Ga0495686_0195172 3300047472 Bacteria 1165
160 Ga0495593_0030418 3300047673 Bacteria 2955
161 Ga0496102_0170563 3300048905 Bacteria 2048
162 Ga0496102_0242979 3300048905 Bacteria 1697
163 Ga0496103_0191363 3300048906 Bacteria 1315
164 Ga0496105_0107221 3300048908 Bacteria 2306
165 Ga0496111_0086687 3300048914 Bacteria 2291
166 Ga0496112_0008913 3300048915 Bacteria 9004
167 Ga0496112_0350311 3300048915 Bacteria 1419
168 Ga0496117_0033711 3300048920 Bacteria 3868
169 Ga0496119_0012009 3300048922 Bacteria 7088
170 Ga0496121_0000042 3300048924 Bacteria 342304
171 Ga0495682_0001595 3300049460 Bacteria 11765
172 Ga0501032_0180721 3300049569 Bacteria 1381
173 Ga0501033_0020401 3300049570 Bacteria 5006
174 Ga0501034_0165332 3300049571 Bacteria 2181
175 Ga0501034_0405116 3300049571 Bacteria 1286
176 Ga0501043_0046194 3300049579 Bacteria 3424
177 Ga0501046_0010751 3300049580 Bacteria 7849
178 Ga0501047_0168257 3300049581 Bacteria 2062
179 Ga0501047_0229568 3300049581 Bacteria 1710
180 Ga0501047_0315276 3300049581 Bacteria 1404
181 Ga0501070_0175258 3300049586 Bacteria 1766
182 Ga0501073_0130265 3300049589 Bacteria 1743
183 Ga0501074_0154900 3300049590 Bacteria 1637
184 Ga0501249_005405 3300049679 Bacteria 2612
185 Ga0501261_002922 3300049690 Bacteria 2099
186 Ga0501080_0013714 3300049742 Bacteria 7461
187 Ga0501080_0106743 3300049742 Bacteria 2595
188 Ga0501035_0043431 3300049822 Bacteria 4051
189 Ga0501035_0088300 3300049822 Bacteria 2732
190 Ga0501044_0072697 3300049823 Bacteria 3496
191 Ga0501044_0079872 3300049823 Bacteria 3313
192 nmdc:mga00v17_969_c1 3300050491 Bacteria 15356
193 nmdc:mga05p37_475085_c1 3300050507 Bacteria 1441
194 Ga0500635_0000123 3300053080 Bacteria 45690
195 Ga0500583_0099450 3300053092 Bacteria 1423
196 Ga0500651_0024727 3300053093 Bacteria 3766
197 Ga0500566_0015447 3300053094 Bacteria 4482
198 Ga0500555_005639 3300053103 Bacteria 3553
199 Ga0500569_007624 3300053109 Bacteria 2438
200 Ga0500595_014289 3300053119 Bacteria 3017
201 Ga0500607_039695 3300053121 Bacteria 2554
202 Ga0500608_002390 3300053122 Bacteria 6822
203 Ga0500614_002023 3300053123 Bacteria 4637
204 Ga0500559_0035936 3300053136 Bacteria 2141
205 Ga0500590_161897 3300053148 Bacteria 995
206 Ga0500603_031978 3300053150 Bacteria 1362
207 Ga0500619_002622 3300053154 Bacteria 3505
208 Ga0500622_0001282 3300053156 Bacteria 20460
209 Ga0500622_0002227 3300053156 Bacteria 14279
210 Ga0500636_0064815 3300053177 Bacteria 2127
211 Ga0500637_0082600 3300053178 Bacteria 1856
212 Ga0500596_000331 3300053735 Bacteria 8515
213 Ga0501084_0000160 3300054114 Bacteria 51877
214 Ga0501084_0170480 3300054114 Bacteria 1837
215 Ga0501082_0120830 3300060353 Bacteria 2271
216 Ga0501082_0222129 3300060353 Bacteria 1644
217 Ga0501082_0418807 3300060353 Bacteria 1170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0180721 Ga0501032_0180721_653_1369 235
2 3300031235 Ga0265330_10033816 Ga0265330_100338161 254
3 3300035086 Ga0373934_0194642 Ga0373934_0194642_33_809 257
4 3300006042 Ga0075368_10049671 Ga0075368_100496711 260
5 3300006051 Ga0075364_10003612 Ga0075364_1000361211 260
6 3300006178 Ga0075367_10012470 Ga0075367_100124702 260
7 3300050491 nmdc:mga00v17_969_c1 nmdc:mga00v17_969_c1_14343_15275 260
8 3300005440 Ga0070705_100052330 Ga0070705_1000523303 265
9 3300005545 Ga0070695_100035137 Ga0070695_1000351374 265
10 3300005546 Ga0070696_100161637 Ga0070696_1001616371 265
11 3300042876 Ga0451577_0126124 Ga0451577_0126124_951_1841 265
12 3300049690 Ga0501261_002922 Ga0501261_002922_803_1741 268
13 3300046660 Ga0495625_0247111 Ga0495625_0247111_192_1043 269
14 3300046684 Ga0495669_0000007 Ga0495669_0000007_130836_131687 269
15 iso_pu_bacteria 2831426010 2831432728 271
16 iso_pu_bacteria 2848694841 2848700847 271
17 iso_pu_bacteria 2849660919 2849668227 271
18 iso_pu_bacteria 2913844669 2913850911 271
19 iso_pu_bacteria 2913912277 2913915405 271
20 iso_pu_bacteria 642555144 642600586 271
21 3300045051 Ga0451576_0631048 Ga0451576_0631048_35_916 272
22 3300045976 Ga0466967_0325870 Ga0466967_0325870_642_1463 272
23 3300046472 Ga0495580_0103750 Ga0495580_0103750_484_1329 272
24 iso_pu_bacteria 2886627955 2886628678 272
25 3300005336 Ga0070680_100000332 Ga0070680_10000033226 276
26 3300005458 Ga0070681_10000123 Ga0070681_1000012326 276
27 3300005530 Ga0070679_100000490 Ga0070679_10000049014 276
28 3300009093 Ga0105240_10000314 Ga0105240_1000031479 276
29 3300009176 Ga0105242_10009784 Ga0105242_100097843 276
30 3300009551 Ga0105238_10003146 Ga0105238_1000314610 276
31 3300010375 Ga0105239_10102783 Ga0105239_101027833 276
32 3300025912 Ga0207707_10000002 Ga0207707_1000000239 276
33 3300025913 Ga0207695_10000012 Ga0207695_1000001280 276
34 3300025913 Ga0207695_10405494 Ga0207695_104054942 276
35 3300025917 Ga0207660_10001354 Ga0207660_100013547 276
36 3300025921 Ga0207652_10002287 Ga0207652_100022873 276
37 3300025924 Ga0207694_10000006 Ga0207694_10000006580 276
38 3300025934 Ga0207686_10009190 Ga0207686_100091902 276
39 3300025949 Ga0207667_10000026 Ga0207667_10000026313 276
40 3300026041 Ga0207639_10001316 Ga0207639_1000131617 276
41 3300026142 Ga0207698_10013720 Ga0207698_100137204 276
42 3300049460 Ga0495682_0001595 Ga0495682_0001595_876_1718 276
43 3300049742 Ga0501080_0013714 Ga0501080_0013714_4668_5513 276
44 3300054114 Ga0501084_0000160 Ga0501084_0000160_10929_11771 276
45 3300060353 Ga0501082_0222129 Ga0501082_0222129_71_937 276
46 3300049589 Ga0501073_0130265 Ga0501073_0130265_310_1158 278
47 3300049590 Ga0501074_0154900 Ga0501074_0154900_197_1045 278
48 3300054114 Ga0501084_0170480 Ga0501084_0170480_239_1087 278
49 3300005367 Ga0070667_100313200 Ga0070667_1003132002 279
50 3300005563 Ga0068855_100248925 Ga0068855_1002489252 279
51 3300009177 Ga0105248_10014621 Ga0105248_100146215 279
52 3300021384 Ga0213876_10089516 Ga0213876_100895162 279
53 3300025941 Ga0207711_10012738 Ga0207711_100127382 279
54 3300025949 Ga0207667_10302310 Ga0207667_103023102 279
55 3300025986 Ga0207658_10109816 Ga0207658_101098162 279
56 3300031249 Ga0265339_10020912 Ga0265339_100209124 279
57 3300031711 Ga0265314_10111744 Ga0265314_101117441 279
58 3300035118 Ga0373954_0131537 Ga0373954_0131537_352_1197 279
59 3300039437 Ga0436365_0105608 Ga0436365_0105608_589_1446 279
60 3300049679 Ga0501249_005405 Ga0501249_005405_1551_2396 279
61 3300005344 Ga0070661_100000476 Ga0070661_10000047618 280
62 3300005439 Ga0070711_100025722 Ga0070711_1000257222 280
63 3300025916 Ga0207663_10029013 Ga0207663_100290132 280
64 3300025920 Ga0207649_10000060 Ga0207649_1000006094 280
65 3300026078 Ga0207702_10205488 Ga0207702_102054882 280
66 3300031241 Ga0265325_10093232 Ga0265325_100932321 280
67 3300031250 Ga0265331_10000049 Ga0265331_1000004957 280
68 3300031250 Ga0265331_10000303 Ga0265331_1000030330 280
69 3300031251 Ga0265327_10000007 Ga0265327_10000007409 280
70 3300031711 Ga0265314_10002708 Ga0265314_1000270816 280
71 3300036401 Ga0373937_0000338 Ga0373937_0000338_38858_39715 280
72 3300039450 Ga0436363_1148710 Ga0436363_1148710_200_1054 280
73 3300049571 Ga0501034_0165332 Ga0501034_0165332_1180_2034 280
74 3300049571 Ga0501034_0405116 Ga0501034_0405116_215_1075 280
75 3300049579 Ga0501043_0046194 Ga0501043_0046194_2209_3063 280
76 3300049580 Ga0501046_0010751 Ga0501046_0010751_3660_4514 280
77 3300049581 Ga0501047_0315276 Ga0501047_0315276_350_1204 280
78 3300049742 Ga0501080_0106743 Ga0501080_0106743_22_876 280
79 3300049822 Ga0501035_0043431 Ga0501035_0043431_230_1084 280
80 3300049823 Ga0501044_0079872 Ga0501044_0079872_1105_1959 280
81 iso_pu_bacteria 2829745981 2829747576 280
82 3300021384 Ga0213876_10000344 Ga0213876_1000034421 282
83 3300039437 Ga0436365_1653371 Ga0436365_1653371_3612_4493 282
84 3300042876 Ga0451577_0208890 Ga0451577_0208890_319_1200 282
85 3300045051 Ga0451576_0645781 Ga0451576_0645781_61_942 282
86 iso_pu_bacteria 2643221598 2643999665 282
87 iso_pu_bacteria 2687453257 2688065899 282
88 3300005336 Ga0070680_100182830 Ga0070680_1001828301 283
89 3300005353 Ga0070669_100434957 Ga0070669_1004349571 283
90 3300044712 Ga0453684_0868618 Ga0453684_0868618_88_957 283
91 3300048915 Ga0496112_0350311 Ga0496112_0350311_537_1403 283
92 3300050507 nmdc:mga05p37_475085_c1 nmdc:mga05p37_475085_c1_184_1053 283
93 3300060353 Ga0501082_0120830 Ga0501082_0120830_388_1257 283
94 iso_pu_bacteria 2889415604 2889421753 283
95 3300005355 Ga0070671_100009160 Ga0070671_1000091606 284
96 3300005536 Ga0070697_100071343 Ga0070697_1000713432 284
97 3300005618 Ga0068864_100155702 Ga0068864_1001557023 284
98 3300005841 Ga0068863_100065050 Ga0068863_1000650502 284
99 3300009177 Ga0105248_10001682 Ga0105248_1000168212 284
100 3300025931 Ga0207644_10022140 Ga0207644_100221403 284
101 3300025941 Ga0207711_10038284 Ga0207711_100382842 284
102 3300026095 Ga0207676_10101855 Ga0207676_101018552 284
103 3300037471 Ga0395905_0388120 Ga0395905_0388120_292_1167 284
104 3300048908 Ga0496105_0107221 Ga0496105_0107221_1048_1920 284
105 3300048914 Ga0496111_0086687 Ga0496111_0086687_689_1561 284
106 3300048915 Ga0496112_0008913 Ga0496112_0008913_2200_3072 284
107 3300049581 Ga0501047_0229568 Ga0501047_0229568_474_1355 284
108 3300049586 Ga0501070_0175258 Ga0501070_0175258_135_1016 284
109 3300005445 Ga0070708_100001584 Ga0070708_10000158410 285
110 3300005467 Ga0070706_100000006 Ga0070706_100000006222 285
111 3300005468 Ga0070707_100009448 Ga0070707_1000094481 285
112 3300005536 Ga0070697_100005910 Ga0070697_1000059109 285
113 3300025910 Ga0207684_10000004 Ga0207684_10000004544 285
114 3300025922 Ga0207646_10040798 Ga0207646_100407984 285
115 3300047472 Ga0495686_0195172 Ga0495686_0195172_163_1026 285
116 3300005564 Ga0070664_100008373 Ga0070664_1000083733 286
117 3300005578 Ga0068854_100276914 Ga0068854_1002769142 286
118 3300025981 Ga0207640_10324623 Ga0207640_103246231 286
119 3300033180 Ga0307510_10072572 Ga0307510_100725724 286
120 3300005467 Ga0070706_100671911 Ga0070706_1006719111 287
121 3300006948 Ga0099826_10103783 Ga0099826_101037832 287
122 3300028379 Ga0268266_10274177 Ga0268266_102741771 287
123 3300031241 Ga0265325_10012015 Ga0265325_100120155 287
124 3300031824 Ga0307413_10206572 Ga0307413_102065721 287
125 3300031903 Ga0307407_10245441 Ga0307407_102454412 287
126 3300032126 Ga0307415_100244489 Ga0307415_1002444891 287
127 3300039447 Ga0436361_0203198 Ga0436361_0203198_2098_2967 287
128 3300041512 Ga0451853_1626336 Ga0451853_1626336_176_1078 287
129 3300046694 Ga0495649_0124690 Ga0495649_0124690_97_969 287
130 3300049581 Ga0501047_0168257 Ga0501047_0168257_628_1653 287
131 3300053156 Ga0500622_0001282 Ga0500622_0001282_12599_13615 287
132 3300053156 Ga0500622_0002227 Ga0500622_0002227_1788_2663 287
133 3300060353 Ga0501082_0418807 Ga0501082_0418807_235_1107 287
134 3300005353 Ga0070669_100036979 Ga0070669_1000369792 288
135 3300005455 Ga0070663_100149899 Ga0070663_1001498991 288
136 3300005563 Ga0068855_100152766 Ga0068855_1001527662 288
137 3300005614 Ga0068856_100292370 Ga0068856_1002923703 288
138 3300005844 Ga0068862_100105618 Ga0068862_1001056182 288
139 3300013308 Ga0157375_10089558 Ga0157375_100895583 288
140 3300025925 Ga0207650_10043346 Ga0207650_100433462 288
141 3300025926 Ga0207659_10069847 Ga0207659_100698472 288
142 3300025949 Ga0207667_10119159 Ga0207667_101191595 288
143 3300026089 Ga0207648_10291406 Ga0207648_102914062 288
144 3300037853 Ga0436364_1466000 Ga0436364_1466000_69_962 288
145 3300047315 Ga0495581_0061052 Ga0495581_0061052_1147_2013 288
146 3300053103 Ga0500555_005639 Ga0500555_005639_2449_3342 288
147 3300005331 Ga0070670_100000007 Ga0070670_1000000077 289
148 3300005331 Ga0070670_100254840 Ga0070670_1002548402 289
149 3300005347 Ga0070668_100003206 Ga0070668_1000032069 289
150 3300005347 Ga0070668_100004735 Ga0070668_1000047353 289
151 3300005367 Ga0070667_100000291 Ga0070667_10000029122 289
152 3300005367 Ga0070667_100004267 Ga0070667_1000042673 289
153 3300005548 Ga0070665_100000395 Ga0070665_10000039530 289
154 3300005548 Ga0070665_100011602 Ga0070665_1000116027 289
155 3300005617 Ga0068859_100022849 Ga0068859_1000228493 289
156 3300005618 Ga0068864_100002407 Ga0068864_10000240714 289
157 3300005618 Ga0068864_100003084 Ga0068864_1000030843 289
158 3300005618 Ga0068864_100076177 Ga0068864_1000761772 289
159 3300005841 Ga0068863_100000262 Ga0068863_10000026264 289
160 3300005841 Ga0068863_100003720 Ga0068863_1000037207 289
161 3300005842 Ga0068858_100001577 Ga0068858_1000015773 289
162 3300005842 Ga0068858_100027494 Ga0068858_1000274943 289
163 3300005843 Ga0068860_100000047 Ga0068860_1000000477 289
164 3300005844 Ga0068862_100068594 Ga0068862_1000685943 289
165 3300006931 Ga0097620_100022849 Ga0097620_1000228497 289
166 3300009177 Ga0105248_10001254 Ga0105248_1000125416 289
167 3300009177 Ga0105248_10075059 Ga0105248_100750593 289
168 3300009177 Ga0105248_10075205 Ga0105248_100752053 289
169 3300009553 Ga0105249_10002418 Ga0105249_1000241814 289
170 3300014325 Ga0163163_10065138 Ga0163163_100651383 289
171 3300014968 Ga0157379_10172728 Ga0157379_101727283 289
172 3300025315 Ga0207697_10103779 Ga0207697_101037792 289
173 3300025903 Ga0207680_10048654 Ga0207680_100486543 289
174 3300025925 Ga0207650_10000033 Ga0207650_1000003388 289
175 3300025941 Ga0207711_10000764 Ga0207711_1000076416 289
176 3300025941 Ga0207711_10019415 Ga0207711_100194153 289
177 3300025941 Ga0207711_10060581 Ga0207711_100605813 289
178 3300025961 Ga0207712_10001293 Ga0207712_1000129313 289
179 3300025972 Ga0207668_10000013 Ga0207668_1000001379 289
180 3300025972 Ga0207668_10001021 Ga0207668_1000102110 289
181 3300025986 Ga0207658_10000323 Ga0207658_1000032352 289
182 3300025986 Ga0207658_10002054 Ga0207658_1000205416 289
183 3300026035 Ga0207703_10000027 Ga0207703_10000027184 289
184 3300026088 Ga0207641_10000003 Ga0207641_10000003184 289
185 3300026088 Ga0207641_10004327 Ga0207641_100043273 289
186 3300026095 Ga0207676_10000135 Ga0207676_100001357 289
187 3300026095 Ga0207676_10000203 Ga0207676_1000020316 289
188 3300026095 Ga0207676_10044481 Ga0207676_100444812 289
189 3300028379 Ga0268266_10003032 Ga0268266_1000303219 289
190 3300028379 Ga0268266_10011732 Ga0268266_100117323 289
191 3300028380 Ga0268265_10008654 Ga0268265_100086542 289
192 3300028380 Ga0268265_10038495 Ga0268265_100384953 289
193 3300028381 Ga0268264_10000032 Ga0268264_10000032421 289
194 3300046459 Ga0495629_0159992 Ga0495629_0159992_521_1390 289
195 3300046515 Ga0495620_0053019 Ga0495620_0053019_48_1025 289
196 3300046522 Ga0495643_0077805 Ga0495643_0077805_557_1426 289
197 3300046538 Ga0495609_0104510 Ga0495609_0104510_149_1018 289
198 3300046542 Ga0495597_0020593 Ga0495597_0020593_17_937 289
199 3300046557 Ga0495622_0012894 Ga0495622_0012894_2734_3603 289
200 3300046616 Ga0495668_0077728 Ga0495668_0077728_73_942 289
201 3300046690 Ga0495624_0165260 Ga0495624_0165260_95_964 289
202 3300047320 Ga0495672_0049657 Ga0495672_0049657_93_1004 289
203 3300047673 Ga0495593_0030418 Ga0495593_0030418_1633_2502 289
204 3300048905 Ga0496102_0170563 Ga0496102_0170563_355_1224 289
205 3300048905 Ga0496102_0242979 Ga0496102_0242979_648_1517 289
206 3300048906 Ga0496103_0191363 Ga0496103_0191363_298_1167 289
207 3300048920 Ga0496117_0033711 Ga0496117_0033711_2194_3063 289
208 3300048922 Ga0496119_0012009 Ga0496119_0012009_1138_2007 289
209 3300048924 Ga0496121_0000042 Ga0496121_0000042_292509_293378 289
210 3300049570 Ga0501033_0020401 Ga0501033_0020401_2484_3380 289
211 3300049822 Ga0501035_0088300 Ga0501035_0088300_800_1696 289
212 3300049823 Ga0501044_0072697 Ga0501044_0072697_1326_2222 289
213 3300053080 Ga0500635_0000123 Ga0500635_0000123_2240_3160 289
214 3300053092 Ga0500583_0099450 Ga0500583_0099450_479_1399 289
215 3300053093 Ga0500651_0024727 Ga0500651_0024727_2636_3505 289
216 3300053094 Ga0500566_0015447 Ga0500566_0015447_584_1453 289
217 3300053109 Ga0500569_007624 Ga0500569_007624_1329_2306 289
218 3300053119 Ga0500595_014289 Ga0500595_014289_262_1131 289
219 3300053121 Ga0500607_039695 Ga0500607_039695_1330_2250 289
220 3300053122 Ga0500608_002390 Ga0500608_002390_1093_1962 289
221 3300053123 Ga0500614_002023 Ga0500614_002023_3533_4402 289
222 3300053136 Ga0500559_0035936 Ga0500559_0035936_1193_2062 289
223 3300053148 Ga0500590_161897 Ga0500590_161897_40_909 289
224 3300053150 Ga0500603_031978 Ga0500603_031978_229_1149 289
225 3300053154 Ga0500619_002622 Ga0500619_002622_839_1708 289
226 3300053177 Ga0500636_0064815 Ga0500636_0064815_550_1470 289
227 3300053178 Ga0500637_0082600 Ga0500637_0082600_231_1151 289
228 3300053735 Ga0500596_000331 Ga0500596_000331_7373_8242 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

116

339

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9472 49 284
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.928 49 284
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8937 54 286
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8852 48 286
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8845 54 286
ID Description Score Start End Superfamily
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9453 49 284 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9258 49 284 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8996 65 286 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8945 52 283 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8832 48 286 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1Q3VSH2-F1-model_v4 Carboxymethylenebutenolidase 0.9679 41 288 GO:0016787
AF-A0A520BRG6-F1-model_v4 Carboxymethylenebutenolidase 0.9672 61 289 GO:0016787
AF-A0A520BRG6-F1-model_v4 Carboxymethylenebutenolidase 0.9631 61 289 GO:0016787
AF-A0A4P5SUH2-F1-model_v4 Carboxymethylenebutenolidase 0.9603 42 288 GO:0016787
AF-A0A1I2VYN5-F1-model_v4 Carboxymethylenebutenolidase 0.9597 48 289 GO:0016787

Feature Viewer

pLDDT pTM Quality
86.9 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map