F341227

General Info

Members Datasets Scaffolds Average Seq Length
228 135 456 216

Family's Representative Sequence

Representative Sequence 3300042001|Ga0439441_001204|Ga0439441_001204_1506_2201
Length 231
Sequence MAARKLRRSIEYDSTVLSLRGVTKRFGARAVLNNVSLDLAAGEYIAIIGESGIGKSTLLNVIAGLEPVDAGEVVFEGQQLTAMDDDALTVLRRDHFGFVFQAFHVLPQLTVEQNVGLPLLLRGIEDEAKTRAMLAAVGLAGREQSAPRELSGGELQRVAIARALVGDPRLVLADEPTGNLDPENARQVLDLFKAQVKTKGAAAILATHSETAAAGCDRRYRLTAQGLAPVT

Samples

Sample ID Description Type Environment
1 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
69 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
70 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
81 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
82 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
83 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
84 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 99.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439441_001204 3300042001 Bacteria 3295
2 JGI25406J46586_10073120 3300003203 Bacteria 1070
3 Ga0065707_10171282 3300005295 Bacteria 1482
4 Ga0065707_10399333 3300005295 Bacteria 821
5 Ga0070676_10106566 3300005328 Bacteria 1739
6 Ga0068869_100085254 3300005334 Bacteria 2366
7 Ga0070680_100081102 3300005336 Bacteria 2677
8 Ga0070689_100363278 3300005340 Bacteria 1217
9 Ga0070691_10019935 3300005341 Bacteria 3096
10 Ga0070687_100029518 3300005343 Bacteria 2671
11 Ga0070687_100038247 3300005343 Bacteria 2404
12 Ga0070692_10053370 3300005345 Bacteria 2108
13 Ga0070692_10114167 3300005345 Bacteria 1498
14 Ga0070688_100107588 3300005365 Bacteria 1849
15 Ga0070711_100416147 3300005439 Bacteria 1094
16 Ga0070705_100118037 3300005440 Bacteria 1708
17 Ga0070705_100257414 3300005440 Bacteria 1229
18 Ga0070700_100340930 3300005441 Bacteria 1108
19 Ga0070700_100369916 3300005441 Bacteria 1069
20 Ga0070700_100632152 3300005441 Bacteria 843
21 Ga0070694_100004547 3300005444 Bacteria 8340
22 Ga0070694_100150978 3300005444 Bacteria 1697
23 Ga0070694_100299707 3300005444 Bacteria 1231
24 Ga0070694_100630228 3300005444 Bacteria 866
25 Ga0070681_10031164 3300005458 Bacteria 5352
26 Ga0068867_100336377 3300005459 Bacteria 1256
27 Ga0070679_100250168 3300005530 Bacteria 1729
28 Ga0070697_100033509 3300005536 Bacteria 4137
29 Ga0070697_100041977 3300005536 Bacteria 3702
30 Ga0070686_100164149 3300005544 Bacteria 1566
31 Ga0070695_100082746 3300005545 Bacteria 2125
32 Ga0070695_100287739 3300005545 Bacteria 1210
33 Ga0070696_100010795 3300005546 Bacteria 6119
34 Ga0070696_100108458 3300005546 Bacteria 1997
35 Ga0070696_100312384 3300005546 Bacteria 1207
36 Ga0070696_100332149 3300005546 Bacteria 1173
37 Ga0070704_100007971 3300005549 Bacteria 6325
38 Ga0070704_100183576 3300005549 Bacteria 1675
39 Ga0070704_100199075 3300005549 Bacteria 1616
40 Ga0070704_100207376 3300005549 Bacteria 1586
41 Ga0070702_100009749 3300005615 Bacteria 4710
42 Ga0068859_100004089 3300005617 Bacteria 14880
43 Ga0068859_100392182 3300005617 Bacteria 1484
44 Ga0068861_100369572 3300005719 Bacteria 1264
45 Ga0068870_10236929 3300005840 Bacteria 1125
46 Ga0068862_100085403 3300005844 Bacteria 2743
47 Ga0081539_10000332 3300005985 Bacteria 104677
48 Ga0070715_10109934 3300006163 Bacteria 1299
49 Ga0075428_100135731 3300006844 Bacteria 2675
50 Ga0075428_100186941 3300006844 Bacteria 2241
51 Ga0075428_100315794 3300006844 Bacteria 1679
52 Ga0075428_100596902 3300006844 Bacteria 1179
53 Ga0075430_100016893 3300006846 Bacteria 6216
54 Ga0075430_100126923 3300006846 Bacteria 2126
55 Ga0075430_100257155 3300006846 Bacteria 1446
56 Ga0075430_100302311 3300006846 Bacteria 1323
57 Ga0075431_100000927 3300006847 Bacteria 25885
58 Ga0075431_100472603 3300006847 Bacteria 1247
59 Ga0075433_10102647 3300006852 Bacteria 2533
60 Ga0075433_10356223 3300006852 Bacteria 1293
61 Ga0075433_10524468 3300006852 Bacteria 1042
62 Ga0075434_100000249 3300006871 Bacteria 37720
63 Ga0075434_100011155 3300006871 Bacteria 8456
64 Ga0075429_100009262 3300006880 Bacteria 8548
65 Ga0075429_100072236 3300006880 Bacteria 3005
66 Ga0075429_100349510 3300006880 Bacteria 1294
67 Ga0075429_100360272 3300006880 Bacteria 1273
68 Ga0075436_100006081 3300006914 Bacteria 8285
69 Ga0075436_100018022 3300006914 Bacteria 4836
70 Ga0075436_100018282 3300006914 Bacteria 4802
71 Ga0075436_100030224 3300006914 Bacteria 3729
72 Ga0097620_100004089 3300006931 Bacteria 14880
73 Ga0097620_100392172 3300006931 Bacteria 1484
74 Ga0075435_100004131 3300007076 Bacteria 9957
75 Ga0075435_100006689 3300007076 Bacteria 8177
76 Ga0075435_100288926 3300007076 Bacteria 1401
77 Ga0099794_10021106 3300007265 Bacteria 2956
78 Ga0111539_10026862 3300009094 Bacteria 7033
79 Ga0111539_10084511 3300009094 Bacteria 3731
80 Ga0111539_10208524 3300009094 Bacteria 2277
81 Ga0111539_10309574 3300009094 Bacteria 1838
82 Ga0111539_10680192 3300009094 Bacteria 1198
83 Ga0111539_10848553 3300009094 Bacteria 1063
84 Ga0114129_10039558 3300009147 Bacteria 6649
85 Ga0114129_10411741 3300009147 Bacteria 1780
86 Ga0114129_11303451 3300009147 Bacteria 900
87 Ga0105243_10083492 3300009148 Bacteria 2614
88 Ga0105249_10126459 3300009553 Bacteria 2435
89 Ga0207645_10092001 3300025907 Bacteria 1951
90 Ga0207707_10023231 3300025912 Bacteria 5425
91 Ga0207663_10178740 3300025916 Bacteria 1514
92 Ga0207662_10053790 3300025918 Bacteria 2399
93 Ga0207652_10255352 3300025921 Bacteria 1581
94 Ga0207646_10340203 3300025922 Bacteria 1356
95 Ga0207664_10081135 3300025929 Bacteria 2638
96 Ga0207670_10016734 3300025936 Bacteria 4415
97 Ga0207670_10128899 3300025936 Bacteria 1850
98 Ga0207670_10424587 3300025936 Bacteria 1067
99 Ga0207669_10113208 3300025937 Bacteria 1824
100 Ga0207708_10043527 3300026075 Bacteria 3421
101 Ga0207708_10057009 3300026075 Bacteria 2980
102 Ga0207708_10241483 3300026075 Bacteria 1453
103 Ga0207708_10289852 3300026075 Bacteria 1328
104 Ga0207708_10322917 3300026075 Bacteria 1260
105 Ga0207708_10655092 3300026075 Bacteria 894
106 Ga0207648_10210522 3300026089 Bacteria 1726
107 Ga0207675_100144724 3300026118 Bacteria 2259
108 Ga0209996_1001922 3300027395 Bacteria 2557
109 Ga0210000_1002331 3300027462 Bacteria 2700
110 Ga0210000_1005877 3300027462 Bacteria 1784
111 Ga0209971_1016255 3300027682 Bacteria 1765
112 Ga0207428_10268916 3300027907 Bacteria 1268
113 Ga0268265_10069662 3300028380 Bacteria 2732
114 Ga0268265_10078607 3300028380 Bacteria 2595
115 Ga0307408_100107148 3300031548 Bacteria 2139
116 Ga0307408_100230296 3300031548 Bacteria 1517
117 Ga0307408_100877225 3300031548 Bacteria 820
118 Ga0316575_10061622 3300031665 Bacteria 1499
119 Ga0316579_10004902 3300031691 Bacteria 5354
120 Ga0307407_10217550 3300031903 Bacteria 1290
121 Ga0307409_100677448 3300031995 Bacteria 1028
122 Ga0307411_10251473 3300032005 Bacteria 1390
123 Ga0316583_10011346 3300032133 Bacteria 3211
124 Ga0316583_10053891 3300032133 Bacteria 1414
125 Ga0373958_0069364 3300034819 Bacteria 779
126 Ga0373939_0046331 3300035114 Bacteria 1331
127 Ga0373954_0000071 3300035118 Bacteria 36140
128 Ga0316574_0010220 3300035398 Bacteria 5292
129 Ga0373931_0059508 3300035691 Bacteria 2055
130 Ga0373933_0006716 3300035724 Bacteria 6270
131 Ga0316582_0025117 3300036647 Bacteria 3573
132 Ga0395900_0109317 3300037418 Bacteria 2840
133 Ga0395898_0203126 3300037466 Bacteria 1891
134 Ga0316581_0010521 3300037588 Bacteria 2568
135 Ga0395901_0033916 3300038443 Bacteria 5271
136 Ga0439443_005117 3300042003 Bacteria 1741
137 Ga0439456_012455 3300042013 Bacteria 1763
138 Ga0439435_0004773 3300042436 Bacteria 2940
139 Ga0439435_0013286 3300042436 Bacteria 2010
140 Ga0439444_0003973 3300042437 Bacteria 2119
141 Ga0439460_0000313 3300042461 Bacteria 10209
142 Ga0451576_0020812 3300045051 Bacteria 7139
143 Ga0451576_0184637 3300045051 Bacteria 2177
144 Ga0466967_0283294 3300045976 Bacteria 1591
145 Ga0495639_0268605 3300046475 Bacteria 846
146 Ga0495662_0008247 3300046476 Bacteria 5132
147 Ga0495608_0024017 3300046511 Bacteria 4172
148 Ga0495608_0444663 3300046511 Bacteria 789
149 Ga0495628_0284035 3300046516 Bacteria 1228
150 Ga0495630_0054767 3300046517 Bacteria 2988
151 Ga0495630_0129614 3300046517 Bacteria 1915
152 Ga0495642_0216138 3300046528 Bacteria 837
153 Ga0495640_0001742 3300046533 Bacteria 17244
154 Ga0495586_0005024 3300046535 Bacteria 7078
155 Ga0495634_0054808 3300046642 Bacteria 2667
156 Ga0495658_0222435 3300046683 Bacteria 1182
157 Ga0495613_0209009 3300046689 Bacteria 1373
158 Ga0495600_0205559 3300046809 Bacteria 1263
159 Ga0495604_0206173 3300047317 Bacteria 1360
160 Ga0495636_0001555 3300047318 Bacteria 8729
161 Ga0495674_0260461 3300047319 Bacteria 1425
162 Ga0495680_0014830 3300047322 Bacteria 6737
163 Ga0495675_0307648 3300047444 Bacteria 940
164 Ga0495684_0376156 3300047471 Bacteria 1003
165 Ga0501036_0065153 3300049572 Bacteria 3084
166 Ga0501036_0067921 3300049572 Bacteria 3016
167 Ga0501038_0039251 3300049574 Bacteria 4142
168 Ga0501039_0030446 3300049575 Bacteria 4162
169 Ga0501039_0036461 3300049575 Bacteria 3795
170 Ga0501039_0133648 3300049575 Bacteria 1947
171 Ga0501040_0023215 3300049576 Bacteria 4158
172 Ga0501040_0030075 3300049576 Bacteria 3667
173 Ga0501040_0035750 3300049576 Bacteria 3370
174 Ga0501041_0097269 3300049577 Bacteria 1820
175 Ga0501042_0024673 3300049578 Bacteria 4219
176 Ga0501042_0059535 3300049578 Bacteria 2727
177 Ga0501046_0124515 3300049580 Bacteria 1959
178 Ga0501048_0049738 3300049582 Bacteria 2987
179 Ga0501067_0028799 3300049583 Bacteria 3078
180 Ga0501071_0141756 3300049587 Bacteria 1790
181 Ga0501072_0007470 3300049588 Bacteria 8293
182 Ga0501072_0138220 3300049588 Bacteria 1943
183 Ga0501075_0003215 3300049591 Bacteria 10931
184 Ga0501076_0004196 3300049592 Bacteria 10202
185 Ga0501076_0216649 3300049592 Bacteria 1565
186 Ga0501076_0412243 3300049592 Bacteria 1111
187 Ga0501077_0053009 3300049593 Bacteria 2575
188 Ga0501077_0129045 3300049593 Bacteria 1603
189 Ga0501079_0041275 3300049741 Bacteria 3561
190 Ga0501079_0357895 3300049741 Bacteria 1144
191 Ga0501080_0128847 3300049742 Bacteria 2343
192 Ga0501080_0353480 3300049742 Bacteria 1326
193 Ga0501081_0008570 3300049743 Bacteria 6644
194 Ga0501035_0132634 3300049822 Bacteria 2171
195 Ga0501045_0035498 3300049824 Bacteria 3620
196 Ga0501045_0045415 3300049824 Bacteria 3198
197 nmdc:mga05p37_2493_c1 3300050507 Bacteria 21412
198 nmdc:mga09592_111630_c1 3300050508 Bacteria 2346
199 nmdc:mga09592_838_c1 3300050508 Bacteria 23869
200 nmdc:mga09592_88353_c1 3300050508 Bacteria 2647
201 nmdc:mga0qj67_377698_c1 3300050509 Bacteria 1145
202 nmdc:mga0qj67_60468_c1 3300050509 Bacteria 3007
203 nmdc:mga0qj67_92906_c1 3300050509 Bacteria 2426
204 nmdc:mga06r32_106121_c1 3300050510 Bacteria 2760
205 nmdc:mga06r32_21624_c1 3300050510 Bacteria 5940
206 nmdc:mga06r32_540669_c1 3300050510 Bacteria 1140
207 nmdc:mga06r32_804269_c1 3300050510 Bacteria 901
208 nmdc:mga08y16_136339_c1 3300050511 Bacteria 2551
209 nmdc:mga08y16_168064_c1 3300050511 Bacteria 2279
210 nmdc:mga08y16_301944_c1 3300050511 Bacteria 1650
211 nmdc:mga08y16_329556_c1 3300050511 Bacteria 1571
212 nmdc:mga08y16_341890_c1 3300050511 Bacteria 1538
213 nmdc:mga0n895_1016_c1 3300050512 Bacteria 20401
214 nmdc:mga0n895_1277333_c1 3300050512 Bacteria 706
215 nmdc:mga0n895_58924_c1 3300050512 Bacteria 3788
216 nmdc:mga0rr50_13124_c1 3300050513 Bacteria 5382
217 nmdc:mga0rr50_29591_c1 3300050513 Bacteria 3866
218 nmdc:mga0rr50_305740_c1 3300050513 Bacteria 1331
219 nmdc:mga08x19_10800_c1 3300050514 Bacteria 5491
220 nmdc:mga08x19_13812_c1 3300050514 Bacteria 4892
221 nmdc:mga08x19_14099_c1 3300050514 Bacteria 4843
222 nmdc:mga08x19_190289_c1 3300050514 Bacteria 1404
223 nmdc:mga08x19_63289_c1 3300050514 Bacteria 2400
224 nmdc:mga0a205_429331_c1 3300050515 Bacteria 1183
225 nmdc:mga0a205_79705_c1 3300050515 Bacteria 3164
226 Ga0500622_0022501 3300053156 Bacteria 3341
227 Ga0501082_0089910 3300060353 Bacteria 2651
228 Ga0530510_0001937 3300061734 Bacteria 14163
229 Ga0439441_001204
230 JGI25406J46586_10073120
231 Ga0065707_10171282
232 Ga0065707_10399333
233 Ga0070676_10106566
234 Ga0068869_100085254
235 Ga0070680_100081102
236 Ga0070689_100363278
237 Ga0070691_10019935
238 Ga0070687_100029518
239 Ga0070687_100038247
240 Ga0070692_10053370
241 Ga0070692_10114167
242 Ga0070688_100107588
243 Ga0070711_100416147
244 Ga0070705_100118037
245 Ga0070705_100257414
246 Ga0070700_100340930
247 Ga0070700_100369916
248 Ga0070700_100632152
249 Ga0070694_100004547
250 Ga0070694_100150978
251 Ga0070694_100299707
252 Ga0070694_100630228
253 Ga0070681_10031164
254 Ga0068867_100336377
255 Ga0070679_100250168
256 Ga0070697_100033509
257 Ga0070697_100041977
258 Ga0070686_100164149
259 Ga0070695_100082746
260 Ga0070695_100287739
261 Ga0070696_100010795
262 Ga0070696_100108458
263 Ga0070696_100312384
264 Ga0070696_100332149
265 Ga0070704_100007971
266 Ga0070704_100183576
267 Ga0070704_100199075
268 Ga0070704_100207376
269 Ga0070702_100009749
270 Ga0068859_100004089
271 Ga0068859_100392182
272 Ga0068861_100369572
273 Ga0068870_10236929
274 Ga0068862_100085403
275 Ga0081539_10000332
276 Ga0070715_10109934
277 Ga0075428_100135731
278 Ga0075428_100186941
279 Ga0075428_100315794
280 Ga0075428_100596902
281 Ga0075430_100016893
282 Ga0075430_100126923
283 Ga0075430_100257155
284 Ga0075430_100302311
285 Ga0075431_100000927
286 Ga0075431_100472603
287 Ga0075433_10102647
288 Ga0075433_10356223
289 Ga0075433_10524468
290 Ga0075434_100000249
291 Ga0075434_100011155
292 Ga0075429_100009262
293 Ga0075429_100072236
294 Ga0075429_100349510
295 Ga0075429_100360272
296 Ga0075436_100006081
297 Ga0075436_100018022
298 Ga0075436_100018282
299 Ga0075436_100030224
300 Ga0097620_100004089
301 Ga0097620_100392172
302 Ga0075435_100004131
303 Ga0075435_100006689
304 Ga0075435_100288926
305 Ga0099794_10021106
306 Ga0111539_10026862
307 Ga0111539_10084511
308 Ga0111539_10208524
309 Ga0111539_10309574
310 Ga0111539_10680192
311 Ga0111539_10848553
312 Ga0114129_10039558
313 Ga0114129_10411741
314 Ga0114129_11303451
315 Ga0105243_10083492
316 Ga0105249_10126459
317 Ga0207645_10092001
318 Ga0207707_10023231
319 Ga0207663_10178740
320 Ga0207662_10053790
321 Ga0207652_10255352
322 Ga0207646_10340203
323 Ga0207664_10081135
324 Ga0207670_10016734
325 Ga0207670_10128899
326 Ga0207670_10424587
327 Ga0207669_10113208
328 Ga0207708_10043527
329 Ga0207708_10057009
330 Ga0207708_10241483
331 Ga0207708_10289852
332 Ga0207708_10322917
333 Ga0207708_10655092
334 Ga0207648_10210522
335 Ga0207675_100144724
336 Ga0209996_1001922
337 Ga0210000_1002331
338 Ga0210000_1005877
339 Ga0209971_1016255
340 Ga0207428_10268916
341 Ga0268265_10069662
342 Ga0268265_10078607
343 Ga0307408_100107148
344 Ga0307408_100230296
345 Ga0307408_100877225
346 Ga0316575_10061622
347 Ga0316579_10004902
348 Ga0307407_10217550
349 Ga0307409_100677448
350 Ga0307411_10251473
351 Ga0316583_10011346
352 Ga0316583_10053891
353 Ga0373958_0069364
354 Ga0373939_0046331
355 Ga0373954_0000071
356 Ga0316574_0010220
357 Ga0373931_0059508
358 Ga0373933_0006716
359 Ga0316582_0025117
360 Ga0395900_0109317
361 Ga0395898_0203126
362 Ga0316581_0010521
363 Ga0395901_0033916
364 Ga0439443_005117
365 Ga0439456_012455
366 Ga0439435_0004773
367 Ga0439435_0013286
368 Ga0439444_0003973
369 Ga0439460_0000313
370 Ga0451576_0020812
371 Ga0451576_0184637
372 Ga0466967_0283294
373 Ga0495639_0268605
374 Ga0495662_0008247
375 Ga0495608_0024017
376 Ga0495608_0444663
377 Ga0495628_0284035
378 Ga0495630_0054767
379 Ga0495630_0129614
380 Ga0495642_0216138
381 Ga0495640_0001742
382 Ga0495586_0005024
383 Ga0495634_0054808
384 Ga0495658_0222435
385 Ga0495613_0209009
386 Ga0495600_0205559
387 Ga0495604_0206173
388 Ga0495636_0001555
389 Ga0495674_0260461
390 Ga0495680_0014830
391 Ga0495675_0307648
392 Ga0495684_0376156
393 Ga0501036_0065153
394 Ga0501036_0067921
395 Ga0501038_0039251
396 Ga0501039_0030446
397 Ga0501039_0036461
398 Ga0501039_0133648
399 Ga0501040_0023215
400 Ga0501040_0030075
401 Ga0501040_0035750
402 Ga0501041_0097269
403 Ga0501042_0024673
404 Ga0501042_0059535
405 Ga0501046_0124515
406 Ga0501048_0049738
407 Ga0501067_0028799
408 Ga0501071_0141756
409 Ga0501072_0007470
410 Ga0501072_0138220
411 Ga0501075_0003215
412 Ga0501076_0004196
413 Ga0501076_0216649
414 Ga0501076_0412243
415 Ga0501077_0053009
416 Ga0501077_0129045
417 Ga0501079_0041275
418 Ga0501079_0357895
419 Ga0501080_0128847
420 Ga0501080_0353480
421 Ga0501081_0008570
422 Ga0501035_0132634
423 Ga0501045_0035498
424 Ga0501045_0045415
425 nmdc:mga05p37_2493_c1
426 nmdc:mga09592_111630_c1
427 nmdc:mga09592_838_c1
428 nmdc:mga09592_88353_c1
429 nmdc:mga0qj67_377698_c1
430 nmdc:mga0qj67_60468_c1
431 nmdc:mga0qj67_92906_c1
432 nmdc:mga06r32_106121_c1
433 nmdc:mga06r32_21624_c1
434 nmdc:mga06r32_540669_c1
435 nmdc:mga06r32_804269_c1
436 nmdc:mga08y16_136339_c1
437 nmdc:mga08y16_168064_c1
438 nmdc:mga08y16_301944_c1
439 nmdc:mga08y16_329556_c1
440 nmdc:mga08y16_341890_c1
441 nmdc:mga0n895_1016_c1
442 nmdc:mga0n895_1277333_c1
443 nmdc:mga0n895_58924_c1
444 nmdc:mga0rr50_13124_c1
445 nmdc:mga0rr50_29591_c1
446 nmdc:mga0rr50_305740_c1
447 nmdc:mga08x19_10800_c1
448 nmdc:mga08x19_13812_c1
449 nmdc:mga08x19_14099_c1
450 nmdc:mga08x19_190289_c1
451 nmdc:mga08x19_63289_c1
452 nmdc:mga0a205_429331_c1
453 nmdc:mga0a205_79705_c1
454 Ga0500622_0022501
455 Ga0501082_0089910
456 Ga0530510_0001937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

32

178

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9488 2 215
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9452 2 214
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.9408 2 216
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9408 2 212
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.94 2 213
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9372 2 214 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9316 1 212 3.40.50.300
af_Q1RS86_1791_2054_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9299 2 216 3.40.50.300
af_A1ZBS3_470_698_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9297 1 212 3.40.50.300
af_P16679_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 1 207 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N2UGJ9-F1-model_v4 deleted 0.9883 2 213
AF-A0A4Q3RCR8-F1-model_v4 deleted 0.9857 2 216
AF-A0A2S9K6G4-F1-model_v4 ABC transporter ATP-binding protein 0.9856 2 215 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7V4A1Q5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9837 1 178 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A480AKC3-F1-model_v4 ABC transporter ATP-binding protein 0.9825 2 215 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map