F341015

General Info

Members Datasets Scaffolds Average Seq Length
228 162 456 320

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10077810|Ga0213875_100778102
Length 365
Sequence MEFAGRQAACSRPACGVSRLLKPRRRECRRETGKPFANYVGVPTLIVLMEPALNAPRLIGDIGGTNARFAIAQGGKYGQLKHVETEHYPSLHDALAEYLKTRPQGELSGALAIAGPVLGDRISLTNKAWSFSVEDLKQSLRLTALTVVNDFAATAQAIPHLSPQQKFAIGPAIANAGGNIGVVGPGTGLGMSSLIPHGDGWTLVAGEGGHATLAASTEEEFAIIQMLRKRWSHVSAERVLSGAGLVNLYEALCALRGIEPLMLAPADVTRHAMDKSDEICVRAFALFCEFLGSVAGDLALTIGAFGGIYIAGGILLRFKEAFAASAFRERFEAKGRFASMLAKMPTWLILDESPALTGLANMPLE

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
152 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
157 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
158 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
159 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
160 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
161 2643221651 Afipia sp. Root123D2 Isolate Unclassified
162 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 2.19
Rhizosphere 85.09
Stem 0
Stem Tuber 0
Unclassified 6.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10077810 3300021388 Bacteria 1548
2 rootH1_10157397 3300003323 Bacteria 3546
3 Ga0070683_100030592 3300005329 Bacteria 4889
4 Ga0070683_100480925 3300005329 Bacteria 1186
5 Ga0070670_100128859 3300005331 Unclassified 2184
6 Ga0070680_100284064 3300005336 Bacteria 1402
7 Ga0070682_100016747 3300005337 Bacteria 4265
8 Ga0070661_100177146 3300005344 Bacteria 1621
9 Ga0070668_100181790 3300005347 Bacteria 1718
10 Ga0070675_100121218 3300005354 Unclassified 2222
11 Ga0070673_100190907 3300005364 Bacteria 1760
12 Ga0070709_10008252 3300005434 Bacteria 5719
13 Ga0070714_100205854 3300005435 Unclassified 1802
14 Ga0070713_100002646 3300005436 Bacteria 11664
15 Ga0070713_100075355 3300005436 Bacteria 2861
16 Ga0070710_10007887 3300005437 Bacteria 5172
17 Ga0070710_10015844 3300005437 Bacteria 3823
18 Ga0070711_100040664 3300005439 Bacteria 3136
19 Ga0070708_100371745 3300005445 Bacteria 1348
20 Ga0070681_10003426 3300005458 Bacteria 14859
21 Ga0070681_10161504 3300005458 Bacteria 2165
22 Ga0070681_10203285 3300005458 Bacteria 1899
23 Ga0070707_100480225 3300005468 Bacteria 1204
24 Ga0070698_100398321 3300005471 Bacteria 1310
25 Ga0070698_100507674 3300005471 Bacteria 1144
26 Ga0070679_100009322 3300005530 Bacteria 9280
27 Ga0070679_100011513 3300005530 Bacteria 8432
28 Ga0070679_100516092 3300005530 Bacteria 1139
29 Ga0070684_100001331 3300005535 Bacteria 17688
30 Ga0070697_100186996 3300005536 Bacteria 1757
31 Ga0070672_100422383 3300005543 Unclassified 1145
32 Ga0068855_100036816 3300005563 Bacteria 5821
33 Ga0068855_100132222 3300005563 Bacteria 2849
34 Ga0068855_100424200 3300005563 Bacteria 1454
35 Ga0068857_100090984 3300005577 Bacteria 2731
36 Ga0068857_100240594 3300005577 Bacteria 1657
37 Ga0068856_100018668 3300005614 Bacteria 6723
38 Ga0068856_100055951 3300005614 Bacteria 3893
39 Ga0068870_10164948 3300005840 Bacteria 1317
40 Ga0081455_10096704 3300005937 Bacteria 2380
41 Ga0081540_1011903 3300005983 Bacteria 5771
42 Ga0070715_10098247 3300006163 Bacteria 1361
43 Ga0070712_100099178 3300006175 Bacteria 2150
44 Ga0070712_100217718 3300006175 Bacteria 1510
45 Ga0070712_100227684 3300006175 Unclassified 1479
46 Ga0097621_100206469 3300006237 Bacteria 1707
47 Ga0105240_10038451 3300009093 Bacteria 6138
48 Ga0105240_10045436 3300009093 Bacteria 5571
49 Ga0105240_10244965 3300009093 Bacteria 2076
50 Ga0105241_10018262 3300009174 Bacteria 5157
51 Ga0105237_10097922 3300009545 Bacteria 2924
52 Ga0105237_10194420 3300009545 Bacteria 2028
53 Ga0105237_10205355 3300009545 Bacteria 1970
54 Ga0105238_10044738 3300009551 Bacteria 4474
55 Ga0105238_10080269 3300009551 Bacteria 3252
56 Ga0105238_10135171 3300009551 Bacteria 2443
57 Ga0105238_10305317 3300009551 Bacteria 1576
58 Ga0099796_10044325 3300010159 Bacteria 1519
59 Ga0157369_10003899 3300013105 Bacteria 17702
60 Ga0157369_10004157 3300013105 Bacteria 17144
61 Ga0157374_10144963 3300013296 Bacteria 2306
62 Ga0163162_10198828 3300013306 Bacteria 2133
63 Ga0157372_10174779 3300013307 Bacteria 2486
64 Ga0157379_10204101 3300014968 Bacteria 1788
65 Ga0213872_10000319 3300021361 Bacteria 41035
66 Ga0209758_1001703 3300025297 Bacteria 24689
67 Ga0207647_10099700 3300025904 Bacteria 1725
68 Ga0207699_10125837 3300025906 Unclassified 1664
69 Ga0207707_10000914 3300025912 Bacteria 28757
70 Ga0207707_10004761 3300025912 Bacteria 11902
71 Ga0207707_10169900 3300025912 Bacteria 1906
72 Ga0207707_10196142 3300025912 Bacteria 1761
73 Ga0207695_10150922 3300025913 Bacteria 2263
74 Ga0207695_10179931 3300025913 Bacteria 2035
75 Ga0207671_10033651 3300025914 Bacteria 3811
76 Ga0207671_10172771 3300025914 Bacteria 1679
77 Ga0207693_10192184 3300025915 Unclassified 1606
78 Ga0207693_10228421 3300025915 Bacteria 1461
79 Ga0207693_10341153 3300025915 Bacteria 1172
80 Ga0207652_10003936 3300025921 Bacteria 12147
81 Ga0207652_10463668 3300025921 Bacteria 1142
82 Ga0207646_10413630 3300025922 Bacteria 1218
83 Ga0207694_10056908 3300025924 Bacteria 3038
84 Ga0207694_10192273 3300025924 Bacteria 1658
85 Ga0207650_10210342 3300025925 Unclassified 1562
86 Ga0207659_10234836 3300025926 Unclassified 1481
87 Ga0207700_10001630 3300025928 Bacteria 12742
88 Ga0207664_10028613 3300025929 Bacteria 4237
89 Ga0207664_10184046 3300025929 Unclassified 1795
90 Ga0207661_10001108 3300025944 Bacteria 17926
91 Ga0207661_10001375 3300025944 Bacteria 16327
92 Ga0207667_10029847 3300025949 Bacteria 5907
93 Ga0207651_10135783 3300025960 Bacteria 1892
94 Ga0207668_10333577 3300025972 Bacteria 1263
95 Ga0207658_10143545 3300025986 Bacteria 1936
96 Ga0207702_10065429 3300026078 Bacteria 3114
97 Ga0207674_10045815 3300026116 Bacteria 4495
98 Ga0207674_10261587 3300026116 Bacteria 1677
99 Ga0209588_1043784 3300027671 Bacteria 1447
100 Ga0265327_10000058 3300031251 Bacteria 237043
101 Ga0265316_10000196 3300031344 Bacteria 69947
102 Ga0307414_10370177 3300032004 Bacteria 1236
103 Ga0307411_10156922 3300032005 Unclassified 1699
104 Ga0373926_0007325 3300035083 Bacteria 3677
105 Ga0373934_0018111 3300035086 Bacteria 2694
106 Ga0373944_0027728 3300035089 Bacteria 1681
107 Ga0373923_0084023 3300035111 Bacteria 1384
108 Ga0373936_0017286 3300035113 Bacteria 2776
109 Ga0373945_0006597 3300035116 Bacteria 3750
110 Ga0373953_0011860 3300035117 Bacteria 3071
111 Ga0373954_0023204 3300035118 Bacteria 2819
112 Ga0373956_0053445 3300035119 Bacteria 1818
113 Ga0373957_0019870 3300035120 Bacteria 2368
114 Ga0373943_0016670 3300035170 Bacteria 3353
115 Ga0373946_0003032 3300035171 Bacteria 5953
116 Ga0373955_0019261 3300035172 Bacteria 3407
117 Ga0373955_0026699 3300035172 Bacteria 2978
118 Ga0373924_0026606 3300035410 Bacteria 2295
119 Ga0373935_0057622 3300035692 Bacteria 2478
120 Ga0373927_0009117 3300035695 Bacteria 6659
121 Ga0373927_0062081 3300035695 Bacteria 2417
122 Ga0373933_0036281 3300035724 Bacteria 2884
123 Ga0373947_0009168 3300035725 Bacteria 5689
124 Ga0373947_0030688 3300035725 Bacteria 3160
125 Ga0373937_0017260 3300036401 Bacteria 6426
126 Ga0373937_0160789 3300036401 Bacteria 2105
127 Ga0373925_0056085 3300037068 Bacteria 2950
128 Ga0395899_0144688 3300037312 Bacteria 1689
129 Ga0395900_0035738 3300037418 Bacteria 5119
130 Ga0395900_0065069 3300037418 Bacteria 3745
131 Ga0395898_0005402 3300037466 Bacteria 13809
132 Ga0395898_0006673 3300037466 Bacteria 12309
133 Ga0395898_0093732 3300037466 Bacteria 2886
134 Ga0395905_0001415 3300037471 Bacteria 28991
135 Ga0436364_0871225 3300037853 Bacteria 2342
136 Ga0436364_1054065 3300037853 Bacteria 2721
137 Ga0395901_0455580 3300038443 Bacteria 1308
138 Ga0436365_0289779 3300039437 Bacteria 4800
139 Ga0436365_0597017 3300039437 Bacteria 2611
140 Ga0436365_1768263 3300039437 Bacteria 1883
141 Ga0436360_0120247 3300039438 Bacteria 7393
142 Ga0436361_0194863 3300039447 Bacteria 21712
143 Ga0436361_1076648 3300039447 Bacteria 8429
144 Ga0451577_0143577 3300042876 Bacteria 2146
145 Ga0466971_0042554 3300044719 Bacteria 2041
146 Ga0466957_0016666 3300044842 Bacteria 4298
147 Ga0466957_0267147 3300044842 Bacteria 1141
148 Ga0466959_0049363 3300045049 Bacteria 3091
149 Ga0495592_0030554 3300046454 Bacteria 4075
150 Ga0495592_0180203 3300046454 Bacteria 1440
151 Ga0495592_0270932 3300046454 Bacteria 1114
152 Ga0495603_0050182 3300046455 Bacteria 2482
153 Ga0495629_0031031 3300046459 Bacteria 3785
154 Ga0495580_0008333 3300046472 Bacteria 8245
155 Ga0495664_0007699 3300046477 Bacteria 5991
156 Ga0495594_0025564 3300046499 Bacteria 3174
157 Ga0495628_0088081 3300046516 Bacteria 2406
158 Ga0495630_0090672 3300046517 Bacteria 2309
159 Ga0495652_0039770 3300046529 Unclassified 4066
160 Ga0495652_0327945 3300046529 Bacteria 1104
161 Ga0495640_0005796 3300046533 Bacteria 9811
162 Ga0495640_0023545 3300046533 Bacteria 4483
163 Ga0495645_0075900 3300046543 Bacteria 2419
164 Ga0495622_0001073 3300046557 Bacteria 14373
165 Ga0495667_0046299 3300046559 Bacteria 2877
166 Ga0495634_0010879 3300046642 Bacteria 6647
167 Ga0495635_0074499 3300046663 Bacteria 2326
168 Ga0495647_0008930 3300046681 Bacteria 3380
169 Ga0495658_0045626 3300046683 Bacteria 2460
170 Ga0495658_0134531 3300046683 Bacteria 1507
171 Ga0495613_0196384 3300046689 Bacteria 1424
172 Ga0495624_0016564 3300046690 Bacteria 4961
173 Ga0495581_0009936 3300047315 Bacteria 5505
174 Ga0495604_0163674 3300047317 Bacteria 1570
175 Ga0495674_0112260 3300047319 Bacteria 2309
176 Ga0495672_0071535 3300047320 Bacteria 1962
177 Ga0495676_0241909 3300047321 Bacteria 1235
178 Ga0495680_0051243 3300047322 Bacteria 3224
179 Ga0495684_0030700 3300047471 Bacteria 4126
180 Ga0495593_0007747 3300047673 Bacteria 6262
181 Ga0496102_0393099 3300048905 Bacteria 1304
182 Ga0496104_0008267 3300048907 Bacteria 9240
183 Ga0496107_0111002 3300048910 Unclassified 2015
184 Ga0496110_0092390 3300048913 Bacteria 2708
185 Ga0496115_0068207 3300048918 Bacteria 2879
186 Ga0496117_0025092 3300048920 Bacteria 4694
187 Ga0496118_0138383 3300048921 Bacteria 1549
188 Ga0496121_0006694 3300048924 Bacteria 14165
189 Ga0496121_0070537 3300048924 Bacteria 2814
190 Ga0496121_0153010 3300048924 Unclassified 1695
191 Ga0496124_0122799 3300048927 Bacteria 2073
192 Ga0496126_0016441 3300048929 Bacteria 7398
193 Ga0496126_0023796 3300048929 Bacteria 5929
194 Ga0496126_0151515 3300048929 Bacteria 1987
195 Ga0501034_0012100 3300049571 Bacteria 8922
196 Ga0501036_0011247 3300049572 Bacteria 7404
197 Ga0501038_0011140 3300049574 Bacteria 8212
198 Ga0501038_0028283 3300049574 Bacteria 4981
199 Ga0501043_0045249 3300049579 Bacteria 3461
200 Ga0501047_0015440 3300049581 Bacteria 7276
201 Ga0501047_0120911 3300049581 Bacteria 2501
202 Ga0501070_0041873 3300049586 Bacteria 3814
203 Ga0501070_0172564 3300049586 Bacteria 1781
204 Ga0501080_0066038 3300049742 Bacteria 3365
205 Ga0501080_0131270 3300049742 Bacteria 2319
206 Ga0501035_0177513 3300049822 Bacteria 1836
207 Ga0501035_0284880 3300049822 Bacteria 1396
208 Ga0501044_0009165 3300049823 Bacteria 10810
209 Ga0501044_0020911 3300049823 Bacteria 6987
210 Ga0501044_0094879 3300049823 Bacteria 3007
211 Ga0495601_0033204 3300053077 Bacteria 3215
212 Ga0495601_0072976 3300053077 Bacteria 2193
213 Ga0495601_0143276 3300053077 Bacteria 1559
214 Ga0495601_0256862 3300053077 Bacteria 1141
215 Ga0495612_0037916 3300053078 Bacteria 1958
216 Ga0500635_0002943 3300053080 Bacteria 4242
217 Ga0500572_020796 3300053111 Bacteria 1731
218 Ga0500595_000470 3300053119 Bacteria 24922
219 Ga0500614_014450 3300053123 Bacteria 1748
220 Ga0500559_0061144 3300053136 Bacteria 1679
221 Ga0500603_003329 3300053150 Bacteria 3456
222 Ga0500639_057449 3300053163 Bacteria 2012
223 Ga0500636_0018731 3300053177 Bacteria 4093
224 Ga0500637_0025975 3300053178 Bacteria 3223
225 Ga0500637_0032876 3300053178 Bacteria 2894
226 Ga0500596_004132 3300053735 Bacteria 2689
227 2644287666 2643221651 Bacteria 4798932
228 2883293821 2883291878 Bacteria 5894118
229 Ga0213875_10077810
230 rootH1_10157397
231 Ga0070683_100030592
232 Ga0070683_100480925
233 Ga0070670_100128859
234 Ga0070680_100284064
235 Ga0070682_100016747
236 Ga0070661_100177146
237 Ga0070668_100181790
238 Ga0070675_100121218
239 Ga0070673_100190907
240 Ga0070709_10008252
241 Ga0070714_100205854
242 Ga0070713_100002646
243 Ga0070713_100075355
244 Ga0070710_10007887
245 Ga0070710_10015844
246 Ga0070711_100040664
247 Ga0070708_100371745
248 Ga0070681_10003426
249 Ga0070681_10161504
250 Ga0070681_10203285
251 Ga0070707_100480225
252 Ga0070698_100398321
253 Ga0070698_100507674
254 Ga0070679_100009322
255 Ga0070679_100011513
256 Ga0070679_100516092
257 Ga0070684_100001331
258 Ga0070697_100186996
259 Ga0070672_100422383
260 Ga0068855_100036816
261 Ga0068855_100132222
262 Ga0068855_100424200
263 Ga0068857_100090984
264 Ga0068857_100240594
265 Ga0068856_100018668
266 Ga0068856_100055951
267 Ga0068870_10164948
268 Ga0081455_10096704
269 Ga0081540_1011903
270 Ga0070715_10098247
271 Ga0070712_100099178
272 Ga0070712_100217718
273 Ga0070712_100227684
274 Ga0097621_100206469
275 Ga0105240_10038451
276 Ga0105240_10045436
277 Ga0105240_10244965
278 Ga0105241_10018262
279 Ga0105237_10097922
280 Ga0105237_10194420
281 Ga0105237_10205355
282 Ga0105238_10044738
283 Ga0105238_10080269
284 Ga0105238_10135171
285 Ga0105238_10305317
286 Ga0099796_10044325
287 Ga0157369_10003899
288 Ga0157369_10004157
289 Ga0157374_10144963
290 Ga0163162_10198828
291 Ga0157372_10174779
292 Ga0157379_10204101
293 Ga0213872_10000319
294 Ga0209758_1001703
295 Ga0207647_10099700
296 Ga0207699_10125837
297 Ga0207707_10000914
298 Ga0207707_10004761
299 Ga0207707_10169900
300 Ga0207707_10196142
301 Ga0207695_10150922
302 Ga0207695_10179931
303 Ga0207671_10033651
304 Ga0207671_10172771
305 Ga0207693_10192184
306 Ga0207693_10228421
307 Ga0207693_10341153
308 Ga0207652_10003936
309 Ga0207652_10463668
310 Ga0207646_10413630
311 Ga0207694_10056908
312 Ga0207694_10192273
313 Ga0207650_10210342
314 Ga0207659_10234836
315 Ga0207700_10001630
316 Ga0207664_10028613
317 Ga0207664_10184046
318 Ga0207661_10001108
319 Ga0207661_10001375
320 Ga0207667_10029847
321 Ga0207651_10135783
322 Ga0207668_10333577
323 Ga0207658_10143545
324 Ga0207702_10065429
325 Ga0207674_10045815
326 Ga0207674_10261587
327 Ga0209588_1043784
328 Ga0265327_10000058
329 Ga0265316_10000196
330 Ga0307414_10370177
331 Ga0307411_10156922
332 Ga0373926_0007325
333 Ga0373934_0018111
334 Ga0373944_0027728
335 Ga0373923_0084023
336 Ga0373936_0017286
337 Ga0373945_0006597
338 Ga0373953_0011860
339 Ga0373954_0023204
340 Ga0373956_0053445
341 Ga0373957_0019870
342 Ga0373943_0016670
343 Ga0373946_0003032
344 Ga0373955_0019261
345 Ga0373955_0026699
346 Ga0373924_0026606
347 Ga0373935_0057622
348 Ga0373927_0009117
349 Ga0373927_0062081
350 Ga0373933_0036281
351 Ga0373947_0009168
352 Ga0373947_0030688
353 Ga0373937_0017260
354 Ga0373937_0160789
355 Ga0373925_0056085
356 Ga0395899_0144688
357 Ga0395900_0035738
358 Ga0395900_0065069
359 Ga0395898_0005402
360 Ga0395898_0006673
361 Ga0395898_0093732
362 Ga0395905_0001415
363 Ga0436364_0871225
364 Ga0436364_1054065
365 Ga0395901_0455580
366 Ga0436365_0289779
367 Ga0436365_0597017
368 Ga0436365_1768263
369 Ga0436360_0120247
370 Ga0436361_0194863
371 Ga0436361_1076648
372 Ga0451577_0143577
373 Ga0466971_0042554
374 Ga0466957_0016666
375 Ga0466957_0267147
376 Ga0466959_0049363
377 Ga0495592_0030554
378 Ga0495592_0180203
379 Ga0495592_0270932
380 Ga0495603_0050182
381 Ga0495629_0031031
382 Ga0495580_0008333
383 Ga0495664_0007699
384 Ga0495594_0025564
385 Ga0495628_0088081
386 Ga0495630_0090672
387 Ga0495652_0039770
388 Ga0495652_0327945
389 Ga0495640_0005796
390 Ga0495640_0023545
391 Ga0495645_0075900
392 Ga0495622_0001073
393 Ga0495667_0046299
394 Ga0495634_0010879
395 Ga0495635_0074499
396 Ga0495647_0008930
397 Ga0495658_0045626
398 Ga0495658_0134531
399 Ga0495613_0196384
400 Ga0495624_0016564
401 Ga0495581_0009936
402 Ga0495604_0163674
403 Ga0495674_0112260
404 Ga0495672_0071535
405 Ga0495676_0241909
406 Ga0495680_0051243
407 Ga0495684_0030700
408 Ga0495593_0007747
409 Ga0496102_0393099
410 Ga0496104_0008267
411 Ga0496107_0111002
412 Ga0496110_0092390
413 Ga0496115_0068207
414 Ga0496117_0025092
415 Ga0496118_0138383
416 Ga0496121_0006694
417 Ga0496121_0070537
418 Ga0496121_0153010
419 Ga0496124_0122799
420 Ga0496126_0016441
421 Ga0496126_0023796
422 Ga0496126_0151515
423 Ga0501034_0012100
424 Ga0501036_0011247
425 Ga0501038_0011140
426 Ga0501038_0028283
427 Ga0501043_0045249
428 Ga0501047_0015440
429 Ga0501047_0120911
430 Ga0501070_0041873
431 Ga0501070_0172564
432 Ga0501080_0066038
433 Ga0501080_0131270
434 Ga0501035_0177513
435 Ga0501035_0284880
436 Ga0501044_0009165
437 Ga0501044_0020911
438 Ga0501044_0094879
439 Ga0495601_0033204
440 Ga0495601_0072976
441 Ga0495601_0143276
442 Ga0495601_0256862
443 Ga0495612_0037916
444 Ga0500635_0002943
445 Ga0500572_020796
446 Ga0500595_000470
447 Ga0500614_014450
448 Ga0500559_0061144
449 Ga0500603_003329
450 Ga0500639_057449
451 Ga0500636_0018731
452 Ga0500637_0025975
453 Ga0500637_0032876
454 Ga0500596_004132
455 2644287666
456 2883293821

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02685

Glucokinase

Glucokinase

58

364

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sz2-assembly1.cif.gz_A crystal structure of e. coli glucokinase in complex with glucose 0.9549 8 321
1sz2-assembly1.cif.gz_A crystal structure of e. coli glucokinase in complex with glucose 0.9288 8 321
3vpz-assembly1.cif.gz_A-2 crystal structure of glucokinase from antarctic psychrotroph at 1.69a 0.8512 9 318
6vzz-assembly1.cif.gz_A-2 crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose 0.8299 2 319
7wn7-assembly1.cif.gz_A crystal structure of hearnpv p26 0.8202 5 37
ID Description Score Start End Superfamily
af_P0A6V8_117_298_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9673 125 304 3.30.420.40
af_P0A6V8_2_105_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9586 8 112 3.30.420.40
af_P0A6V8_117_298_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9519 125 304 3.30.420.40
3vpzA02 Alpha Beta;3-Layer(aba) Sandwich;Hexokinase; domain 1; 0.9345 109 307 3.40.367.20
af_P0A6V8_2_105_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9316 8 112 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A3E0TLB8-F1-model_v4 Glucokinase 0.9883 197 316 GO:0004340
GO:0005524
GO:0005536
GO:0005829
GO:0006096
AF-A0A327KDW3-F1-model_v4 Glucokinase 0.9863 185 317 GO:0004340
GO:0005524
GO:0005536
GO:0005829
GO:0006096
AF-A0A3D5XJT5-F1-model_v4 deleted 0.9786 180 321
AF-A0A2X1N584-F1-model_v4 Glucokinase (EC 2.7.1.2) 0.9757 186 304 GO:0004340
GO:0005524
GO:0005536
GO:0005829
GO:0006096
AF-A0A357N638-F1-model_v4 Glucokinase (EC 2.7.1.2) 0.9753 141 321 GO:0004340
GO:0005524
GO:0005536
GO:0005829
GO:0006096

Map