F341015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 228 | 162 | 456 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10077810|Ga0213875_100778102 |
| Length | 365 |
| Sequence | MEFAGRQAACSRPACGVSRLLKPRRRECRRETGKPFANYVGVPTLIVLMEPALNAPRLIGDIGGTNARFAIAQGGKYGQLKHVETEHYPSLHDALAEYLKTRPQGELSGALAIAGPVLGDRISLTNKAWSFSVEDLKQSLRLTALTVVNDFAATAQAIPHLSPQQKFAIGPAIANAGGNIGVVGPGTGLGMSSLIPHGDGWTLVAGEGGHATLAASTEEEFAIIQMLRKRWSHVSAERVLSGAGLVNLYEALCALRGIEPLMLAPADVTRHAMDKSDEICVRAFALFCEFLGSVAGDLALTIGAFGGIYIAGGILLRFKEAFAASAFRERFEAKGRFASMLAKMPTWLILDESPALTGLANMPLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 44 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 67 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 69 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 70 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 71 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 72 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 73 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 74 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 75 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 76 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 77 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 78 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 80 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 81 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 82 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 83 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 84 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 85 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 86 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 87 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 88 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 89 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 93 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 94 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 97 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 98 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 99 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 100 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 101 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 102 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 103 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 134 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 135 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 136 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 137 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 138 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 139 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 152 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 153 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 154 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 155 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 156 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 157 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 158 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 159 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 160 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 161 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 162 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.12 |
| Metatranscriptomes | 0 |
| Isolates | 0.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.26 |
| Nodule | 0 |
| Rhizoplane | 2.19 |
| Rhizosphere | 85.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213875_10077810 | 3300021388 | Bacteria | 1548 |
| 2 | rootH1_10157397 | 3300003323 | Bacteria | 3546 |
| 3 | Ga0070683_100030592 | 3300005329 | Bacteria | 4889 |
| 4 | Ga0070683_100480925 | 3300005329 | Bacteria | 1186 |
| 5 | Ga0070670_100128859 | 3300005331 | Unclassified | 2184 |
| 6 | Ga0070680_100284064 | 3300005336 | Bacteria | 1402 |
| 7 | Ga0070682_100016747 | 3300005337 | Bacteria | 4265 |
| 8 | Ga0070661_100177146 | 3300005344 | Bacteria | 1621 |
| 9 | Ga0070668_100181790 | 3300005347 | Bacteria | 1718 |
| 10 | Ga0070675_100121218 | 3300005354 | Unclassified | 2222 |
| 11 | Ga0070673_100190907 | 3300005364 | Bacteria | 1760 |
| 12 | Ga0070709_10008252 | 3300005434 | Bacteria | 5719 |
| 13 | Ga0070714_100205854 | 3300005435 | Unclassified | 1802 |
| 14 | Ga0070713_100002646 | 3300005436 | Bacteria | 11664 |
| 15 | Ga0070713_100075355 | 3300005436 | Bacteria | 2861 |
| 16 | Ga0070710_10007887 | 3300005437 | Bacteria | 5172 |
| 17 | Ga0070710_10015844 | 3300005437 | Bacteria | 3823 |
| 18 | Ga0070711_100040664 | 3300005439 | Bacteria | 3136 |
| 19 | Ga0070708_100371745 | 3300005445 | Bacteria | 1348 |
| 20 | Ga0070681_10003426 | 3300005458 | Bacteria | 14859 |
| 21 | Ga0070681_10161504 | 3300005458 | Bacteria | 2165 |
| 22 | Ga0070681_10203285 | 3300005458 | Bacteria | 1899 |
| 23 | Ga0070707_100480225 | 3300005468 | Bacteria | 1204 |
| 24 | Ga0070698_100398321 | 3300005471 | Bacteria | 1310 |
| 25 | Ga0070698_100507674 | 3300005471 | Bacteria | 1144 |
| 26 | Ga0070679_100009322 | 3300005530 | Bacteria | 9280 |
| 27 | Ga0070679_100011513 | 3300005530 | Bacteria | 8432 |
| 28 | Ga0070679_100516092 | 3300005530 | Bacteria | 1139 |
| 29 | Ga0070684_100001331 | 3300005535 | Bacteria | 17688 |
| 30 | Ga0070697_100186996 | 3300005536 | Bacteria | 1757 |
| 31 | Ga0070672_100422383 | 3300005543 | Unclassified | 1145 |
| 32 | Ga0068855_100036816 | 3300005563 | Bacteria | 5821 |
| 33 | Ga0068855_100132222 | 3300005563 | Bacteria | 2849 |
| 34 | Ga0068855_100424200 | 3300005563 | Bacteria | 1454 |
| 35 | Ga0068857_100090984 | 3300005577 | Bacteria | 2731 |
| 36 | Ga0068857_100240594 | 3300005577 | Bacteria | 1657 |
| 37 | Ga0068856_100018668 | 3300005614 | Bacteria | 6723 |
| 38 | Ga0068856_100055951 | 3300005614 | Bacteria | 3893 |
| 39 | Ga0068870_10164948 | 3300005840 | Bacteria | 1317 |
| 40 | Ga0081455_10096704 | 3300005937 | Bacteria | 2380 |
| 41 | Ga0081540_1011903 | 3300005983 | Bacteria | 5771 |
| 42 | Ga0070715_10098247 | 3300006163 | Bacteria | 1361 |
| 43 | Ga0070712_100099178 | 3300006175 | Bacteria | 2150 |
| 44 | Ga0070712_100217718 | 3300006175 | Bacteria | 1510 |
| 45 | Ga0070712_100227684 | 3300006175 | Unclassified | 1479 |
| 46 | Ga0097621_100206469 | 3300006237 | Bacteria | 1707 |
| 47 | Ga0105240_10038451 | 3300009093 | Bacteria | 6138 |
| 48 | Ga0105240_10045436 | 3300009093 | Bacteria | 5571 |
| 49 | Ga0105240_10244965 | 3300009093 | Bacteria | 2076 |
| 50 | Ga0105241_10018262 | 3300009174 | Bacteria | 5157 |
| 51 | Ga0105237_10097922 | 3300009545 | Bacteria | 2924 |
| 52 | Ga0105237_10194420 | 3300009545 | Bacteria | 2028 |
| 53 | Ga0105237_10205355 | 3300009545 | Bacteria | 1970 |
| 54 | Ga0105238_10044738 | 3300009551 | Bacteria | 4474 |
| 55 | Ga0105238_10080269 | 3300009551 | Bacteria | 3252 |
| 56 | Ga0105238_10135171 | 3300009551 | Bacteria | 2443 |
| 57 | Ga0105238_10305317 | 3300009551 | Bacteria | 1576 |
| 58 | Ga0099796_10044325 | 3300010159 | Bacteria | 1519 |
| 59 | Ga0157369_10003899 | 3300013105 | Bacteria | 17702 |
| 60 | Ga0157369_10004157 | 3300013105 | Bacteria | 17144 |
| 61 | Ga0157374_10144963 | 3300013296 | Bacteria | 2306 |
| 62 | Ga0163162_10198828 | 3300013306 | Bacteria | 2133 |
| 63 | Ga0157372_10174779 | 3300013307 | Bacteria | 2486 |
| 64 | Ga0157379_10204101 | 3300014968 | Bacteria | 1788 |
| 65 | Ga0213872_10000319 | 3300021361 | Bacteria | 41035 |
| 66 | Ga0209758_1001703 | 3300025297 | Bacteria | 24689 |
| 67 | Ga0207647_10099700 | 3300025904 | Bacteria | 1725 |
| 68 | Ga0207699_10125837 | 3300025906 | Unclassified | 1664 |
| 69 | Ga0207707_10000914 | 3300025912 | Bacteria | 28757 |
| 70 | Ga0207707_10004761 | 3300025912 | Bacteria | 11902 |
| 71 | Ga0207707_10169900 | 3300025912 | Bacteria | 1906 |
| 72 | Ga0207707_10196142 | 3300025912 | Bacteria | 1761 |
| 73 | Ga0207695_10150922 | 3300025913 | Bacteria | 2263 |
| 74 | Ga0207695_10179931 | 3300025913 | Bacteria | 2035 |
| 75 | Ga0207671_10033651 | 3300025914 | Bacteria | 3811 |
| 76 | Ga0207671_10172771 | 3300025914 | Bacteria | 1679 |
| 77 | Ga0207693_10192184 | 3300025915 | Unclassified | 1606 |
| 78 | Ga0207693_10228421 | 3300025915 | Bacteria | 1461 |
| 79 | Ga0207693_10341153 | 3300025915 | Bacteria | 1172 |
| 80 | Ga0207652_10003936 | 3300025921 | Bacteria | 12147 |
| 81 | Ga0207652_10463668 | 3300025921 | Bacteria | 1142 |
| 82 | Ga0207646_10413630 | 3300025922 | Bacteria | 1218 |
| 83 | Ga0207694_10056908 | 3300025924 | Bacteria | 3038 |
| 84 | Ga0207694_10192273 | 3300025924 | Bacteria | 1658 |
| 85 | Ga0207650_10210342 | 3300025925 | Unclassified | 1562 |
| 86 | Ga0207659_10234836 | 3300025926 | Unclassified | 1481 |
| 87 | Ga0207700_10001630 | 3300025928 | Bacteria | 12742 |
| 88 | Ga0207664_10028613 | 3300025929 | Bacteria | 4237 |
| 89 | Ga0207664_10184046 | 3300025929 | Unclassified | 1795 |
| 90 | Ga0207661_10001108 | 3300025944 | Bacteria | 17926 |
| 91 | Ga0207661_10001375 | 3300025944 | Bacteria | 16327 |
| 92 | Ga0207667_10029847 | 3300025949 | Bacteria | 5907 |
| 93 | Ga0207651_10135783 | 3300025960 | Bacteria | 1892 |
| 94 | Ga0207668_10333577 | 3300025972 | Bacteria | 1263 |
| 95 | Ga0207658_10143545 | 3300025986 | Bacteria | 1936 |
| 96 | Ga0207702_10065429 | 3300026078 | Bacteria | 3114 |
| 97 | Ga0207674_10045815 | 3300026116 | Bacteria | 4495 |
| 98 | Ga0207674_10261587 | 3300026116 | Bacteria | 1677 |
| 99 | Ga0209588_1043784 | 3300027671 | Bacteria | 1447 |
| 100 | Ga0265327_10000058 | 3300031251 | Bacteria | 237043 |
| 101 | Ga0265316_10000196 | 3300031344 | Bacteria | 69947 |
| 102 | Ga0307414_10370177 | 3300032004 | Bacteria | 1236 |
| 103 | Ga0307411_10156922 | 3300032005 | Unclassified | 1699 |
| 104 | Ga0373926_0007325 | 3300035083 | Bacteria | 3677 |
| 105 | Ga0373934_0018111 | 3300035086 | Bacteria | 2694 |
| 106 | Ga0373944_0027728 | 3300035089 | Bacteria | 1681 |
| 107 | Ga0373923_0084023 | 3300035111 | Bacteria | 1384 |
| 108 | Ga0373936_0017286 | 3300035113 | Bacteria | 2776 |
| 109 | Ga0373945_0006597 | 3300035116 | Bacteria | 3750 |
| 110 | Ga0373953_0011860 | 3300035117 | Bacteria | 3071 |
| 111 | Ga0373954_0023204 | 3300035118 | Bacteria | 2819 |
| 112 | Ga0373956_0053445 | 3300035119 | Bacteria | 1818 |
| 113 | Ga0373957_0019870 | 3300035120 | Bacteria | 2368 |
| 114 | Ga0373943_0016670 | 3300035170 | Bacteria | 3353 |
| 115 | Ga0373946_0003032 | 3300035171 | Bacteria | 5953 |
| 116 | Ga0373955_0019261 | 3300035172 | Bacteria | 3407 |
| 117 | Ga0373955_0026699 | 3300035172 | Bacteria | 2978 |
| 118 | Ga0373924_0026606 | 3300035410 | Bacteria | 2295 |
| 119 | Ga0373935_0057622 | 3300035692 | Bacteria | 2478 |
| 120 | Ga0373927_0009117 | 3300035695 | Bacteria | 6659 |
| 121 | Ga0373927_0062081 | 3300035695 | Bacteria | 2417 |
| 122 | Ga0373933_0036281 | 3300035724 | Bacteria | 2884 |
| 123 | Ga0373947_0009168 | 3300035725 | Bacteria | 5689 |
| 124 | Ga0373947_0030688 | 3300035725 | Bacteria | 3160 |
| 125 | Ga0373937_0017260 | 3300036401 | Bacteria | 6426 |
| 126 | Ga0373937_0160789 | 3300036401 | Bacteria | 2105 |
| 127 | Ga0373925_0056085 | 3300037068 | Bacteria | 2950 |
| 128 | Ga0395899_0144688 | 3300037312 | Bacteria | 1689 |
| 129 | Ga0395900_0035738 | 3300037418 | Bacteria | 5119 |
| 130 | Ga0395900_0065069 | 3300037418 | Bacteria | 3745 |
| 131 | Ga0395898_0005402 | 3300037466 | Bacteria | 13809 |
| 132 | Ga0395898_0006673 | 3300037466 | Bacteria | 12309 |
| 133 | Ga0395898_0093732 | 3300037466 | Bacteria | 2886 |
| 134 | Ga0395905_0001415 | 3300037471 | Bacteria | 28991 |
| 135 | Ga0436364_0871225 | 3300037853 | Bacteria | 2342 |
| 136 | Ga0436364_1054065 | 3300037853 | Bacteria | 2721 |
| 137 | Ga0395901_0455580 | 3300038443 | Bacteria | 1308 |
| 138 | Ga0436365_0289779 | 3300039437 | Bacteria | 4800 |
| 139 | Ga0436365_0597017 | 3300039437 | Bacteria | 2611 |
| 140 | Ga0436365_1768263 | 3300039437 | Bacteria | 1883 |
| 141 | Ga0436360_0120247 | 3300039438 | Bacteria | 7393 |
| 142 | Ga0436361_0194863 | 3300039447 | Bacteria | 21712 |
| 143 | Ga0436361_1076648 | 3300039447 | Bacteria | 8429 |
| 144 | Ga0451577_0143577 | 3300042876 | Bacteria | 2146 |
| 145 | Ga0466971_0042554 | 3300044719 | Bacteria | 2041 |
| 146 | Ga0466957_0016666 | 3300044842 | Bacteria | 4298 |
| 147 | Ga0466957_0267147 | 3300044842 | Bacteria | 1141 |
| 148 | Ga0466959_0049363 | 3300045049 | Bacteria | 3091 |
| 149 | Ga0495592_0030554 | 3300046454 | Bacteria | 4075 |
| 150 | Ga0495592_0180203 | 3300046454 | Bacteria | 1440 |
| 151 | Ga0495592_0270932 | 3300046454 | Bacteria | 1114 |
| 152 | Ga0495603_0050182 | 3300046455 | Bacteria | 2482 |
| 153 | Ga0495629_0031031 | 3300046459 | Bacteria | 3785 |
| 154 | Ga0495580_0008333 | 3300046472 | Bacteria | 8245 |
| 155 | Ga0495664_0007699 | 3300046477 | Bacteria | 5991 |
| 156 | Ga0495594_0025564 | 3300046499 | Bacteria | 3174 |
| 157 | Ga0495628_0088081 | 3300046516 | Bacteria | 2406 |
| 158 | Ga0495630_0090672 | 3300046517 | Bacteria | 2309 |
| 159 | Ga0495652_0039770 | 3300046529 | Unclassified | 4066 |
| 160 | Ga0495652_0327945 | 3300046529 | Bacteria | 1104 |
| 161 | Ga0495640_0005796 | 3300046533 | Bacteria | 9811 |
| 162 | Ga0495640_0023545 | 3300046533 | Bacteria | 4483 |
| 163 | Ga0495645_0075900 | 3300046543 | Bacteria | 2419 |
| 164 | Ga0495622_0001073 | 3300046557 | Bacteria | 14373 |
| 165 | Ga0495667_0046299 | 3300046559 | Bacteria | 2877 |
| 166 | Ga0495634_0010879 | 3300046642 | Bacteria | 6647 |
| 167 | Ga0495635_0074499 | 3300046663 | Bacteria | 2326 |
| 168 | Ga0495647_0008930 | 3300046681 | Bacteria | 3380 |
| 169 | Ga0495658_0045626 | 3300046683 | Bacteria | 2460 |
| 170 | Ga0495658_0134531 | 3300046683 | Bacteria | 1507 |
| 171 | Ga0495613_0196384 | 3300046689 | Bacteria | 1424 |
| 172 | Ga0495624_0016564 | 3300046690 | Bacteria | 4961 |
| 173 | Ga0495581_0009936 | 3300047315 | Bacteria | 5505 |
| 174 | Ga0495604_0163674 | 3300047317 | Bacteria | 1570 |
| 175 | Ga0495674_0112260 | 3300047319 | Bacteria | 2309 |
| 176 | Ga0495672_0071535 | 3300047320 | Bacteria | 1962 |
| 177 | Ga0495676_0241909 | 3300047321 | Bacteria | 1235 |
| 178 | Ga0495680_0051243 | 3300047322 | Bacteria | 3224 |
| 179 | Ga0495684_0030700 | 3300047471 | Bacteria | 4126 |
| 180 | Ga0495593_0007747 | 3300047673 | Bacteria | 6262 |
| 181 | Ga0496102_0393099 | 3300048905 | Bacteria | 1304 |
| 182 | Ga0496104_0008267 | 3300048907 | Bacteria | 9240 |
| 183 | Ga0496107_0111002 | 3300048910 | Unclassified | 2015 |
| 184 | Ga0496110_0092390 | 3300048913 | Bacteria | 2708 |
| 185 | Ga0496115_0068207 | 3300048918 | Bacteria | 2879 |
| 186 | Ga0496117_0025092 | 3300048920 | Bacteria | 4694 |
| 187 | Ga0496118_0138383 | 3300048921 | Bacteria | 1549 |
| 188 | Ga0496121_0006694 | 3300048924 | Bacteria | 14165 |
| 189 | Ga0496121_0070537 | 3300048924 | Bacteria | 2814 |
| 190 | Ga0496121_0153010 | 3300048924 | Unclassified | 1695 |
| 191 | Ga0496124_0122799 | 3300048927 | Bacteria | 2073 |
| 192 | Ga0496126_0016441 | 3300048929 | Bacteria | 7398 |
| 193 | Ga0496126_0023796 | 3300048929 | Bacteria | 5929 |
| 194 | Ga0496126_0151515 | 3300048929 | Bacteria | 1987 |
| 195 | Ga0501034_0012100 | 3300049571 | Bacteria | 8922 |
| 196 | Ga0501036_0011247 | 3300049572 | Bacteria | 7404 |
| 197 | Ga0501038_0011140 | 3300049574 | Bacteria | 8212 |
| 198 | Ga0501038_0028283 | 3300049574 | Bacteria | 4981 |
| 199 | Ga0501043_0045249 | 3300049579 | Bacteria | 3461 |
| 200 | Ga0501047_0015440 | 3300049581 | Bacteria | 7276 |
| 201 | Ga0501047_0120911 | 3300049581 | Bacteria | 2501 |
| 202 | Ga0501070_0041873 | 3300049586 | Bacteria | 3814 |
| 203 | Ga0501070_0172564 | 3300049586 | Bacteria | 1781 |
| 204 | Ga0501080_0066038 | 3300049742 | Bacteria | 3365 |
| 205 | Ga0501080_0131270 | 3300049742 | Bacteria | 2319 |
| 206 | Ga0501035_0177513 | 3300049822 | Bacteria | 1836 |
| 207 | Ga0501035_0284880 | 3300049822 | Bacteria | 1396 |
| 208 | Ga0501044_0009165 | 3300049823 | Bacteria | 10810 |
| 209 | Ga0501044_0020911 | 3300049823 | Bacteria | 6987 |
| 210 | Ga0501044_0094879 | 3300049823 | Bacteria | 3007 |
| 211 | Ga0495601_0033204 | 3300053077 | Bacteria | 3215 |
| 212 | Ga0495601_0072976 | 3300053077 | Bacteria | 2193 |
| 213 | Ga0495601_0143276 | 3300053077 | Bacteria | 1559 |
| 214 | Ga0495601_0256862 | 3300053077 | Bacteria | 1141 |
| 215 | Ga0495612_0037916 | 3300053078 | Bacteria | 1958 |
| 216 | Ga0500635_0002943 | 3300053080 | Bacteria | 4242 |
| 217 | Ga0500572_020796 | 3300053111 | Bacteria | 1731 |
| 218 | Ga0500595_000470 | 3300053119 | Bacteria | 24922 |
| 219 | Ga0500614_014450 | 3300053123 | Bacteria | 1748 |
| 220 | Ga0500559_0061144 | 3300053136 | Bacteria | 1679 |
| 221 | Ga0500603_003329 | 3300053150 | Bacteria | 3456 |
| 222 | Ga0500639_057449 | 3300053163 | Bacteria | 2012 |
| 223 | Ga0500636_0018731 | 3300053177 | Bacteria | 4093 |
| 224 | Ga0500637_0025975 | 3300053178 | Bacteria | 3223 |
| 225 | Ga0500637_0032876 | 3300053178 | Bacteria | 2894 |
| 226 | Ga0500596_004132 | 3300053735 | Bacteria | 2689 |
| 227 | 2644287666 | 2643221651 | Bacteria | 4798932 |
| 228 | 2883293821 | 2883291878 | Bacteria | 5894118 |
| 229 | Ga0213875_10077810 | |||
| 230 | rootH1_10157397 | |||
| 231 | Ga0070683_100030592 | |||
| 232 | Ga0070683_100480925 | |||
| 233 | Ga0070670_100128859 | |||
| 234 | Ga0070680_100284064 | |||
| 235 | Ga0070682_100016747 | |||
| 236 | Ga0070661_100177146 | |||
| 237 | Ga0070668_100181790 | |||
| 238 | Ga0070675_100121218 | |||
| 239 | Ga0070673_100190907 | |||
| 240 | Ga0070709_10008252 | |||
| 241 | Ga0070714_100205854 | |||
| 242 | Ga0070713_100002646 | |||
| 243 | Ga0070713_100075355 | |||
| 244 | Ga0070710_10007887 | |||
| 245 | Ga0070710_10015844 | |||
| 246 | Ga0070711_100040664 | |||
| 247 | Ga0070708_100371745 | |||
| 248 | Ga0070681_10003426 | |||
| 249 | Ga0070681_10161504 | |||
| 250 | Ga0070681_10203285 | |||
| 251 | Ga0070707_100480225 | |||
| 252 | Ga0070698_100398321 | |||
| 253 | Ga0070698_100507674 | |||
| 254 | Ga0070679_100009322 | |||
| 255 | Ga0070679_100011513 | |||
| 256 | Ga0070679_100516092 | |||
| 257 | Ga0070684_100001331 | |||
| 258 | Ga0070697_100186996 | |||
| 259 | Ga0070672_100422383 | |||
| 260 | Ga0068855_100036816 | |||
| 261 | Ga0068855_100132222 | |||
| 262 | Ga0068855_100424200 | |||
| 263 | Ga0068857_100090984 | |||
| 264 | Ga0068857_100240594 | |||
| 265 | Ga0068856_100018668 | |||
| 266 | Ga0068856_100055951 | |||
| 267 | Ga0068870_10164948 | |||
| 268 | Ga0081455_10096704 | |||
| 269 | Ga0081540_1011903 | |||
| 270 | Ga0070715_10098247 | |||
| 271 | Ga0070712_100099178 | |||
| 272 | Ga0070712_100217718 | |||
| 273 | Ga0070712_100227684 | |||
| 274 | Ga0097621_100206469 | |||
| 275 | Ga0105240_10038451 | |||
| 276 | Ga0105240_10045436 | |||
| 277 | Ga0105240_10244965 | |||
| 278 | Ga0105241_10018262 | |||
| 279 | Ga0105237_10097922 | |||
| 280 | Ga0105237_10194420 | |||
| 281 | Ga0105237_10205355 | |||
| 282 | Ga0105238_10044738 | |||
| 283 | Ga0105238_10080269 | |||
| 284 | Ga0105238_10135171 | |||
| 285 | Ga0105238_10305317 | |||
| 286 | Ga0099796_10044325 | |||
| 287 | Ga0157369_10003899 | |||
| 288 | Ga0157369_10004157 | |||
| 289 | Ga0157374_10144963 | |||
| 290 | Ga0163162_10198828 | |||
| 291 | Ga0157372_10174779 | |||
| 292 | Ga0157379_10204101 | |||
| 293 | Ga0213872_10000319 | |||
| 294 | Ga0209758_1001703 | |||
| 295 | Ga0207647_10099700 | |||
| 296 | Ga0207699_10125837 | |||
| 297 | Ga0207707_10000914 | |||
| 298 | Ga0207707_10004761 | |||
| 299 | Ga0207707_10169900 | |||
| 300 | Ga0207707_10196142 | |||
| 301 | Ga0207695_10150922 | |||
| 302 | Ga0207695_10179931 | |||
| 303 | Ga0207671_10033651 | |||
| 304 | Ga0207671_10172771 | |||
| 305 | Ga0207693_10192184 | |||
| 306 | Ga0207693_10228421 | |||
| 307 | Ga0207693_10341153 | |||
| 308 | Ga0207652_10003936 | |||
| 309 | Ga0207652_10463668 | |||
| 310 | Ga0207646_10413630 | |||
| 311 | Ga0207694_10056908 | |||
| 312 | Ga0207694_10192273 | |||
| 313 | Ga0207650_10210342 | |||
| 314 | Ga0207659_10234836 | |||
| 315 | Ga0207700_10001630 | |||
| 316 | Ga0207664_10028613 | |||
| 317 | Ga0207664_10184046 | |||
| 318 | Ga0207661_10001108 | |||
| 319 | Ga0207661_10001375 | |||
| 320 | Ga0207667_10029847 | |||
| 321 | Ga0207651_10135783 | |||
| 322 | Ga0207668_10333577 | |||
| 323 | Ga0207658_10143545 | |||
| 324 | Ga0207702_10065429 | |||
| 325 | Ga0207674_10045815 | |||
| 326 | Ga0207674_10261587 | |||
| 327 | Ga0209588_1043784 | |||
| 328 | Ga0265327_10000058 | |||
| 329 | Ga0265316_10000196 | |||
| 330 | Ga0307414_10370177 | |||
| 331 | Ga0307411_10156922 | |||
| 332 | Ga0373926_0007325 | |||
| 333 | Ga0373934_0018111 | |||
| 334 | Ga0373944_0027728 | |||
| 335 | Ga0373923_0084023 | |||
| 336 | Ga0373936_0017286 | |||
| 337 | Ga0373945_0006597 | |||
| 338 | Ga0373953_0011860 | |||
| 339 | Ga0373954_0023204 | |||
| 340 | Ga0373956_0053445 | |||
| 341 | Ga0373957_0019870 | |||
| 342 | Ga0373943_0016670 | |||
| 343 | Ga0373946_0003032 | |||
| 344 | Ga0373955_0019261 | |||
| 345 | Ga0373955_0026699 | |||
| 346 | Ga0373924_0026606 | |||
| 347 | Ga0373935_0057622 | |||
| 348 | Ga0373927_0009117 | |||
| 349 | Ga0373927_0062081 | |||
| 350 | Ga0373933_0036281 | |||
| 351 | Ga0373947_0009168 | |||
| 352 | Ga0373947_0030688 | |||
| 353 | Ga0373937_0017260 | |||
| 354 | Ga0373937_0160789 | |||
| 355 | Ga0373925_0056085 | |||
| 356 | Ga0395899_0144688 | |||
| 357 | Ga0395900_0035738 | |||
| 358 | Ga0395900_0065069 | |||
| 359 | Ga0395898_0005402 | |||
| 360 | Ga0395898_0006673 | |||
| 361 | Ga0395898_0093732 | |||
| 362 | Ga0395905_0001415 | |||
| 363 | Ga0436364_0871225 | |||
| 364 | Ga0436364_1054065 | |||
| 365 | Ga0395901_0455580 | |||
| 366 | Ga0436365_0289779 | |||
| 367 | Ga0436365_0597017 | |||
| 368 | Ga0436365_1768263 | |||
| 369 | Ga0436360_0120247 | |||
| 370 | Ga0436361_0194863 | |||
| 371 | Ga0436361_1076648 | |||
| 372 | Ga0451577_0143577 | |||
| 373 | Ga0466971_0042554 | |||
| 374 | Ga0466957_0016666 | |||
| 375 | Ga0466957_0267147 | |||
| 376 | Ga0466959_0049363 | |||
| 377 | Ga0495592_0030554 | |||
| 378 | Ga0495592_0180203 | |||
| 379 | Ga0495592_0270932 | |||
| 380 | Ga0495603_0050182 | |||
| 381 | Ga0495629_0031031 | |||
| 382 | Ga0495580_0008333 | |||
| 383 | Ga0495664_0007699 | |||
| 384 | Ga0495594_0025564 | |||
| 385 | Ga0495628_0088081 | |||
| 386 | Ga0495630_0090672 | |||
| 387 | Ga0495652_0039770 | |||
| 388 | Ga0495652_0327945 | |||
| 389 | Ga0495640_0005796 | |||
| 390 | Ga0495640_0023545 | |||
| 391 | Ga0495645_0075900 | |||
| 392 | Ga0495622_0001073 | |||
| 393 | Ga0495667_0046299 | |||
| 394 | Ga0495634_0010879 | |||
| 395 | Ga0495635_0074499 | |||
| 396 | Ga0495647_0008930 | |||
| 397 | Ga0495658_0045626 | |||
| 398 | Ga0495658_0134531 | |||
| 399 | Ga0495613_0196384 | |||
| 400 | Ga0495624_0016564 | |||
| 401 | Ga0495581_0009936 | |||
| 402 | Ga0495604_0163674 | |||
| 403 | Ga0495674_0112260 | |||
| 404 | Ga0495672_0071535 | |||
| 405 | Ga0495676_0241909 | |||
| 406 | Ga0495680_0051243 | |||
| 407 | Ga0495684_0030700 | |||
| 408 | Ga0495593_0007747 | |||
| 409 | Ga0496102_0393099 | |||
| 410 | Ga0496104_0008267 | |||
| 411 | Ga0496107_0111002 | |||
| 412 | Ga0496110_0092390 | |||
| 413 | Ga0496115_0068207 | |||
| 414 | Ga0496117_0025092 | |||
| 415 | Ga0496118_0138383 | |||
| 416 | Ga0496121_0006694 | |||
| 417 | Ga0496121_0070537 | |||
| 418 | Ga0496121_0153010 | |||
| 419 | Ga0496124_0122799 | |||
| 420 | Ga0496126_0016441 | |||
| 421 | Ga0496126_0023796 | |||
| 422 | Ga0496126_0151515 | |||
| 423 | Ga0501034_0012100 | |||
| 424 | Ga0501036_0011247 | |||
| 425 | Ga0501038_0011140 | |||
| 426 | Ga0501038_0028283 | |||
| 427 | Ga0501043_0045249 | |||
| 428 | Ga0501047_0015440 | |||
| 429 | Ga0501047_0120911 | |||
| 430 | Ga0501070_0041873 | |||
| 431 | Ga0501070_0172564 | |||
| 432 | Ga0501080_0066038 | |||
| 433 | Ga0501080_0131270 | |||
| 434 | Ga0501035_0177513 | |||
| 435 | Ga0501035_0284880 | |||
| 436 | Ga0501044_0009165 | |||
| 437 | Ga0501044_0020911 | |||
| 438 | Ga0501044_0094879 | |||
| 439 | Ga0495601_0033204 | |||
| 440 | Ga0495601_0072976 | |||
| 441 | Ga0495601_0143276 | |||
| 442 | Ga0495601_0256862 | |||
| 443 | Ga0495612_0037916 | |||
| 444 | Ga0500635_0002943 | |||
| 445 | Ga0500572_020796 | |||
| 446 | Ga0500595_000470 | |||
| 447 | Ga0500614_014450 | |||
| 448 | Ga0500559_0061144 | |||
| 449 | Ga0500603_003329 | |||
| 450 | Ga0500639_057449 | |||
| 451 | Ga0500636_0018731 | |||
| 452 | Ga0500637_0025975 | |||
| 453 | Ga0500637_0032876 | |||
| 454 | Ga0500596_004132 | |||
| 455 | 2644287666 | |||
| 456 | 2883293821 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sz2-assembly1.cif.gz_A | crystal structure of e. coli glucokinase in complex with glucose | 0.9549 | 8 | 321 |
| 1sz2-assembly1.cif.gz_A | crystal structure of e. coli glucokinase in complex with glucose | 0.9288 | 8 | 321 |
| 3vpz-assembly1.cif.gz_A-2 | crystal structure of glucokinase from antarctic psychrotroph at 1.69a | 0.8512 | 9 | 318 |
| 6vzz-assembly1.cif.gz_A-2 | crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose | 0.8299 | 2 | 319 |
| 7wn7-assembly1.cif.gz_A | crystal structure of hearnpv p26 | 0.8202 | 5 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6V8_117_298_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9673 | 125 | 304 | 3.30.420.40 |
| af_P0A6V8_2_105_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9586 | 8 | 112 | 3.30.420.40 |
| af_P0A6V8_117_298_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9519 | 125 | 304 | 3.30.420.40 |
| 3vpzA02 | Alpha Beta;3-Layer(aba) Sandwich;Hexokinase; domain 1; | 0.9345 | 109 | 307 | 3.40.367.20 |
| af_P0A6V8_2_105_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9316 | 8 | 112 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E0TLB8-F1-model_v4 | Glucokinase | 0.9883 | 197 | 316 |
GO:0004340
GO:0005524 GO:0005536 GO:0005829 GO:0006096 |
| AF-A0A327KDW3-F1-model_v4 | Glucokinase | 0.9863 | 185 | 317 |
GO:0004340
GO:0005524 GO:0005536 GO:0005829 GO:0006096 |
| AF-A0A3D5XJT5-F1-model_v4 | deleted | 0.9786 | 180 | 321 |
|
| AF-A0A2X1N584-F1-model_v4 | Glucokinase (EC 2.7.1.2) | 0.9757 | 186 | 304 |
GO:0004340
GO:0005524 GO:0005536 GO:0005829 GO:0006096 |
| AF-A0A357N638-F1-model_v4 | Glucokinase (EC 2.7.1.2) | 0.9753 | 141 | 321 |
GO:0004340
GO:0005524 GO:0005536 GO:0005829 GO:0006096 |