F340925

General Info

Members Datasets Scaffolds Average Seq Length
228 142 228 84

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10258622|Ga0105241_102586223
Length 97
Sequence VIGYDESEVRNMPTLDWSQCPAVESVPGRVSGAWVFRDTRLPIATVIENLEDLSVEEVMEQFDVTREQIAAVLDFVAQSLKASVPEHTSAPIDAHSL

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
122 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
129 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.88
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 6.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10211112 3300005295 Bacteria 1254
2 Ga0065707_10254089 3300005295 Bacteria 1116
3 Ga0065707_10552040 3300005295 Unclassified 720
4 Ga0070658_10520100 3300005327 Bacteria 1029
5 Ga0070683_100039626 3300005329 Bacteria 4327
6 Ga0070666_10034554 3300005335 Bacteria 3350
7 Ga0070682_101704989 3300005337 Unclassified 547
8 Ga0068868_100247919 3300005338 Bacteria 1498
9 Ga0070660_100087176 3300005339 Bacteria 2457
10 Ga0070669_101469102 3300005353 Bacteria 592
11 Ga0070667_100034891 3300005367 Bacteria 4212
12 Ga0070694_100486803 3300005444 Bacteria 980
13 Ga0070708_101145544 3300005445 Unclassified 728
14 Ga0068867_101999289 3300005459 Unclassified 548
15 Ga0070706_100399472 3300005467 Bacteria 1279
16 Ga0070706_102107857 3300005467 Unclassified 510
17 Ga0070707_100037111 3300005468 Plasmid 4650
18 Ga0070707_100869959 3300005468 Bacteria 866
19 Ga0070698_100280172 3300005471 Bacteria 1599
20 Ga0070698_101565691 3300005471 Unclassified 611
21 Ga0070699_100090844 3300005518 Unclassified 2669
22 Ga0070699_100174444 3300005518 Bacteria 1906
23 Ga0070684_100306289 3300005535 Bacteria 1458
24 Ga0070697_100621039 3300005536 Bacteria 951
25 Ga0070697_101038681 3300005536 Bacteria 729
26 Ga0070696_100820435 3300005546 Unclassified 767
27 Ga0070696_101153032 3300005546 Unclassified 653
28 Ga0070704_100329947 3300005549 Bacteria 1281
29 Ga0070704_102239169 3300005549 Unclassified 508
30 Ga0068859_100090929 3300005617 Bacteria 3103
31 Ga0068859_102491212 3300005617 Unclassified 570
32 Ga0068861_100979808 3300005719 Unclassified 806
33 Ga0068863_100282874 3300005841 Bacteria 1607
34 Ga0068858_100022180 3300005842 Bacteria 5929
35 Ga0068858_101562118 3300005842 Unclassified 651
36 Ga0068860_100007850 3300005843 Bacteria 10652
37 Ga0068862_100129017 3300005844 Bacteria 2235
38 Ga0068862_100637712 3300005844 Unclassified 1026
39 Ga0068862_101020030 3300005844 Unclassified 819
40 Ga0068862_101774100 3300005844 Unclassified 626
41 Ga0081455_10005018 3300005937 Bacteria 14642
42 Ga0097621_100027442 3300006237 Bacteria 4477
43 Ga0097621_100462472 3300006237 Unclassified 1144
44 Ga0097621_100774082 3300006237 Unclassified 888
45 Ga0068871_100053012 3300006358 Bacteria 3286
46 Ga0068871_100063169 3300006358 Bacteria 3028
47 Ga0075428_101061901 3300006844 Unclassified 856
48 Ga0075433_10301287 3300006852 Unclassified 1419
49 Ga0075433_10715322 3300006852 Unclassified 877
50 Ga0075433_10881881 3300006852 Bacteria 781
51 Ga0075433_11872220 3300006852 Unclassified 515
52 Ga0075434_100060104 3300006871 Bacteria 3779
53 Ga0075434_100238270 3300006871 Unclassified 1839
54 Ga0075434_101308787 3300006871 Unclassified 735
55 Ga0075429_100731829 3300006880 Unclassified 866
56 Ga0068865_100906052 3300006881 Bacteria 767
57 Ga0075436_100051105 3300006914 Bacteria 2853
58 Ga0075436_100310024 3300006914 Bacteria 1132
59 Ga0075436_100411883 3300006914 Unclassified 980
60 Ga0097620_100090928 3300006931 Bacteria 3103
61 Ga0097620_102491533 3300006931 Unclassified 570
62 Ga0075435_100258422 3300007076 Unclassified 1483
63 Ga0075435_100367726 3300007076 Unclassified 1234
64 Ga0075435_100389658 3300007076 Archaea 1197
65 Ga0105240_10004037 3300009093 Bacteria 22586
66 Ga0111539_10883373 3300009094 Archaea 1040
67 Ga0111539_11032296 3300009094 Unclassified 956
68 Ga0105245_11819137 3300009098 Unclassified 662
69 Ga0105247_10041893 3300009101 Plasmid 2802
70 Ga0105247_10163007 3300009101 Unclassified 1477
71 Ga0114129_10022494 3300009147 Bacteria 8947
72 Ga0114129_10189938 3300009147 Bacteria 2790
73 Ga0114129_10209800 3300009147 Unclassified 2634
74 Ga0114129_11311899 3300009147 Bacteria 897
75 Ga0114129_13077003 3300009147 Unclassified 546
76 Ga0114129_13311782 3300009147 Unclassified 521
77 Ga0105243_12983812 3300009148 Unclassified 513
78 Ga0105241_10258622 3300009174 Bacteria 1479
79 Ga0105242_10071331 3300009176 Bacteria 2882
80 Ga0105242_11122172 3300009176 Unclassified 801
81 Ga0105248_10165892 3300009177 Bacteria 2490
82 Ga0105248_11643136 3300009177 Unclassified 728
83 Ga0105237_10005980 3300009545 Bacteria 13633
84 Ga0105237_12110282 3300009545 Unclassified 573
85 Ga0105238_10431756 3300009551 Unclassified 1313
86 Ga0105249_10110564 3300009553 Bacteria 2597
87 Ga0105239_10017224 3300010375 Bacteria 7989
88 Ga0105246_10009300 3300011119 Bacteria 6051
89 Ga0157374_10153017 3300013296 Bacteria 2244
90 Ga0157378_10356812 3300013297 Unclassified 1430
91 Ga0157378_10502068 3300013297 Bacteria 1212
92 Ga0157378_11108364 3300013297 Unclassified 829
93 Ga0157378_11774271 3300013297 Unclassified 665
94 Ga0163162_13455822 3300013306 Bacteria 503
95 Ga0163163_10008726 3300014325 Bacteria 9018
96 Ga0163163_10722353 3300014325 Bacteria 1060
97 Ga0157380_10032700 3300014326 Bacteria 4004
98 Ga0157380_10295784 3300014326 Unclassified 1489
99 Ga0157380_10351350 3300014326 Bacteria 1380
100 Ga0157380_11443832 3300014326 Unclassified 740
101 Ga0157379_10067115 3300014968 Bacteria 3207
102 Ga0157379_10087390 3300014968 Bacteria 2795
103 Ga0157379_10107180 3300014968 Bacteria 2508
104 Ga0157376_12190225 3300014969 Unclassified 591
105 Ga0163161_11694764 3300017792 Unclassified 560
106 Ga0213873_10291265 3300021358 Unclassified 525
107 Ga0213876_10439343 3300021384 Bacteria 694
108 Ga0213875_10055089 3300021388 Unclassified 1862
109 Ga0213875_10101161 3300021388 Bacteria 1345
110 Ga0207710_10089949 3300025900 Bacteria 1435
111 Ga0207680_10168857 3300025903 Unclassified 1472
112 Ga0207705_10834858 3300025909 Bacteria 715
113 Ga0207705_11267754 3300025909 Unclassified 564
114 Ga0207684_10046809 3300025910 Bacteria 3670
115 Ga0207684_10067841 3300025910 Bacteria 3031
116 Ga0207654_10983298 3300025911 Unclassified 613
117 Ga0207695_10046063 3300025913 Bacteria 4624
118 Ga0207671_10010046 3300025914 Bacteria 7847
119 Ga0207657_10231698 3300025919 Unclassified 1477
120 Ga0207646_10020216 3300025922 Bacteria 6172
121 Ga0207681_10157996 3300025923 Unclassified 1706
122 Ga0207694_10432814 3300025924 Unclassified 1097
123 Ga0207687_10058204 3300025927 Bacteria 2718
124 Ga0207686_10014728 3300025934 Bacteria 4362
125 Ga0207709_10878830 3300025935 Unclassified 727
126 Ga0207704_10799172 3300025938 Bacteria 788
127 Ga0207711_10141531 3300025941 Bacteria 2165
128 Ga0207711_10172861 3300025941 Bacteria 1961
129 Ga0207689_10693461 3300025942 Bacteria 859
130 Ga0207661_10026597 3300025944 Unclassified 4411
131 Ga0207712_10397515 3300025961 Bacteria 1157
132 Ga0207658_10196049 3300025986 Bacteria 1682
133 Ga0207677_10510087 3300026023 Bacteria 1041
134 Ga0207703_10052582 3300026035 Bacteria 3308
135 Ga0207703_11413378 3300026035 Unclassified 669
136 Ga0207708_11525165 3300026075 Bacteria 587
137 Ga0207641_10180840 3300026088 Bacteria 1931
138 Ga0207648_11530974 3300026089 Unclassified 627
139 Ga0207648_11678212 3300026089 Unclassified 597
140 Ga0209966_1077348 3300027695 Unclassified 734
141 Ga0209974_10146204 3300027876 Unclassified 851
142 Ga0207428_10912590 3300027907 Unclassified 620
143 Ga0268265_10178835 3300028380 Unclassified 1821
144 Ga0268265_10571415 3300028380 Bacteria 1076
145 Ga0268264_10015069 3300028381 Bacteria 6342
146 Ga0268264_10649582 3300028381 Bacteria 1044
147 Ga0265332_10131719 3300031238 Bacteria 1049
148 Ga0265325_10489940 3300031241 Unclassified 533
149 Ga0265329_10025427 3300031242 Bacteria 1960
150 Ga0265316_10056924 3300031344 Bacteria 3051
151 Ga0265316_10068264 3300031344 Bacteria 2747
152 Ga0265316_10077904 3300031344 Bacteria 2545
153 Ga0265316_10119362 3300031344 Bacteria 1992
154 Ga0307408_100106318 3300031548 Bacteria 2147
155 Ga0307412_10270689 3300031911 Bacteria 1329
156 Ga0307416_102056204 3300032002 Bacteria 673
157 Ga0307411_10385155 3300032005 Bacteria 1154
158 Ga0307415_100837191 3300032126 Bacteria 843
159 Ga0373926_0110556 3300035083 Unclassified 1032
160 Ga0373943_0849696 3300035170 Unclassified 544
161 Ga0373955_0356970 3300035172 Unclassified 886
162 Ga0373961_0277534 3300035241 Unclassified 614
163 Ga0373937_0446541 3300036401 Unclassified 1228
164 Ga0373937_0571960 3300036401 Unclassified 1073
165 Ga0373937_1052751 3300036401 Bacteria 762
166 Ga0373937_1712348 3300036401 Unclassified 575
167 Ga0373925_0040753 3300037068 Bacteria 3439
168 Ga0373925_1395195 3300037068 Unclassified 574
169 Ga0436364_0175673 3300037853 Bacteria 3885
170 Ga0436364_0349040 3300037853 Unclassified 1584
171 Ga0436364_0594179 3300037853 Bacteria 7525
172 Ga0436364_0982904 3300037853 Unclassified 526
173 Ga0436364_1183489 3300037853 Bacteria 1838
174 Ga0436364_1380910 3300037853 Unclassified 731
175 Ga0436365_0475059 3300039437 Bacteria 1311
176 Ga0436365_0593639 3300039437 Unclassified 629
177 Ga0436360_0640106 3300039438 Unclassified 862
178 Ga0436361_0906483 3300039447 Unclassified 618
179 Ga0436363_0679882 3300039450 Bacteria 968
180 Ga0436363_0847241 3300039450 Bacteria 2175
181 Ga0436363_1602395 3300039450 Bacteria 1701
182 Ga0436362_0588979 3300039453 Unclassified 778
183 Ga0450907_088252 3300042146 Unclassified 539
184 Ga0453683_0681640 3300044673 Unclassified 673
185 Ga0495580_0170948 3300046472 Unclassified 1503
186 Ga0495587_0185969 3300046536 Bacteria 1177
187 Ga0495645_0206504 3300046543 Bacteria 1329
188 Ga0496109_1823281 3300048912 Unclassified 541
189 Ga0496113_1089022 3300048916 Unclassified 627
190 Ga0501296_061112 3300049519 Unclassified 570
191 Ga0501298_027379 3300049521 Bacteria 1102
192 Ga0501039_0107822 3300049575 Unclassified 2177
193 Ga0501046_0527135 3300049580 Unclassified 844
194 Ga0501072_1600337 3300049588 Unclassified 502
195 Ga0501075_0290603 3300049591 Bacteria 1245
196 Ga0501076_0011402 3300049592 Bacteria 6618
197 Ga0501076_0090868 3300049592 Bacteria 2456
198 Ga0501243_067210 3300049675 Bacteria 675
199 Ga0501261_041057 3300049690 Bacteria 730
200 Ga0501081_1091680 3300049743 Unclassified 604
201 Ga0501268_105135 3300049765 Bacteria 610
202 nmdc:mga05p37_13368_c1 3300050507 Bacteria 9835
203 nmdc:mga05p37_208036_c1 3300050507 Bacteria 2366
204 nmdc:mga05p37_2212098_c1 3300050507 Unclassified 510
205 nmdc:mga05p37_30000_c1 3300050507 Bacteria 6636
206 nmdc:mga05p37_367_c1 3300050507 Bacteria 48570
207 nmdc:mga05p37_546906_c1 3300050507 Unclassified 1319
208 nmdc:mga05p37_67920_c1 3300050507 Unclassified 4385
209 nmdc:mga09592_996783_c1 3300050508 Unclassified 700
210 nmdc:mga0qj67_1048676_c1 3300050509 Unclassified 638
211 nmdc:mga08y16_430750_c1 3300050511 Bacteria 1347
212 nmdc:mga08y16_898582_c1 3300050511 Archaea 872
213 nmdc:mga0n895_1298176_c1 3300050512 Bacteria 699
214 nmdc:mga0n895_755800_c1 3300050512 Unclassified 965
215 nmdc:mga0n895_756351_c1 3300050512 Bacteria 965
216 nmdc:mga0n895_77608_c1 3300050512 Unclassified 3304
217 nmdc:mga0rr50_201019_c1 3300050513 Bacteria 1637
218 nmdc:mga08x19_307189_c1 3300050514 Bacteria 1102
219 nmdc:mga08x19_804690_c1 3300050514 Unclassified 667
220 nmdc:mga0a205_1082685_c1 3300050515 Unclassified 649
221 nmdc:mga0a205_261357_c1 3300050515 Bacteria 1609
222 nmdc:mga0a205_43741_c1 3300050515 Bacteria 4317
223 nmdc:mga0a205_95807_c2 3300050515 Unclassified 2473
224 Ga0495619_0610258 3300053085 Unclassified 746
225 Ga0501082_1845436 3300060353 Unclassified 527
226 Ga0530510_0783439 3300061734 Bacteria 727
227 Ga0530510_1208648 3300061734 Unclassified 579
228 Ga0530510_1250787 3300061734 Bacteria 569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0571960 Ga0373937_0571960_582_821 76
2 3300005339 Ga0070660_100087176 Ga0070660_1000871763 77
3 3300006852 Ga0075433_10881881 Ga0075433_108818811 77
4 3300025919 Ga0207657_10231698 Ga0207657_102316982 77
5 3300039450 Ga0436363_0679882 Ga0436363_0679882_404_649 77
6 3300009177 Ga0105248_11643136 Ga0105248_116431362 78
7 3300050514 nmdc:mga08x19_804690_c1 nmdc:mga08x19_804690_c1_189_440 78
8 3300005844 Ga0068862_100637712 Ga0068862_1006377122 79
9 3300028380 Ga0268265_10571415 Ga0268265_105714152 79
10 3300031238 Ga0265332_10131719 Ga0265332_101317194 79
11 3300039453 Ga0436362_0588979 Ga0436362_0588979_410_664 79
12 3300005295 Ga0065707_10254089 Ga0065707_102540892 80
13 3300005329 Ga0070683_100039626 Ga0070683_1000396265 80
14 3300005337 Ga0070682_101704989 Ga0070682_1017049891 80
15 3300005518 Ga0070699_100090844 Ga0070699_1000908444 80
16 3300005535 Ga0070684_100306289 Ga0070684_1003062891 80
17 3300005546 Ga0070696_101153032 Ga0070696_1011530322 80
18 3300005549 Ga0070704_102239169 Ga0070704_1022391692 80
19 3300006852 Ga0075433_10301287 Ga0075433_103012873 80
20 3300006871 Ga0075434_101308787 Ga0075434_1013087871 80
21 3300009093 Ga0105240_10004037 Ga0105240_1000403719 80
22 3300009147 Ga0114129_10189938 Ga0114129_101899383 80
23 3300009147 Ga0114129_11311899 Ga0114129_113118992 80
24 3300009545 Ga0105237_10005980 Ga0105237_100059803 80
25 3300009551 Ga0105238_10431756 Ga0105238_104317562 80
26 3300009553 Ga0105249_10110564 Ga0105249_101105641 80
27 3300010375 Ga0105239_10017224 Ga0105239_100172246 80
28 3300013296 Ga0157374_10153017 Ga0157374_101530173 80
29 3300013297 Ga0157378_11774271 Ga0157378_117742712 80
30 3300025913 Ga0207695_10046063 Ga0207695_100460632 80
31 3300025914 Ga0207671_10010046 Ga0207671_100100466 80
32 3300025924 Ga0207694_10432814 Ga0207694_104328142 80
33 3300025944 Ga0207661_10026597 Ga0207661_100265973 80
34 3300025961 Ga0207712_10397515 Ga0207712_103975151 80
35 3300035172 Ga0373955_0356970 Ga0373955_0356970_98_340 80
36 3300049580 Ga0501046_0527135 Ga0501046_0527135_31_273 80
37 3300049592 Ga0501076_0011402 Ga0501076_0011402_82_324 80
38 3300049743 Ga0501081_1091680 Ga0501081_1091680_138_380 80
39 3300050507 nmdc:mga05p37_208036_c1 nmdc:mga05p37_208036_c1_82_324 80
40 3300050507 nmdc:mga05p37_67920_c1 nmdc:mga05p37_67920_c1_641_883 80
41 3300050512 nmdc:mga0n895_755800_c1 nmdc:mga0n895_755800_c1_264_506 80
42 3300050515 nmdc:mga0a205_261357_c1 nmdc:mga0a205_261357_c1_146_388 80
43 3300053085 Ga0495619_0610258 Ga0495619_0610258_55_297 80
44 3300061734 Ga0530510_0783439 Ga0530510_0783439_152_394 80
45 3300005295 Ga0065707_10211112 Ga0065707_102111122 81
46 3300005295 Ga0065707_10552040 Ga0065707_105520402 81
47 3300005327 Ga0070658_10520100 Ga0070658_105201002 81
48 3300005335 Ga0070666_10034554 Ga0070666_100345544 81
49 3300005338 Ga0068868_100247919 Ga0068868_1002479192 81
50 3300005353 Ga0070669_101469102 Ga0070669_1014691021 81
51 3300005367 Ga0070667_100034891 Ga0070667_1000348915 81
52 3300005444 Ga0070694_100486803 Ga0070694_1004868032 81
53 3300005445 Ga0070708_101145544 Ga0070708_1011455442 81
54 3300005459 Ga0068867_101999289 Ga0068867_1019992892 81
55 3300005467 Ga0070706_100399472 Ga0070706_1003994721 81
56 3300005467 Ga0070706_102107857 Ga0070706_1021078571 81
57 3300005468 Ga0070707_100037111 Ga0070707_1000371114 81
58 3300005468 Ga0070707_100869959 Ga0070707_1008699592 81
59 3300005471 Ga0070698_100280172 Ga0070698_1002801722 81
60 3300005471 Ga0070698_101565691 Ga0070698_1015656911 81
61 3300005518 Ga0070699_100174444 Ga0070699_1001744442 81
62 3300005536 Ga0070697_100621039 Ga0070697_1006210392 81
63 3300005536 Ga0070697_101038681 Ga0070697_1010386811 81
64 3300005546 Ga0070696_100820435 Ga0070696_1008204352 81
65 3300005549 Ga0070704_100329947 Ga0070704_1003299473 81
66 3300005617 Ga0068859_100090929 Ga0068859_1000909293 81
67 3300005617 Ga0068859_102491212 Ga0068859_1024912121 81
68 3300005719 Ga0068861_100979808 Ga0068861_1009798082 81
69 3300005841 Ga0068863_100282874 Ga0068863_1002828743 81
70 3300005842 Ga0068858_100022180 Ga0068858_1000221803 81
71 3300005842 Ga0068858_101562118 Ga0068858_1015621182 81
72 3300005843 Ga0068860_100007850 Ga0068860_10000785011 81
73 3300005844 Ga0068862_100129017 Ga0068862_1001290174 81
74 3300005844 Ga0068862_101020030 Ga0068862_1010200302 81
75 3300005844 Ga0068862_101774100 Ga0068862_1017741002 81
76 3300005937 Ga0081455_10005018 Ga0081455_1000501811 81
77 3300006237 Ga0097621_100027442 Ga0097621_1000274423 81
78 3300006237 Ga0097621_100462472 Ga0097621_1004624723 81
79 3300006237 Ga0097621_100774082 Ga0097621_1007740822 81
80 3300006358 Ga0068871_100053012 Ga0068871_1000530123 81
81 3300006358 Ga0068871_100063169 Ga0068871_1000631692 81
82 3300006844 Ga0075428_101061901 Ga0075428_1010619012 81
83 3300006852 Ga0075433_10715322 Ga0075433_107153222 81
84 3300006852 Ga0075433_11872220 Ga0075433_118722201 81
85 3300006871 Ga0075434_100060104 Ga0075434_10006010410 81
86 3300006871 Ga0075434_100238270 Ga0075434_1002382703 81
87 3300006880 Ga0075429_100731829 Ga0075429_1007318291 81
88 3300006881 Ga0068865_100906052 Ga0068865_1009060521 81
89 3300006914 Ga0075436_100051105 Ga0075436_1000511053 81
90 3300006914 Ga0075436_100310024 Ga0075436_1003100242 81
91 3300006914 Ga0075436_100411883 Ga0075436_1004118832 81
92 3300006931 Ga0097620_100090928 Ga0097620_1000909282 81
93 3300006931 Ga0097620_102491533 Ga0097620_1024915331 81
94 3300007076 Ga0075435_100258422 Ga0075435_1002584223 81
95 3300007076 Ga0075435_100367726 Ga0075435_1003677263 81
96 3300007076 Ga0075435_100389658 Ga0075435_1003896583 81
97 3300009094 Ga0111539_10883373 Ga0111539_108833731 81
98 3300009094 Ga0111539_11032296 Ga0111539_110322962 81
99 3300009098 Ga0105245_11819137 Ga0105245_118191371 81
100 3300009101 Ga0105247_10041893 Ga0105247_100418935 81
101 3300009101 Ga0105247_10163007 Ga0105247_101630071 81
102 3300009147 Ga0114129_10022494 Ga0114129_100224949 81
103 3300009147 Ga0114129_10209800 Ga0114129_102098003 81
104 3300009147 Ga0114129_13077003 Ga0114129_130770031 81
105 3300009147 Ga0114129_13311782 Ga0114129_133117821 81
106 3300009148 Ga0105243_12983812 Ga0105243_129838122 81
107 3300009174 Ga0105241_10258622 Ga0105241_102586223 81
108 3300009176 Ga0105242_10071331 Ga0105242_100713312 81
109 3300009176 Ga0105242_11122172 Ga0105242_111221721 81
110 3300009177 Ga0105248_10165892 Ga0105248_101658922 81
111 3300009545 Ga0105237_12110282 Ga0105237_121102822 81
112 3300011119 Ga0105246_10009300 Ga0105246_100093002 81
113 3300013297 Ga0157378_10356812 Ga0157378_103568122 81
114 3300013297 Ga0157378_10502068 Ga0157378_105020681 81
115 3300013297 Ga0157378_11108364 Ga0157378_111083641 81
116 3300013306 Ga0163162_13455822 Ga0163162_134558221 81
117 3300014325 Ga0163163_10008726 Ga0163163_1000872619 81
118 3300014325 Ga0163163_10722353 Ga0163163_107223532 81
119 3300014326 Ga0157380_10032700 Ga0157380_100327005 81
120 3300014326 Ga0157380_10295784 Ga0157380_102957841 81
121 3300014326 Ga0157380_10351350 Ga0157380_103513502 81
122 3300014326 Ga0157380_11443832 Ga0157380_114438322 81
123 3300014968 Ga0157379_10067115 Ga0157379_100671154 81
124 3300014968 Ga0157379_10087390 Ga0157379_100873901 81
125 3300014968 Ga0157379_10107180 Ga0157379_101071803 81
126 3300014969 Ga0157376_12190225 Ga0157376_121902252 81
127 3300017792 Ga0163161_11694764 Ga0163161_116947642 81
128 3300021358 Ga0213873_10291265 Ga0213873_102912651 81
129 3300021384 Ga0213876_10439343 Ga0213876_104393432 81
130 3300021388 Ga0213875_10055089 Ga0213875_100550894 81
131 3300021388 Ga0213875_10101161 Ga0213875_101011612 81
132 3300025900 Ga0207710_10089949 Ga0207710_100899492 81
133 3300025903 Ga0207680_10168857 Ga0207680_101688574 81
134 3300025909 Ga0207705_10834858 Ga0207705_108348582 81
135 3300025909 Ga0207705_11267754 Ga0207705_112677542 81
136 3300025910 Ga0207684_10046809 Ga0207684_100468092 81
137 3300025910 Ga0207684_10067841 Ga0207684_100678414 81
138 3300025911 Ga0207654_10983298 Ga0207654_109832982 81
139 3300025922 Ga0207646_10020216 Ga0207646_100202167 81
140 3300025923 Ga0207681_10157996 Ga0207681_101579962 81
141 3300025927 Ga0207687_10058204 Ga0207687_100582042 81
142 3300025934 Ga0207686_10014728 Ga0207686_100147282 81
143 3300025935 Ga0207709_10878830 Ga0207709_108788301 81
144 3300025938 Ga0207704_10799172 Ga0207704_107991722 81
145 3300025941 Ga0207711_10141531 Ga0207711_101415313 81
146 3300025941 Ga0207711_10172861 Ga0207711_101728614 81
147 3300025942 Ga0207689_10693461 Ga0207689_106934613 81
148 3300025986 Ga0207658_10196049 Ga0207658_101960492 81
149 3300026023 Ga0207677_10510087 Ga0207677_105100872 81
150 3300026035 Ga0207703_10052582 Ga0207703_100525824 81
151 3300026035 Ga0207703_11413378 Ga0207703_114133782 81
152 3300026075 Ga0207708_11525165 Ga0207708_115251651 81
153 3300026088 Ga0207641_10180840 Ga0207641_101808402 81
154 3300026089 Ga0207648_11530974 Ga0207648_115309741 81
155 3300026089 Ga0207648_11678212 Ga0207648_116782121 81
156 3300027695 Ga0209966_1077348 Ga0209966_10773481 81
157 3300027876 Ga0209974_10146204 Ga0209974_101462042 81
158 3300027907 Ga0207428_10912590 Ga0207428_109125902 81
159 3300028380 Ga0268265_10178835 Ga0268265_101788352 81
160 3300028381 Ga0268264_10015069 Ga0268264_100150693 81
161 3300028381 Ga0268264_10649582 Ga0268264_106495821 81
162 3300031241 Ga0265325_10489940 Ga0265325_104899402 81
163 3300031242 Ga0265329_10025427 Ga0265329_100254273 81
164 3300031344 Ga0265316_10056924 Ga0265316_100569242 81
165 3300031344 Ga0265316_10068264 Ga0265316_100682642 81
166 3300031344 Ga0265316_10077904 Ga0265316_100779043 81
167 3300031344 Ga0265316_10119362 Ga0265316_101193623 81
168 3300031548 Ga0307408_100106318 Ga0307408_1001063182 81
169 3300031911 Ga0307412_10270689 Ga0307412_102706892 81
170 3300032002 Ga0307416_102056204 Ga0307416_1020562042 81
171 3300032005 Ga0307411_10385155 Ga0307411_103851552 81
172 3300032126 Ga0307415_100837191 Ga0307415_1008371912 81
173 3300035083 Ga0373926_0110556 Ga0373926_0110556_219_479 81
174 3300035170 Ga0373943_0849696 Ga0373943_0849696_163_423 81
175 3300035241 Ga0373961_0277534 Ga0373961_0277534_299_544 81
176 3300036401 Ga0373937_0446541 Ga0373937_0446541_226_486 81
177 3300036401 Ga0373937_1052751 Ga0373937_1052751_16_261 81
178 3300036401 Ga0373937_1712348 Ga0373937_1712348_288_542 81
179 3300037068 Ga0373925_0040753 Ga0373925_0040753_3059_3319 81
180 3300037068 Ga0373925_1395195 Ga0373925_1395195_18_263 81
181 3300037853 Ga0436364_0175673 Ga0436364_0175673_3499_3759 81
182 3300037853 Ga0436364_0349040 Ga0436364_0349040_1236_1502 81
183 3300037853 Ga0436364_0594179 Ga0436364_0594179_6802_7092 81
184 3300037853 Ga0436364_0982904 Ga0436364_0982904_193_453 81
185 3300037853 Ga0436364_1183489 Ga0436364_1183489_440_700 81
186 3300037853 Ga0436364_1380910 Ga0436364_1380910_364_624 81
187 3300039437 Ga0436365_0475059 Ga0436365_0475059_64_324 81
188 3300039437 Ga0436365_0593639 Ga0436365_0593639_320_580 81
189 3300039438 Ga0436360_0640106 Ga0436360_0640106_51_311 81
190 3300039447 Ga0436361_0906483 Ga0436361_0906483_260_520 81
191 3300039450 Ga0436363_0847241 Ga0436363_0847241_1808_2068 81
192 3300039450 Ga0436363_1602395 Ga0436363_1602395_105_365 81
193 3300042146 Ga0450907_088252 Ga0450907_088252_151_396 81
194 3300044673 Ga0453683_0681640 Ga0453683_0681640_260_520 81
195 3300046472 Ga0495580_0170948 Ga0495580_0170948_1050_1310 81
196 3300046536 Ga0495587_0185969 Ga0495587_0185969_48_308 81
197 3300046543 Ga0495645_0206504 Ga0495645_0206504_833_1093 81
198 3300048912 Ga0496109_1823281 Ga0496109_1823281_233_493 81
199 3300048916 Ga0496113_1089022 Ga0496113_1089022_245_505 81
200 3300049519 Ga0501296_061112 Ga0501296_061112_271_516 81
201 3300049521 Ga0501298_027379 Ga0501298_027379_532_777 81
202 3300049575 Ga0501039_0107822 Ga0501039_0107822_282_539 81
203 3300049588 Ga0501072_1600337 Ga0501072_1600337_28_285 81
204 3300049591 Ga0501075_0290603 Ga0501075_0290603_89_334 81
205 3300049592 Ga0501076_0090868 Ga0501076_0090868_669_914 81
206 3300049675 Ga0501243_067210 Ga0501243_067210_257_502 81
207 3300049690 Ga0501261_041057 Ga0501261_041057_150_395 81
208 3300049765 Ga0501268_105135 Ga0501268_105135_149_394 81
209 3300050507 nmdc:mga05p37_13368_c1 nmdc:mga05p37_13368_c1_9463_9720 81
210 3300050507 nmdc:mga05p37_2212098_c1 nmdc:mga05p37_2212098_c1_191_436 81
211 3300050507 nmdc:mga05p37_30000_c1 nmdc:mga05p37_30000_c1_2398_2643 81
212 3300050507 nmdc:mga05p37_367_c1 nmdc:mga05p37_367_c1_37820_38086 81
213 3300050507 nmdc:mga05p37_546906_c1 nmdc:mga05p37_546906_c1_243_488 81
214 3300050508 nmdc:mga09592_996783_c1 nmdc:mga09592_996783_c1_203_460 81
215 3300050509 nmdc:mga0qj67_1048676_c1 nmdc:mga0qj67_1048676_c1_50_304 81
216 3300050511 nmdc:mga08y16_430750_c1 nmdc:mga08y16_430750_c1_460_705 81
217 3300050511 nmdc:mga08y16_898582_c1 nmdc:mga08y16_898582_c1_574_819 81
218 3300050512 nmdc:mga0n895_1298176_c1 nmdc:mga0n895_1298176_c1_18_263 81
219 3300050512 nmdc:mga0n895_756351_c1 nmdc:mga0n895_756351_c1_230_475 81
220 3300050512 nmdc:mga0n895_77608_c1 nmdc:mga0n895_77608_c1_951_1211 81
221 3300050513 nmdc:mga0rr50_201019_c1 nmdc:mga0rr50_201019_c1_774_1034 81
222 3300050514 nmdc:mga08x19_307189_c1 nmdc:mga08x19_307189_c1_48_293 81
223 3300050515 nmdc:mga0a205_1082685_c1 nmdc:mga0a205_1082685_c1_203_448 81
224 3300050515 nmdc:mga0a205_43741_c1 nmdc:mga0a205_43741_c1_3573_3818 81
225 3300050515 nmdc:mga0a205_95807_c2 nmdc:mga0a205_95807_c2_2068_2313 81
226 3300060353 Ga0501082_1845436 Ga0501082_1845436_248_493 81
227 3300061734 Ga0530510_1208648 Ga0530510_1208648_191_448 81
228 3300061734 Ga0530510_1250787 Ga0530510_1250787_50_295 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04255

DUF433

Protein of unknown function (DUF433)

23

76

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jp0-assembly1.cif.gz_A crystal structure of cry35ab1 0.8852 31 63
5af3-assembly1.cif.gz_B x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8798 12 62
5af3-assembly1.cif.gz_A x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8788 12 62
5ey0-assembly1.cif.gz_B crystal structure of cody from staphylococcus aureus with gtp and ile 0.72 34 68
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.7142 7 73
ID Description Score Start End Superfamily
4jp0A03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8896 33 63 1.10.10.60
af_H2KY86_676_859_1.10.3380.20 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.8242 33 72 1.10.3380.20
1fseD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8118 35 70 1.10.10.10
4jp0A03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8063 33 63 1.10.10.60
1zr4E03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8055 28 63 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1A8XHR1-F1-model_v4 DUF433 domain-containing protein 0.9677 4 72
AF-A0A450YIL6-F1-model_v4 Uncharacterized conserved protein, DUF433 family 0.9624 5 71
AF-A0A3C1ST58-F1-model_v4 DUF433 domain-containing protein 0.9605 4 72
AF-A0A450TSN4-F1-model_v4 Uncharacterized conserved protein, DUF433 family 0.9565 5 71
AF-A0A7V5VNF4-F1-model_v4 DUF433 domain-containing protein 0.9557 3 72

Feature Viewer

pLDDT pTM Quality
84.81 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map