F340907

General Info

Members Datasets Scaffolds Average Seq Length
228 131 456 194

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10033026|Ga0114129_100330265
Length 213
Sequence MPEVHVPKLDDHDGGRIDRTMKRICVFAGSSAGRQAGYRTAAEALGRELAARGIGLVYGGARVGLMGALADTVLASNGHVTGVIPAALVAKEVAHDGLDDLRVVASMHERKAVMADLADGFVALPGGLGTLEEFFEVLTWAQLGLHLKPCGLLNVHGYFDRLLSFVDHAIEQQFIRSQYRAMIITSESPRVLLERLALYQPPVVEKWIDVAAT

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10033026 3300009147 Bacteria 7313
2 Ga0070676_10080299 3300005328 Bacteria 1977
3 Ga0070670_100009830 3300005331 Bacteria 8173
4 Ga0070670_100123914 3300005331 Bacteria 2230
5 Ga0070666_10536492 3300005335 Bacteria 850
6 Ga0068868_100174873 3300005338 Bacteria 1779
7 Ga0070689_100156322 3300005340 Bacteria 1841
8 Ga0070669_100059481 3300005353 Bacteria 2806
9 Ga0070669_100118704 3300005353 Bacteria 2015
10 Ga0070675_100020419 3300005354 Bacteria 5287
11 Ga0070673_100039772 3300005364 Bacteria 3602
12 Ga0070673_100292549 3300005364 Bacteria 1432
13 Ga0070673_100924098 3300005364 Bacteria 810
14 Ga0070688_100111591 3300005365 Bacteria 1819
15 Ga0070688_100514500 3300005365 Bacteria 905
16 Ga0070659_100777386 3300005366 Bacteria 832
17 Ga0070667_101035239 3300005367 Bacteria 766
18 Ga0070714_100042881 3300005435 Bacteria 3824
19 Ga0070701_10280582 3300005438 Bacteria 1017
20 Ga0070678_100490385 3300005456 Unclassified 1083
21 Ga0070662_100513632 3300005457 Bacteria 1000
22 Ga0070706_100013882 3300005467 Bacteria 7446
23 Ga0070707_100071518 3300005468 Bacteria 3342
24 Ga0070698_100124940 3300005471 Bacteria 2530
25 Ga0070697_100706846 3300005536 Bacteria 889
26 Ga0070696_100084512 3300005546 Bacteria 2252
27 Ga0070665_100341268 3300005548 Bacteria 1503
28 Ga0070704_100197608 3300005549 Bacteria 1621
29 Ga0070664_100019452 3300005564 Bacteria 5587
30 Ga0070702_100038854 3300005615 Bacteria 2653
31 Ga0070702_100659727 3300005615 Bacteria 792
32 Ga0068859_100662486 3300005617 Bacteria 1135
33 Ga0068859_101186170 3300005617 Bacteria 841
34 Ga0068861_100434940 3300005719 Bacteria 1172
35 Ga0068861_100689650 3300005719 Bacteria 948
36 Ga0068858_100117852 3300005842 Bacteria 2482
37 Ga0068860_100450784 3300005843 Bacteria 1279
38 Ga0068860_101405861 3300005843 Bacteria 719
39 Ga0068862_100069412 3300005844 Bacteria 3042
40 Ga0068862_100548155 3300005844 Bacteria 1104
41 Ga0068862_100920193 3300005844 Bacteria 861
42 Ga0075432_10057849 3300006058 Bacteria 1376
43 Ga0097621_100104275 3300006237 Bacteria 2389
44 Ga0097621_100155789 3300006237 Bacteria 1961
45 Ga0068871_100005768 3300006358 Bacteria 8697
46 Ga0068871_100010726 3300006358 Bacteria 6700
47 Ga0068871_100412966 3300006358 Bacteria 1204
48 Ga0068871_100556887 3300006358 Bacteria 1039
49 Ga0075428_100033493 3300006844 Bacteria 5673
50 Ga0075428_100035689 3300006844 Bacteria 5480
51 Ga0075430_100011695 3300006846 Bacteria 7469
52 Ga0075430_100066698 3300006846 Bacteria 3022
53 Ga0075431_100031789 3300006847 Bacteria 5437
54 Ga0075431_100331178 3300006847 Bacteria 1533
55 Ga0075431_100555782 3300006847 Unclassified 1135
56 Ga0075433_10002822 3300006852 Bacteria 13291
57 Ga0075433_10007045 3300006852 Bacteria 8905
58 Ga0075434_100002971 3300006871 Bacteria 15086
59 Ga0075434_100013622 3300006871 Bacteria 7750
60 Ga0075429_100095530 3300006880 Bacteria 2592
61 Ga0075429_100346065 3300006880 Bacteria 1301
62 Ga0068865_100024580 3300006881 Bacteria 3954
63 Ga0068865_100033286 3300006881 Bacteria 3450
64 Ga0097620_100662550 3300006931 Bacteria 1135
65 Ga0097620_101186097 3300006931 Bacteria 841
66 Ga0075435_100001488 3300007076 Bacteria 15058
67 Ga0111539_10000841 3300009094 Bacteria 39945
68 Ga0111539_10001210 3300009094 Bacteria 34346
69 Ga0111539_10107872 3300009094 Bacteria 3267
70 Ga0111539_10654278 3300009094 Bacteria 1223
71 Ga0111539_11167349 3300009094 Bacteria 895
72 Ga0111539_11320823 3300009094 Bacteria 837
73 Ga0105245_10015761 3300009098 Bacteria 6592
74 Ga0114129_10213034 3300009147 Bacteria 2611
75 Ga0114129_10407909 3300009147 Bacteria 1790
76 Ga0105243_10256970 3300009148 Bacteria 1562
77 Ga0105243_11631260 3300009148 Bacteria 672
78 Ga0105242_10005753 3300009176 Bacteria 9558
79 Ga0105248_10073111 3300009177 Bacteria 3853
80 Ga0105248_10234463 3300009177 Bacteria 2066
81 Ga0105248_10328125 3300009177 Bacteria 1723
82 Ga0105248_10463432 3300009177 Bacteria 1428
83 Ga0105249_10505236 3300009553 Bacteria 1254
84 Ga0105239_10100965 3300010375 Bacteria 3192
85 Ga0157378_10059994 3300013297 Bacteria 3395
86 Ga0157378_10284110 3300013297 Bacteria 1596
87 Ga0157378_11177057 3300013297 Bacteria 805
88 Ga0163162_10033615 3300013306 Bacteria 5097
89 Ga0163162_10729919 3300013306 Bacteria 1111
90 Ga0157375_10056185 3300013308 Bacteria 3885
91 Ga0157375_10129498 3300013308 Bacteria 2642
92 Ga0163163_10040331 3300014325 Bacteria 4559
93 Ga0157380_10045493 3300014326 Bacteria 3444
94 Ga0157380_10058065 3300014326 Bacteria 3084
95 Ga0157376_10040724 3300014969 Bacteria 3799
96 Ga0207680_10117284 3300025903 Bacteria 1736
97 Ga0207684_10012303 3300025910 Bacteria 7448
98 Ga0207646_10113809 3300025922 Bacteria 2429
99 Ga0207681_10025304 3300025923 Bacteria 3817
100 Ga0207681_10252332 3300025923 Bacteria 1378
101 Ga0207681_10306913 3300025923 Bacteria 1257
102 Ga0207659_10015541 3300025926 Bacteria 4935
103 Ga0207659_10151990 3300025926 Bacteria 1809
104 Ga0207687_10008396 3300025927 Bacteria 6757
105 Ga0207690_10399838 3300025932 Bacteria 1095
106 Ga0207706_10071750 3300025933 Bacteria 3046
107 Ga0207686_10055906 3300025934 Bacteria 2478
108 Ga0207670_10257419 3300025936 Bacteria 1351
109 Ga0207669_10161591 3300025937 Bacteria 1583
110 Ga0207669_10683723 3300025937 Bacteria 842
111 Ga0207691_10385864 3300025940 Unclassified 1196
112 Ga0207711_10264298 3300025941 Bacteria 1582
113 Ga0207711_10369100 3300025941 Bacteria 1331
114 Ga0207689_10397122 3300025942 Bacteria 1149
115 Ga0207651_10001223 3300025960 Bacteria 11524
116 Ga0207651_10158883 3300025960 Bacteria 1769
117 Ga0207677_10118986 3300026023 Bacteria 1983
118 Ga0207677_10581474 3300026023 Bacteria 980
119 Ga0207676_10190979 3300026095 Bacteria 1802
120 Ga0207675_100293785 3300026118 Bacteria 1581
121 Ga0207675_100817794 3300026118 Bacteria 946
122 Ga0207683_10021640 3300026121 Bacteria 5510
123 Ga0207428_10003914 3300027907 Bacteria 14288
124 Ga0207428_10005751 3300027907 Bacteria 11517
125 Ga0207428_10023349 3300027907 Bacteria 5201
126 Ga0207428_10285842 3300027907 Bacteria 1223
127 Ga0268266_10727579 3300028379 Unclassified 957
128 Ga0268265_10133964 3300028380 Bacteria 2064
129 Ga0268265_10212119 3300028380 Bacteria 1688
130 Ga0307513_10015064 3300031456 Bacteria 9384
131 Ga0316577_10022938 3300031733 Bacteria 3466
132 Ga0316582_0112177 3300036647 Bacteria 1816
133 Ga0316581_0089249 3300037588 Bacteria 949
134 Ga0395901_0388684 3300038443 Bacteria 1435
135 Ga0436365_0158457 3300039437 Bacteria 3110
136 Ga0439466_0120640 3300041411 Bacteria 810
137 Ga0453684_0215282 3300044712 Bacteria 2229
138 Ga0451576_0431115 3300045051 Bacteria 1383
139 Ga0495592_0126242 3300046454 Bacteria 1795
140 Ga0495603_0103864 3300046455 Unclassified 1658
141 Ga0495604_0513930 3300047317 Bacteria 776
142 Ga0501031_0373327 3300049568 Bacteria 923
143 Ga0501034_0018415 3300049571 Bacteria 7161
144 Ga0501036_0062121 3300049572 Bacteria 3164
145 Ga0501036_0468457 3300049572 Bacteria 1049
146 Ga0501036_0825186 3300049572 Bacteria 763
147 Ga0501037_0118992 3300049573 Bacteria 1900
148 Ga0501037_0128280 3300049573 Bacteria 1820
149 Ga0501038_0327397 3300049574 Bacteria 1197
150 Ga0501039_0004386 3300049575 Bacteria 10639
151 Ga0501040_0038867 3300049576 Bacteria 3235
152 Ga0501040_0052864 3300049576 Bacteria 2781
153 Ga0501040_0125476 3300049576 Bacteria 1803
154 Ga0501041_0008618 3300049577 Bacteria 6007
155 Ga0501042_0123651 3300049578 Bacteria 1863
156 Ga0501043_0023153 3300049579 Bacteria 4873
157 Ga0501043_0104213 3300049579 Bacteria 2229
158 Ga0501046_0025924 3300049580 Bacteria 4792
159 Ga0501046_0405555 3300049580 Bacteria 984
160 Ga0501047_0313731 3300049581 Unclassified 1408
161 Ga0501048_0005837 3300049582 Bacteria 9364
162 Ga0501048_0029168 3300049582 Bacteria 4003
163 Ga0501068_0053855 3300049584 Bacteria 2437
164 Ga0501068_0143808 3300049584 Bacteria 1496
165 Ga0501070_0303331 3300049586 Bacteria 1301
166 Ga0501071_0012296 3300049587 Bacteria 5800
167 Ga0501071_0135732 3300049587 Bacteria 1830
168 Ga0501071_0565457 3300049587 Bacteria 874
169 Ga0501072_0005406 3300049588 Bacteria 9726
170 Ga0501072_0021272 3300049588 Bacteria 5031
171 Ga0501072_0594618 3300049588 Bacteria 872
172 Ga0501073_0415129 3300049589 Unclassified 930
173 Ga0501074_0084904 3300049590 Bacteria 2269
174 Ga0501074_0143495 3300049590 Bacteria 1707
175 Ga0501075_0003694 3300049591 Bacteria 10274
176 Ga0501075_0044956 3300049591 Bacteria 3313
177 Ga0501075_0139303 3300049591 Bacteria 1848
178 Ga0501075_0284996 3300049591 Bacteria 1258
179 Ga0501076_0007136 3300049592 Bacteria 8122
180 Ga0501076_0419108 3300049592 Bacteria 1101
181 Ga0501077_0129211 3300049593 Bacteria 1602
182 Ga0501079_0004165 3300049741 Bacteria 10715
183 Ga0501079_0032237 3300049741 Bacteria 4028
184 Ga0501079_0075457 3300049741 Bacteria 2607
185 Ga0501079_0340040 3300049741 Bacteria 1176
186 Ga0501080_0056017 3300049742 Bacteria 3672
187 Ga0501080_0072370 3300049742 Bacteria 3207
188 Ga0501080_0091189 3300049742 Bacteria 2831
189 Ga0501081_0000826 3300049743 Bacteria 18324
190 Ga0501081_0001023 3300049743 Bacteria 16707
191 Ga0501083_0068484 3300049744 Bacteria 2362
192 Ga0501083_0123847 3300049744 Bacteria 1695
193 Ga0501035_0155269 3300049822 Unclassified 1984
194 Ga0501035_0350474 3300049822 Bacteria 1235
195 Ga0501044_0037236 3300049823 Bacteria 5086
196 Ga0501044_0613831 3300049823 Bacteria 980
197 Ga0501045_0000631 3300049824 Bacteria 22221
198 Ga0501045_0081624 3300049824 Bacteria 2384
199 Ga0501045_0247196 3300049824 Bacteria 1328
200 nmdc:mga05p37_292692_c1 3300050507 Bacteria 1938
201 nmdc:mga05p37_44162_c1 3300050507 Bacteria 5483
202 nmdc:mga09592_322150_c1 3300050508 Bacteria 1339
203 nmdc:mga0qj67_109171_c1 3300050509 Bacteria 2233
204 nmdc:mga0qj67_194376_c1 3300050509 Bacteria 1649
205 nmdc:mga06r32_15530_c1 3300050510 Bacteria 6915
206 nmdc:mga06r32_243008_c1 3300050510 Bacteria 1788
207 nmdc:mga06r32_253871_c1 3300050510 Bacteria 1746
208 nmdc:mga06r32_333142_c1 3300050510 Bacteria 1503
209 nmdc:mga08y16_1689_c1 3300050511 Bacteria 22402
210 nmdc:mga08y16_187240_c1 3300050511 Bacteria 2148
211 nmdc:mga08y16_19223_c1 3300050511 Bacteria 7199
212 nmdc:mga08y16_4336_c1 3300050511 Bacteria 14820
213 nmdc:mga08y16_508758_c1 3300050511 Bacteria 1223
214 nmdc:mga0n895_2626_c1 3300050512 Bacteria 14149
215 nmdc:mga0n895_998412_c1 3300050512 Bacteria 818
216 nmdc:mga0rr50_587_c1 3300050513 Bacteria 19500
217 nmdc:mga0a205_106323_c1 3300050515 Bacteria 2704
218 nmdc:mga0a205_96_c1 3300050515 Bacteria 49838
219 Ga0495601_0462120 3300053077 Bacteria 820
220 Ga0500555_007661 3300053103 Bacteria 3069
221 Ga0501084_0001645 3300054114 Bacteria 17764
222 Ga0501084_0004567 3300054114 Bacteria 11318
223 Ga0501084_0061194 3300054114 Bacteria 3152
224 Ga0501084_0337688 3300054114 Bacteria 1273
225 Ga0501082_0001706 3300060353 Bacteria 19391
226 Ga0501082_0174514 3300060353 Bacteria 1869
227 Ga0501082_0222823 3300060353 Bacteria 1641
228 Ga0530510_0002666 3300061734 Bacteria 12265
229 Ga0114129_10033026
230 Ga0070676_10080299
231 Ga0070670_100009830
232 Ga0070670_100123914
233 Ga0070666_10536492
234 Ga0068868_100174873
235 Ga0070689_100156322
236 Ga0070669_100059481
237 Ga0070669_100118704
238 Ga0070675_100020419
239 Ga0070673_100039772
240 Ga0070673_100292549
241 Ga0070673_100924098
242 Ga0070688_100111591
243 Ga0070688_100514500
244 Ga0070659_100777386
245 Ga0070667_101035239
246 Ga0070714_100042881
247 Ga0070701_10280582
248 Ga0070678_100490385
249 Ga0070662_100513632
250 Ga0070706_100013882
251 Ga0070707_100071518
252 Ga0070698_100124940
253 Ga0070697_100706846
254 Ga0070696_100084512
255 Ga0070665_100341268
256 Ga0070704_100197608
257 Ga0070664_100019452
258 Ga0070702_100038854
259 Ga0070702_100659727
260 Ga0068859_100662486
261 Ga0068859_101186170
262 Ga0068861_100434940
263 Ga0068861_100689650
264 Ga0068858_100117852
265 Ga0068860_100450784
266 Ga0068860_101405861
267 Ga0068862_100069412
268 Ga0068862_100548155
269 Ga0068862_100920193
270 Ga0075432_10057849
271 Ga0097621_100104275
272 Ga0097621_100155789
273 Ga0068871_100005768
274 Ga0068871_100010726
275 Ga0068871_100412966
276 Ga0068871_100556887
277 Ga0075428_100033493
278 Ga0075428_100035689
279 Ga0075430_100011695
280 Ga0075430_100066698
281 Ga0075431_100031789
282 Ga0075431_100331178
283 Ga0075431_100555782
284 Ga0075433_10002822
285 Ga0075433_10007045
286 Ga0075434_100002971
287 Ga0075434_100013622
288 Ga0075429_100095530
289 Ga0075429_100346065
290 Ga0068865_100024580
291 Ga0068865_100033286
292 Ga0097620_100662550
293 Ga0097620_101186097
294 Ga0075435_100001488
295 Ga0111539_10000841
296 Ga0111539_10001210
297 Ga0111539_10107872
298 Ga0111539_10654278
299 Ga0111539_11167349
300 Ga0111539_11320823
301 Ga0105245_10015761
302 Ga0114129_10213034
303 Ga0114129_10407909
304 Ga0105243_10256970
305 Ga0105243_11631260
306 Ga0105242_10005753
307 Ga0105248_10073111
308 Ga0105248_10234463
309 Ga0105248_10328125
310 Ga0105248_10463432
311 Ga0105249_10505236
312 Ga0105239_10100965
313 Ga0157378_10059994
314 Ga0157378_10284110
315 Ga0157378_11177057
316 Ga0163162_10033615
317 Ga0163162_10729919
318 Ga0157375_10056185
319 Ga0157375_10129498
320 Ga0163163_10040331
321 Ga0157380_10045493
322 Ga0157380_10058065
323 Ga0157376_10040724
324 Ga0207680_10117284
325 Ga0207684_10012303
326 Ga0207646_10113809
327 Ga0207681_10025304
328 Ga0207681_10252332
329 Ga0207681_10306913
330 Ga0207659_10015541
331 Ga0207659_10151990
332 Ga0207687_10008396
333 Ga0207690_10399838
334 Ga0207706_10071750
335 Ga0207686_10055906
336 Ga0207670_10257419
337 Ga0207669_10161591
338 Ga0207669_10683723
339 Ga0207691_10385864
340 Ga0207711_10264298
341 Ga0207711_10369100
342 Ga0207689_10397122
343 Ga0207651_10001223
344 Ga0207651_10158883
345 Ga0207677_10118986
346 Ga0207677_10581474
347 Ga0207676_10190979
348 Ga0207675_100293785
349 Ga0207675_100817794
350 Ga0207683_10021640
351 Ga0207428_10003914
352 Ga0207428_10005751
353 Ga0207428_10023349
354 Ga0207428_10285842
355 Ga0268266_10727579
356 Ga0268265_10133964
357 Ga0268265_10212119
358 Ga0307513_10015064
359 Ga0316577_10022938
360 Ga0316582_0112177
361 Ga0316581_0089249
362 Ga0395901_0388684
363 Ga0436365_0158457
364 Ga0439466_0120640
365 Ga0453684_0215282
366 Ga0451576_0431115
367 Ga0495592_0126242
368 Ga0495603_0103864
369 Ga0495604_0513930
370 Ga0501031_0373327
371 Ga0501034_0018415
372 Ga0501036_0062121
373 Ga0501036_0468457
374 Ga0501036_0825186
375 Ga0501037_0118992
376 Ga0501037_0128280
377 Ga0501038_0327397
378 Ga0501039_0004386
379 Ga0501040_0038867
380 Ga0501040_0052864
381 Ga0501040_0125476
382 Ga0501041_0008618
383 Ga0501042_0123651
384 Ga0501043_0023153
385 Ga0501043_0104213
386 Ga0501046_0025924
387 Ga0501046_0405555
388 Ga0501047_0313731
389 Ga0501048_0005837
390 Ga0501048_0029168
391 Ga0501068_0053855
392 Ga0501068_0143808
393 Ga0501070_0303331
394 Ga0501071_0012296
395 Ga0501071_0135732
396 Ga0501071_0565457
397 Ga0501072_0005406
398 Ga0501072_0021272
399 Ga0501072_0594618
400 Ga0501073_0415129
401 Ga0501074_0084904
402 Ga0501074_0143495
403 Ga0501075_0003694
404 Ga0501075_0044956
405 Ga0501075_0139303
406 Ga0501075_0284996
407 Ga0501076_0007136
408 Ga0501076_0419108
409 Ga0501077_0129211
410 Ga0501079_0004165
411 Ga0501079_0032237
412 Ga0501079_0075457
413 Ga0501079_0340040
414 Ga0501080_0056017
415 Ga0501080_0072370
416 Ga0501080_0091189
417 Ga0501081_0000826
418 Ga0501081_0001023
419 Ga0501083_0068484
420 Ga0501083_0123847
421 Ga0501035_0155269
422 Ga0501035_0350474
423 Ga0501044_0037236
424 Ga0501044_0613831
425 Ga0501045_0000631
426 Ga0501045_0081624
427 Ga0501045_0247196
428 nmdc:mga05p37_292692_c1
429 nmdc:mga05p37_44162_c1
430 nmdc:mga09592_322150_c1
431 nmdc:mga0qj67_109171_c1
432 nmdc:mga0qj67_194376_c1
433 nmdc:mga06r32_15530_c1
434 nmdc:mga06r32_243008_c1
435 nmdc:mga06r32_253871_c1
436 nmdc:mga06r32_333142_c1
437 nmdc:mga08y16_1689_c1
438 nmdc:mga08y16_187240_c1
439 nmdc:mga08y16_19223_c1
440 nmdc:mga08y16_4336_c1
441 nmdc:mga08y16_508758_c1
442 nmdc:mga0n895_2626_c1
443 nmdc:mga0n895_998412_c1
444 nmdc:mga0rr50_587_c1
445 nmdc:mga0a205_106323_c1
446 nmdc:mga0a205_96_c1
447 Ga0495601_0462120
448 Ga0500555_007661
449 Ga0501084_0001645
450 Ga0501084_0004567
451 Ga0501084_0061194
452 Ga0501084_0337688
453 Ga0501082_0001706
454 Ga0501082_0174514
455 Ga0501082_0222823
456 Ga0530510_0002666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

66

196

0.98

PF18306

LDcluster4

SLOG cluster4 family

21

186

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zbj-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 0.988 2 181
5its-assembly2.cif.gz_C crystal structure of log from corynebacterium glutamicum 0.9867 2 180
2q4o-assembly1.cif.gz_B ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at2g37210 0.9845 2 176
5zbk-assembly1.cif.gz_A-2 crystal structure of type-i log from pseudomonas aeruginosa pao1 in complex with amp 0.9835 2 180
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9812 2 182
ID Description Score Start End Superfamily
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.988 1 181 3.40.50.450
af_A0A1D6K2U3_1_187_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9749 2 176 3.40.50.450
5zblB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9613 2 187 3.40.50.450
af_A4HXF6_126_320_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9566 1 182 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9565 1 181 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A084IPJ1-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9936 2 178 GO:0005829
GO:0008714
GO:0009691
AF-A0A4V2PPR8-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9933 1 185 GO:0005829
GO:0008714
GO:0009691
AF-E5WL92-F1-model_v4 deleted 0.9922 1 170
AF-A0A3B8LGH7-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9916 2 178 GO:0005829
GO:0008714
GO:0009691
AF-A0A1I4TH92-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9912 3 190 GO:0005829
GO:0008714
GO:0009691

Map