F340889

General Info

Members Datasets Scaffolds Average Seq Length
228 144 456 253

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10684247|Ga0111539_106842472
Length 299
Sequence MMIEGTLLSRTAQDLASVRSKPAWRGGSWMIQSVDRALRILAVLQGGHRLSLGEIAQRLDLPPSTVHGILRTLLAHRVVVQEHDSGRYRLGPAVLTMGNVYLDTLELRSRVTPWAEDLARRTGLAVRTAVMLVDDVVVVHHEPRPDGSRQMPEVGIVIPAHASALGKAILAFDDELADELLDSPAARRSMTGETITDQKAQRAQLDEVRATGIAYEVEEAVLGECGVAATLSDRLGGPVGALGLVVASGEWPLAQSTIDSLRTAARSVSRELGATRWPPEGEAPNASAMGTRRKRPRPA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
84 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
87 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
88 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
89 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
90 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
142 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
143 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
144 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 4.39
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10684247 3300009094 Bacteria 1194
2 Ga0070658_10434472 3300005327 Bacteria 1130
3 Ga0070682_100156228 3300005337 Bacteria 1571
4 Ga0070659_100741060 3300005366 Bacteria 852
5 Ga0070709_10073690 3300005434 Bacteria 2211
6 Ga0070714_100588556 3300005435 Bacteria 1068
7 Ga0070713_100472672 3300005436 Bacteria 1180
8 Ga0070700_100239339 3300005441 Bacteria 1296
9 Ga0070681_10000024 3300005458 Bacteria 111597
10 Ga0070685_10039452 3300005466 Bacteria 2683
11 Ga0070679_100000109 3300005530 Bacteria 65139
12 Ga0070679_100187427 3300005530 Bacteria 2039
13 Ga0070684_100272444 3300005535 Bacteria 1550
14 Ga0068853_100139112 3300005539 Bacteria 2179
15 Ga0068853_100819396 3300005539 Bacteria 892
16 Ga0070696_100162115 3300005546 Bacteria 1648
17 Ga0070693_100122613 3300005547 Bacteria 1614
18 Ga0070704_100011852 3300005549 Bacteria 5364
19 Ga0068856_100080232 3300005614 Bacteria 3236
20 Ga0068864_100363094 3300005618 Bacteria 1369
21 Ga0068864_100724886 3300005618 Bacteria 973
22 Ga0068858_100012287 3300005842 Bacteria 8077
23 Ga0068858_100590344 3300005842 Unclassified 1077
24 Ga0068860_100059021 3300005843 Bacteria 3648
25 Ga0068860_100138755 3300005843 Bacteria 2336
26 Ga0068862_100599597 3300005844 Bacteria 1057
27 Ga0081455_10038103 3300005937 Bacteria 4259
28 Ga0081540_1009456 3300005983 Bacteria 6716
29 Ga0081539_10000926 3300005985 Bacteria 55157
30 Ga0070717_10357311 3300006028 Unclassified 1307
31 Ga0075363_100109981 3300006048 Bacteria 1531
32 Ga0075364_10162650 3300006051 Bacteria 1507
33 Ga0075432_10000678 3300006058 Bacteria 10471
34 Ga0075362_10094720 3300006177 Bacteria 1390
35 Ga0097621_100070535 3300006237 Bacteria 2886
36 Ga0068871_100158775 3300006358 Bacteria 1932
37 Ga0075428_100011612 3300006844 Bacteria 9803
38 Ga0075428_100142586 3300006844 Bacteria 2605
39 Ga0075430_100004784 3300006846 Bacteria 11390
40 Ga0075430_100175717 3300006846 Bacteria 1781
41 Ga0075431_100037326 3300006847 Bacteria 5006
42 Ga0075433_10044832 3300006852 Bacteria 3843
43 Ga0075434_100003995 3300006871 Bacteria 13211
44 Ga0075429_100007964 3300006880 Bacteria 9202
45 Ga0075436_100005810 3300006914 Bacteria 8472
46 Ga0075435_100006641 3300007076 Bacteria 8198
47 Ga0075435_100018044 3300007076 Bacteria 5354
48 Ga0105240_10665181 3300009093 Unclassified 1140
49 Ga0111539_10001727 3300009094 Bacteria 29086
50 Ga0111539_11205134 3300009094 Bacteria 879
51 Ga0105245_10271816 3300009098 Bacteria 1653
52 Ga0105245_10897540 3300009098 Bacteria 928
53 Ga0105247_10093506 3300009101 Bacteria 1911
54 Ga0114129_10004496 3300009147 Bacteria 19678
55 Ga0114129_10421647 3300009147 Bacteria 1755
56 Ga0105241_10026521 3300009174 Bacteria 4312
57 Ga0105242_10768031 3300009176 Bacteria 951
58 Ga0105248_10193191 3300009177 Bacteria 2294
59 Ga0105237_10016017 3300009545 Bacteria 7796
60 Ga0105238_10130067 3300009551 Bacteria 2496
61 Ga0105238_10275120 3300009551 Bacteria 1664
62 Ga0157370_10365491 3300013104 Bacteria 1330
63 Ga0157369_10020105 3300013105 Bacteria 7468
64 Ga0157369_10383598 3300013105 Bacteria 1458
65 Ga0157374_10161483 3300013296 Bacteria 2182
66 Ga0163162_10026286 3300013306 Bacteria 5753
67 Ga0157372_10287294 3300013307 Bacteria 1913
68 Ga0157372_10419035 3300013307 Bacteria 1560
69 Ga0157375_10002475 3300013308 Bacteria 15989
70 Ga0163163_10048835 3300014325 Bacteria 4163
71 Ga0163163_10076269 3300014325 Bacteria 3347
72 Ga0157376_10014398 3300014969 Bacteria 5937
73 Ga0207688_10099375 3300025901 Bacteria 1679
74 Ga0207707_10000059 3300025912 Bacteria 110997
75 Ga0207671_10083930 3300025914 Bacteria 2392
76 Ga0207660_10000414 3300025917 Bacteria 28238
77 Ga0207652_10000020 3300025921 Bacteria 159903
78 Ga0207687_10387100 3300025927 Bacteria 1147
79 Ga0207664_10123450 3300025929 Bacteria 2171
80 Ga0207690_10324445 3300025932 Bacteria 1211
81 Ga0207661_10090493 3300025944 Bacteria 2548
82 Ga0207677_10073646 3300026023 Bacteria 2420
83 Ga0207703_10365217 3300026035 Bacteria 1332
84 Ga0207708_10549425 3300026075 Bacteria 974
85 Ga0207698_10478611 3300026142 Bacteria 1207
86 Ga0207428_10001284 3300027907 Bacteria 26882
87 Ga0268266_10223225 3300028379 Bacteria 1733
88 Ga0268265_10022087 3300028380 Bacteria 4467
89 Ga0268264_10028000 3300028381 Bacteria 4608
90 Ga0307405_10069010 3300031731 Bacteria 2265
91 Ga0307406_10069104 3300031901 Bacteria 2308
92 Ga0307409_100211096 3300031995 Bacteria 1745
93 Ga0307409_100411200 3300031995 Bacteria 1295
94 Ga0307416_100094980 3300032002 Bacteria 2573
95 Ga0307416_100569786 3300032002 Bacteria 1208
96 Ga0395899_0124988 3300037312 Bacteria 1840
97 Ga0395898_0009345 3300037466 Bacteria 10304
98 Ga0395898_0206611 3300037466 Bacteria 1874
99 Ga0395898_0583749 3300037466 Bacteria 1060
100 Ga0395905_0009140 3300037471 Bacteria 9710
101 Ga0395901_0016502 3300038443 Bacteria 7526
102 Ga0395901_0038830 3300038443 Bacteria 4924
103 Ga0436362_0536166 3300039453 Bacteria 1365
104 Ga0439466_0000465 3300041411 Bacteria 15425
105 Ga0439465_0009546 3300041413 Bacteria 3056
106 Ga0439448_0063347 3300042005 Bacteria 1224
107 Ga0450900_003605 3300042136 Bacteria 1728
108 Ga0439435_0003071 3300042436 Bacteria 3421
109 Ga0439459_0055649 3300042438 Unclassified 881
110 Ga0439464_0007846 3300042439 Bacteria 2793
111 Ga0450916_032189 3300042530 Bacteria 768
112 Ga0466972_0020155 3300044658 Bacteria 3332
113 Ga0466972_0177085 3300044658 Bacteria 1000
114 Ga0466972_0213709 3300044658 Bacteria 902
115 Ga0466965_0005718 3300044683 Bacteria 5607
116 Ga0466965_0029540 3300044683 Bacteria 2668
117 Ga0466966_0002543 3300044684 Bacteria 11947
118 Ga0466966_0150076 3300044684 Bacteria 1422
119 Ga0466961_0121661 3300044693 Bacteria 1638
120 Ga0466961_0247332 3300044693 Bacteria 1095
121 Ga0466961_0274171 3300044693 Unclassified 1033
122 Ga0466963_0005713 3300044694 Bacteria 7310
123 Ga0466963_0006027 3300044694 Bacteria 7143
124 Ga0466963_0026467 3300044694 Bacteria 3710
125 Ga0466963_0027829 3300044694 Bacteria 3624
126 Ga0466963_0064211 3300044694 Unclassified 2459
127 Ga0466963_0123971 3300044694 Bacteria 1780
128 Ga0466963_0294828 3300044694 Bacteria 1140
129 Ga0466963_0312196 3300044694 Bacteria 1106
130 Ga0466964_0029368 3300044706 Bacteria 2170
131 Ga0466964_0030096 3300044706 Bacteria 2147
132 Ga0466964_0056714 3300044706 Bacteria 1620
133 Ga0466964_0092642 3300044706 Bacteria 1318
134 Ga0466971_0013240 3300044719 Unclassified 3620
135 Ga0466971_0027205 3300044719 Bacteria 2560
136 Ga0466971_0071683 3300044719 Bacteria 1574
137 Ga0466970_0104018 3300044765 Bacteria 1548
138 Ga0466970_0111708 3300044765 Bacteria 1493
139 Ga0466957_0008022 3300044842 Bacteria 5988
140 Ga0466957_0025592 3300044842 Bacteria 3498
141 Ga0466957_0097347 3300044842 Bacteria 1850
142 Ga0466957_0099210 3300044842 Bacteria 1834
143 Ga0466957_0159710 3300044842 Unclassified 1463
144 Ga0466957_0174492 3300044842 Bacteria 1401
145 Ga0466957_0207026 3300044842 Bacteria 1290
146 Ga0466957_0471948 3300044842 Bacteria 867
147 Ga0466960_0003372 3300044901 Bacteria 6134
148 Ga0466960_0025304 3300044901 Bacteria 2685
149 Ga0466960_0025767 3300044901 Bacteria 2664
150 Ga0466960_0051253 3300044901 Bacteria 1993
151 Ga0466959_0067996 3300045049 Bacteria 2582
152 Ga0466959_0122406 3300045049 Bacteria 1848
153 Ga0466959_0161413 3300045049 Bacteria 1576
154 Ga0466959_0324858 3300045049 Bacteria 1051
155 Ga0466958_0004969 3300045836 Bacteria 7094
156 Ga0466958_0021387 3300045836 Bacteria 3780
157 Ga0466958_0029243 3300045836 Bacteria 3269
158 Ga0466958_0033514 3300045836 Bacteria 3060
159 Ga0466958_0062207 3300045836 Bacteria 2275
160 Ga0466958_0062394 3300045836 Bacteria 2272
161 Ga0466958_0068924 3300045836 Bacteria 2163
162 Ga0466958_0245731 3300045836 Bacteria 1144
163 Ga0466958_0325683 3300045836 Bacteria 988
164 Ga0466958_0392312 3300045836 Bacteria 896
165 Ga0466967_0011321 3300045976 Bacteria 6747
166 Ga0466967_0025295 3300045976 Bacteria 4893
167 Ga0466967_0037395 3300045976 Bacteria 4154
168 Ga0466967_0037733 3300045976 Bacteria 4138
169 Ga0466967_0059412 3300045976 Bacteria 3384
170 Ga0466967_0086738 3300045976 Bacteria 2836
171 Ga0466967_0094521 3300045976 Bacteria 2722
172 Ga0466967_0193207 3300045976 Bacteria 1925
173 Ga0466967_0205348 3300045976 Unclassified 1867
174 Ga0466967_0427747 3300045976 Bacteria 1291
175 Ga0466967_0489311 3300045976 Bacteria 1206
176 Ga0466967_0595301 3300045976 Bacteria 1091
177 Ga0495605_0207112 3300046474 Bacteria 853
178 Ga0495664_0230234 3300046477 Bacteria 1121
179 Ga0495584_0210403 3300046491 Bacteria 989
180 Ga0495608_0278831 3300046511 Bacteria 1038
181 Ga0495666_0208797 3300046526 Bacteria 896
182 Ga0495633_0106505 3300046558 Bacteria 1301
183 Ga0495611_0186458 3300046648 Bacteria 969
184 Ga0496107_0257071 3300048910 Bacteria 1300
185 Ga0496108_0032710 3300048911 Bacteria 4320
186 Ga0496109_0038836 3300048912 Bacteria 4306
187 Ga0496110_0112632 3300048913 Bacteria 2446
188 Ga0496110_0477581 3300048913 Bacteria 1135
189 Ga0496111_0037684 3300048914 Bacteria 3461
190 Ga0496113_0009056 3300048916 Bacteria 6521
191 Ga0496113_0256826 3300048916 Unclassified 1396
192 Ga0496113_0261998 3300048916 Bacteria 1381
193 Ga0496113_0437945 3300048916 Bacteria 1050
194 Ga0501036_0046931 3300049572 Bacteria 3658
195 Ga0501037_0000196 3300049573 Bacteria 54903
196 Ga0501038_0064420 3300049574 Bacteria 3125
197 Ga0501039_0000450 3300049575 Bacteria 29852
198 Ga0501039_0002617 3300049575 Bacteria 13435
199 Ga0501042_0131373 3300049578 Bacteria 1805
200 Ga0501043_0001264 3300049579 Bacteria 22214
201 Ga0501067_0004537 3300049583 Bacteria 7673
202 Ga0501067_0117041 3300049583 Bacteria 1482
203 Ga0501068_0155465 3300049584 Bacteria 1439
204 Ga0501069_0045791 3300049585 Bacteria 2424
205 Ga0501070_0000427 3300049586 Bacteria 38281
206 Ga0501071_0078114 3300049587 Bacteria 2419
207 Ga0501079_0148546 3300049741 Bacteria 1827
208 Ga0501044_0006965 3300049823 Bacteria 12439
209 nmdc:mga05p37_149537_c1 3300050507 Bacteria 2858
210 nmdc:mga05p37_374690_c1 3300050507 Bacteria 1669
211 nmdc:mga09592_6200_c1 3300050508 Bacteria 9732
212 nmdc:mga0qj67_40119_c1 3300050509 Bacteria 3680
213 nmdc:mga06r32_10685_c1 3300050510 Bacteria 8275
214 nmdc:mga08y16_381172_c1 3300050511 Bacteria 1445
215 nmdc:mga08y16_6731_c1 3300050511 Bacteria 12050
216 nmdc:mga0n895_2886_c1 3300050512 Bacteria 13634
217 nmdc:mga0rr50_1775_c1 3300050513 Bacteria 11913
218 nmdc:mga08x19_9449_c1 3300050514 Bacteria 5839
219 nmdc:mga0a205_7347_c1 3300050515 Bacteria 9977
220 Ga0495601_0039450 3300053077 Bacteria 2957
221 Ga0466962_0007236 3300061719 Bacteria 5318
222 Ga0466962_0015245 3300061719 Bacteria 3705
223 Ga0466962_0054600 3300061719 Bacteria 1909
224 Ga0466962_0093704 3300061719 Bacteria 1440
225 2558907824 2558860112 Bacteria 9931328
226 2753265732 2751185782 Bacteria 11227053
227 2899362682 2899359706 Bacteria 10940472
228 2902811344 2902810491 Bacteria 6794147
229 Ga0111539_10684247
230 Ga0070658_10434472
231 Ga0070682_100156228
232 Ga0070659_100741060
233 Ga0070709_10073690
234 Ga0070714_100588556
235 Ga0070713_100472672
236 Ga0070700_100239339
237 Ga0070681_10000024
238 Ga0070685_10039452
239 Ga0070679_100000109
240 Ga0070679_100187427
241 Ga0070684_100272444
242 Ga0068853_100139112
243 Ga0068853_100819396
244 Ga0070696_100162115
245 Ga0070693_100122613
246 Ga0070704_100011852
247 Ga0068856_100080232
248 Ga0068864_100363094
249 Ga0068864_100724886
250 Ga0068858_100012287
251 Ga0068858_100590344
252 Ga0068860_100059021
253 Ga0068860_100138755
254 Ga0068862_100599597
255 Ga0081455_10038103
256 Ga0081540_1009456
257 Ga0081539_10000926
258 Ga0070717_10357311
259 Ga0075363_100109981
260 Ga0075364_10162650
261 Ga0075432_10000678
262 Ga0075362_10094720
263 Ga0097621_100070535
264 Ga0068871_100158775
265 Ga0075428_100011612
266 Ga0075428_100142586
267 Ga0075430_100004784
268 Ga0075430_100175717
269 Ga0075431_100037326
270 Ga0075433_10044832
271 Ga0075434_100003995
272 Ga0075429_100007964
273 Ga0075436_100005810
274 Ga0075435_100006641
275 Ga0075435_100018044
276 Ga0105240_10665181
277 Ga0111539_10001727
278 Ga0111539_11205134
279 Ga0105245_10271816
280 Ga0105245_10897540
281 Ga0105247_10093506
282 Ga0114129_10004496
283 Ga0114129_10421647
284 Ga0105241_10026521
285 Ga0105242_10768031
286 Ga0105248_10193191
287 Ga0105237_10016017
288 Ga0105238_10130067
289 Ga0105238_10275120
290 Ga0157370_10365491
291 Ga0157369_10020105
292 Ga0157369_10383598
293 Ga0157374_10161483
294 Ga0163162_10026286
295 Ga0157372_10287294
296 Ga0157372_10419035
297 Ga0157375_10002475
298 Ga0163163_10048835
299 Ga0163163_10076269
300 Ga0157376_10014398
301 Ga0207688_10099375
302 Ga0207707_10000059
303 Ga0207671_10083930
304 Ga0207660_10000414
305 Ga0207652_10000020
306 Ga0207687_10387100
307 Ga0207664_10123450
308 Ga0207690_10324445
309 Ga0207661_10090493
310 Ga0207677_10073646
311 Ga0207703_10365217
312 Ga0207708_10549425
313 Ga0207698_10478611
314 Ga0207428_10001284
315 Ga0268266_10223225
316 Ga0268265_10022087
317 Ga0268264_10028000
318 Ga0307405_10069010
319 Ga0307406_10069104
320 Ga0307409_100211096
321 Ga0307409_100411200
322 Ga0307416_100094980
323 Ga0307416_100569786
324 Ga0395899_0124988
325 Ga0395898_0009345
326 Ga0395898_0206611
327 Ga0395898_0583749
328 Ga0395905_0009140
329 Ga0395901_0016502
330 Ga0395901_0038830
331 Ga0436362_0536166
332 Ga0439466_0000465
333 Ga0439465_0009546
334 Ga0439448_0063347
335 Ga0450900_003605
336 Ga0439435_0003071
337 Ga0439459_0055649
338 Ga0439464_0007846
339 Ga0450916_032189
340 Ga0466972_0020155
341 Ga0466972_0177085
342 Ga0466972_0213709
343 Ga0466965_0005718
344 Ga0466965_0029540
345 Ga0466966_0002543
346 Ga0466966_0150076
347 Ga0466961_0121661
348 Ga0466961_0247332
349 Ga0466961_0274171
350 Ga0466963_0005713
351 Ga0466963_0006027
352 Ga0466963_0026467
353 Ga0466963_0027829
354 Ga0466963_0064211
355 Ga0466963_0123971
356 Ga0466963_0294828
357 Ga0466963_0312196
358 Ga0466964_0029368
359 Ga0466964_0030096
360 Ga0466964_0056714
361 Ga0466964_0092642
362 Ga0466971_0013240
363 Ga0466971_0027205
364 Ga0466971_0071683
365 Ga0466970_0104018
366 Ga0466970_0111708
367 Ga0466957_0008022
368 Ga0466957_0025592
369 Ga0466957_0097347
370 Ga0466957_0099210
371 Ga0466957_0159710
372 Ga0466957_0174492
373 Ga0466957_0207026
374 Ga0466957_0471948
375 Ga0466960_0003372
376 Ga0466960_0025304
377 Ga0466960_0025767
378 Ga0466960_0051253
379 Ga0466959_0067996
380 Ga0466959_0122406
381 Ga0466959_0161413
382 Ga0466959_0324858
383 Ga0466958_0004969
384 Ga0466958_0021387
385 Ga0466958_0029243
386 Ga0466958_0033514
387 Ga0466958_0062207
388 Ga0466958_0062394
389 Ga0466958_0068924
390 Ga0466958_0245731
391 Ga0466958_0325683
392 Ga0466958_0392312
393 Ga0466967_0011321
394 Ga0466967_0025295
395 Ga0466967_0037395
396 Ga0466967_0037733
397 Ga0466967_0059412
398 Ga0466967_0086738
399 Ga0466967_0094521
400 Ga0466967_0193207
401 Ga0466967_0205348
402 Ga0466967_0427747
403 Ga0466967_0489311
404 Ga0466967_0595301
405 Ga0495605_0207112
406 Ga0495664_0230234
407 Ga0495584_0210403
408 Ga0495608_0278831
409 Ga0495666_0208797
410 Ga0495633_0106505
411 Ga0495611_0186458
412 Ga0496107_0257071
413 Ga0496108_0032710
414 Ga0496109_0038836
415 Ga0496110_0112632
416 Ga0496110_0477581
417 Ga0496111_0037684
418 Ga0496113_0009056
419 Ga0496113_0256826
420 Ga0496113_0261998
421 Ga0496113_0437945
422 Ga0501036_0046931
423 Ga0501037_0000196
424 Ga0501038_0064420
425 Ga0501039_0000450
426 Ga0501039_0002617
427 Ga0501042_0131373
428 Ga0501043_0001264
429 Ga0501067_0004537
430 Ga0501067_0117041
431 Ga0501068_0155465
432 Ga0501069_0045791
433 Ga0501070_0000427
434 Ga0501071_0078114
435 Ga0501079_0148546
436 Ga0501044_0006965
437 nmdc:mga05p37_149537_c1
438 nmdc:mga05p37_374690_c1
439 nmdc:mga09592_6200_c1
440 nmdc:mga0qj67_40119_c1
441 nmdc:mga06r32_10685_c1
442 nmdc:mga08y16_381172_c1
443 nmdc:mga08y16_6731_c1
444 nmdc:mga0n895_2886_c1
445 nmdc:mga0rr50_1775_c1
446 nmdc:mga08x19_9449_c1
447 nmdc:mga0a205_7347_c1
448 Ga0495601_0039450
449 Ga0466962_0007236
450 Ga0466962_0015245
451 Ga0466962_0054600
452 Ga0466962_0093704
453 2558907824
454 2753265732
455 2899362682
456 2902811344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

33

83

0.97

PF01614

IclR

Bacterial transcriptional regulator

99

270

0.94

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

35

79

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qww-assembly2.cif.gz_D crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9301 1 42
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9231 1 42
1tf1-assembly2.cif.gz_B crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain 0.9199 52 221
2qww-assembly4.cif.gz_G crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9098 1 42
2qww-assembly3.cif.gz_F crystal structure of multiple antibiotic-resistance repressor (marr) (yp_013417.1) from listeria monocytogenes 4b f2365 at 2.07 a resolution 0.9097 1 42
ID Description Score Start End Superfamily
af_O06806_1_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9843 1 42 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9734 1 42 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9576 1 31 1.10.10.10
af_P0ACN4_17_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9543 1 50 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9437 1 43 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9QTZ5-F1-model_v4 IclR-ED domain-containing protein 0.9115 58 220 GO:0003677
GO:0003700
GO:0045892
AF-X1EUD4-F1-model_v4 IclR-ED domain-containing protein 0.908 62 225 GO:0003677
GO:0003700
GO:0045892
AF-A0A7C7E5S2-F1-model_v4 IclR family transcriptional regulator 0.9055 76 224 GO:0003677
GO:0003700
GO:0045892
AF-A0A1H9EZ93-F1-model_v4 DNA-binding transcriptional regulator, IclR family 0.9043 55 222 GO:0003677
GO:0003700
GO:0045892
AF-A0A4U2ZDZ6-F1-model_v4 IclR family transcriptional regulator 0.9028 74 220 GO:0003677
GO:0003700
GO:0045892

Map