F340696

General Info

Members Datasets Scaffolds Average Seq Length
228 104 456 81

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_11068044|Ga0070709_110680442
Length 84
Sequence MWKRLFGRGGDEPRAAKQAGDVHALDRPGDPRGGVQSDEYRHAGPDDIVQEGEVVMGGPAGAPTDDDLSVEERRERDRPEEAAG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
60 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
61 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
62 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
63 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
64 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
65 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
69 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
70 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
71 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 2.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 4.82
Rhizosphere 92.11
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_11068044 3300005434 Bacteria 645
2 Ga0070658_10006151 3300005327 Bacteria 9732
3 Ga0070658_10721678 3300005327 Bacteria 865
4 Ga0070683_100166618 3300005329 Bacteria 2091
5 Ga0070660_100010958 3300005339 Bacteria 6421
6 Ga0070660_100016526 3300005339 Bacteria 5357
7 Ga0070660_101483507 3300005339 Unclassified 576
8 Ga0070691_10395422 3300005341 Bacteria 778
9 Ga0070661_100130424 3300005344 Bacteria 1887
10 Ga0070661_101355739 3300005344 Bacteria 598
11 Ga0070661_101468466 3300005344 Bacteria 575
12 Ga0070661_101793988 3300005344 Bacteria 521
13 Ga0070659_101859937 3300005366 Bacteria 540
14 Ga0070714_100131233 3300005435 Bacteria 2239
15 Ga0070714_100239478 3300005435 Bacteria 1674
16 Ga0070714_101026789 3300005435 Bacteria 803
17 Ga0070714_101433092 3300005435 Bacteria 674
18 Ga0070714_101825362 3300005435 Bacteria 594
19 Ga0070713_100010952 3300005436 Bacteria 6577
20 Ga0070713_100897050 3300005436 Bacteria 853
21 Ga0070711_100840587 3300005439 Bacteria 781
22 Ga0070662_101441011 3300005457 Bacteria 594
23 Ga0070681_10071312 3300005458 Bacteria 3438
24 Ga0070681_10761815 3300005458 Bacteria 885
25 Ga0070684_100037910 3300005535 Bacteria 4138
26 Ga0070684_100297024 3300005535 Bacteria 1482
27 Ga0068853_101663735 3300005539 Bacteria 619
28 Ga0070695_100000297 3300005545 Bacteria 25077
29 Ga0068855_100331317 3300005563 Bacteria 1680
30 Ga0068855_100584856 3300005563 Bacteria 1205
31 Ga0068855_101540273 3300005563 Bacteria 682
32 Ga0068852_100084806 3300005616 Bacteria 2820
33 Ga0068852_101980755 3300005616 Bacteria 605
34 Ga0068852_102225111 3300005616 Bacteria 570
35 Ga0081539_10001930 3300005985 Bacteria 31892
36 Ga0070717_10004232 3300006028 Bacteria 10346
37 Ga0070717_10639451 3300006028 Bacteria 966
38 Ga0070716_100242191 3300006173 Bacteria 1224
39 Ga0070712_100802503 3300006175 Bacteria 808
40 Ga0105240_10006157 3300009093 Bacteria 17686
41 Ga0105240_10274541 3300009093 Bacteria 1940
42 Ga0105237_10015417 3300009545 Bacteria 7954
43 Ga0105238_11434656 3300009551 Bacteria 718
44 Ga0157373_10496790 3300013100 Bacteria 881
45 Ga0157373_11089192 3300013100 Bacteria 599
46 Ga0157371_11479064 3300013102 Bacteria 529
47 Ga0157370_10005396 3300013104 Bacteria 14343
48 Ga0157369_10007347 3300013105 Bacteria 12684
49 Ga0157369_10110857 3300013105 Bacteria 2917
50 Ga0157369_10363790 3300013105 Bacteria 1502
51 Ga0157372_10008149 3300013307 Bacteria 11138
52 Ga0157372_10083431 3300013307 Bacteria 3620
53 Ga0157372_10314784 3300013307 Bacteria 1822
54 Ga0182008_10156484 3300014497 Bacteria 1145
55 Ga0197907_10876247 3300020069 Bacteria 798
56 Ga0206349_1154389 3300020075 Bacteria 935
57 Ga0206352_10335055 3300020078 Bacteria 839
58 Ga0206354_11613819 3300020081 Bacteria 574
59 Ga0206353_11400551 3300020082 Bacteria 531
60 Ga0224712_10118644 3300022467 Bacteria 1143
61 Ga0207699_11190133 3300025906 Bacteria 564
62 Ga0207705_10010046 3300025909 Bacteria 6889
63 Ga0207705_10030854 3300025909 Bacteria 3825
64 Ga0207707_10992969 3300025912 Bacteria 689
65 Ga0207707_11499864 3300025912 Bacteria 534
66 Ga0207695_10070161 3300025913 Bacteria 3584
67 Ga0207671_11031307 3300025914 Bacteria 648
68 Ga0207660_10174952 3300025917 Bacteria 1664
69 Ga0207660_10294340 3300025917 Bacteria 1291
70 Ga0207660_10297851 3300025917 Bacteria 1284
71 Ga0207660_10384123 3300025917 Bacteria 1129
72 Ga0207657_10003131 3300025919 Bacteria 17691
73 Ga0207657_10115364 3300025919 Bacteria 2214
74 Ga0207649_10936060 3300025920 Bacteria 680
75 Ga0207649_11139097 3300025920 Bacteria 616
76 Ga0207652_10060995 3300025921 Bacteria 3256
77 Ga0207652_10548973 3300025921 Bacteria 1038
78 Ga0207652_10633554 3300025921 Bacteria 957
79 Ga0207694_11650049 3300025924 Bacteria 540
80 Ga0207700_10320249 3300025928 Bacteria 1344
81 Ga0207700_10836938 3300025928 Bacteria 823
82 Ga0207664_10019652 3300025929 Bacteria 4997
83 Ga0207664_10036049 3300025929 Bacteria 3821
84 Ga0207664_10300416 3300025929 Bacteria 1412
85 Ga0207664_10406034 3300025929 Bacteria 1212
86 Ga0207664_10957654 3300025929 Bacteria 768
87 Ga0207664_11753477 3300025929 Bacteria 543
88 Ga0207690_11513572 3300025932 Bacteria 561
89 Ga0207661_10137738 3300025944 Bacteria 2098
90 Ga0207667_10587338 3300025949 Bacteria 1124
91 Ga0207667_11990733 3300025949 Unclassified 541
92 Ga0207698_10073956 3300026142 Bacteria 2716
93 Ga0373947_0640286 3300035725 Unclassified 725
94 Ga0395899_0333652 3300037312 Bacteria 1018
95 Ga0395900_0034259 3300037418 Bacteria 5227
96 Ga0395900_1909987 3300037418 Bacteria 504
97 Ga0395898_0028242 3300037466 Bacteria 5625
98 Ga0395898_0232289 3300037466 Bacteria 1759
99 Ga0395898_0401777 3300037466 Bacteria 1306
100 Ga0395898_0639123 3300037466 Unclassified 1007
101 Ga0395905_0851979 3300037471 Bacteria 814
102 Ga0395905_1576829 3300037471 Bacteria 561
103 Ga0395901_0162967 3300038443 Bacteria 2341
104 Ga0395901_1881857 3300038443 Bacteria 546
105 Ga0451789_0174414 3300041443 Bacteria 2275
106 Ga0451791_0288553 3300041451 Bacteria 2129
107 Ga0451793_0073281 3300041452 Unclassified 961
108 Ga0451795_0080721 3300041456 Bacteria 672
109 Ga0451798_0184685 3300041458 Bacteria 530
110 Ga0451802_1719339 3300041460 Bacteria 3753
111 Ga0451804_0602594 3300041463 Bacteria 657
112 Ga0451807_0986498 3300041486 Bacteria 1158
113 Ga0451841_0958266 3300041498 Unclassified 700
114 Ga0451845_0497892 3300041501 Bacteria 1235
115 Ga0451847_0122028 3300041503 Bacteria 3902
116 Ga0451851_0310844 3300041507 Bacteria 1994
117 Ga0451855_1032848 3300041511 Unclassified 684
118 Ga0451853_0320166 3300041512 Bacteria 1254
119 Ga0466969_0000734 3300044656 Bacteria 17706
120 Ga0466972_0178027 3300044658 Bacteria 997
121 Ga0466972_0406095 3300044658 Bacteria 639
122 Ga0466965_0062715 3300044683 Bacteria 1860
123 Ga0466965_0093717 3300044683 Bacteria 1530
124 Ga0466966_0004046 3300044684 Bacteria 9687
125 Ga0466966_0413614 3300044684 Unclassified 810
126 Ga0466961_0011324 3300044693 Bacteria 5703
127 Ga0466961_0158200 3300044693 Bacteria 1413
128 Ga0466961_0186024 3300044693 Bacteria 1289
129 Ga0466961_0746106 3300044693 Bacteria 585
130 Ga0466963_0000700 3300044694 Bacteria 16343
131 Ga0466963_0005249 3300044694 Bacteria 7565
132 Ga0466963_0005671 3300044694 Bacteria 7333
133 Ga0466963_0019704 3300044694 Bacteria 4235
134 Ga0466963_0025823 3300044694 Bacteria 3750
135 Ga0466963_0037184 3300044694 Bacteria 3178
136 Ga0466963_0048335 3300044694 Bacteria 2810
137 Ga0466963_0069665 3300044694 Bacteria 2364
138 Ga0466963_0327100 3300044694 Bacteria 1079
139 Ga0466963_0615092 3300044694 Bacteria 767
140 Ga0466964_0004035 3300044706 Bacteria 5396
141 Ga0466964_0012932 3300044706 Bacteria 3161
142 Ga0466964_0018724 3300044706 Bacteria 2659
143 Ga0466964_0024729 3300044706 Bacteria 2341
144 Ga0466964_0074184 3300044706 Bacteria 1446
145 Ga0466964_0103098 3300044706 Bacteria 1261
146 Ga0466964_0238106 3300044706 Bacteria 891
147 Ga0466964_0331711 3300044706 Bacteria 776
148 Ga0466964_0446912 3300044706 Bacteria 685
149 Ga0466964_0516728 3300044706 Bacteria 643
150 Ga0466964_0531057 3300044706 Bacteria 636
151 Ga0466971_0002636 3300044719 Bacteria 7589
152 Ga0466971_0002668 3300044719 Bacteria 7535
153 Ga0466971_0114864 3300044719 Bacteria 1244
154 Ga0466971_0129438 3300044719 Bacteria 1171
155 Ga0466971_0283501 3300044719 Bacteria 793
156 Ga0466968_0007944 3300044735 Bacteria 4051
157 Ga0466968_0008822 3300044735 Bacteria 3870
158 Ga0466968_0466373 3300044735 Bacteria 626
159 Ga0466970_0101927 3300044765 Bacteria 1564
160 Ga0466957_0000767 3300044842 Bacteria 16367
161 Ga0466957_0083009 3300044842 Bacteria 1998
162 Ga0466957_0116156 3300044842 Bacteria 1702
163 Ga0466957_0117864 3300044842 Bacteria 1690
164 Ga0466957_0124118 3300044842 Bacteria 1648
165 Ga0466957_0180840 3300044842 Bacteria 1377
166 Ga0466957_0182437 3300044842 Bacteria 1371
167 Ga0466957_0257776 3300044842 Bacteria 1161
168 Ga0466957_0495578 3300044842 Bacteria 846
169 Ga0466957_0631748 3300044842 Bacteria 752
170 Ga0466960_0021324 3300044901 Bacteria 2883
171 Ga0466960_0090718 3300044901 Bacteria 1557
172 Ga0466960_0137842 3300044901 Bacteria 1293
173 Ga0466959_0001733 3300045049 Bacteria 13559
174 Ga0466959_0001830 3300045049 Bacteria 13341
175 Ga0466959_0238168 3300045049 Bacteria 1258
176 Ga0466959_0282610 3300045049 Bacteria 1139
177 Ga0466959_0385057 3300045049 Bacteria 954
178 Ga0466959_0849512 3300045049 Bacteria 609
179 Ga0466958_0001082 3300045836 Bacteria 12528
180 Ga0466958_0002088 3300045836 Bacteria 9890
181 Ga0466958_0006936 3300045836 Bacteria 6198
182 Ga0466958_0014663 3300045836 Bacteria 4476
183 Ga0466958_0024450 3300045836 Bacteria 3555
184 Ga0466958_0175709 3300045836 Bacteria 1357
185 Ga0466967_0008793 3300045976 Bacteria 7442
186 Ga0466967_0019372 3300045976 Bacteria 5470
187 Ga0466967_0019823 3300045976 Bacteria 5418
188 Ga0466967_0021766 3300045976 Bacteria 5216
189 Ga0466967_0023440 3300045976 Bacteria 5057
190 Ga0466967_0048875 3300045976 Bacteria 3697
191 Ga0466967_0070296 3300045976 Bacteria 3132
192 Ga0466967_0079970 3300045976 Bacteria 2948
193 Ga0466967_0079984 3300045976 Bacteria 2948
194 Ga0466967_0150086 3300045976 Bacteria 2177
195 Ga0466967_0181499 3300045976 Bacteria 1985
196 Ga0466967_0304639 3300045976 Bacteria 1534
197 Ga0466967_0402469 3300045976 Bacteria 1332
198 Ga0466967_0438702 3300045976 Bacteria 1275
199 Ga0466967_0528673 3300045976 Bacteria 1159
200 Ga0466967_0750196 3300045976 Bacteria 968
201 Ga0466967_0805819 3300045976 Bacteria 932
202 Ga0466967_0860203 3300045976 Bacteria 901
203 Ga0466967_0960361 3300045976 Bacteria 850
204 Ga0466967_1334597 3300045976 Bacteria 714
205 Ga0466967_1432903 3300045976 Bacteria 688
206 Ga0466967_1475159 3300045976 Bacteria 677
207 Ga0466967_1813962 3300045976 Bacteria 607
208 Ga0466967_2421261 3300045976 Bacteria 520
209 Ga0495624_0734038 3300046690 Bacteria 585
210 Ga0496102_0045828 3300048905 Bacteria 3970
211 Ga0496103_0097108 3300048906 Bacteria 1862
212 Ga0496109_0536651 3300048912 Bacteria 1104
213 Ga0501047_0507555 3300049581 Bacteria 1032
214 Ga0501067_0082279 3300049583 Archaea 1785
215 Ga0501067_0199172 3300049583 Bacteria 1115
216 Ga0501069_0548916 3300049585 Archaea 691
217 Ga0501070_0007832 3300049586 Bacteria 9055
218 Ga0501070_1192691 3300049586 Bacteria 584
219 Ga0501072_0078465 3300049588 Bacteria 2614
220 Ga0501073_0012414 3300049589 Bacteria 6217
221 Ga0501074_0039602 3300049590 Bacteria 3413
222 Ga0501079_0464237 3300049741 Bacteria 994
223 Ga0501080_0045236 3300049742 Bacteria 4097
224 Ga0501083_0000145 3300049744 Bacteria 48483
225 nmdc:mga06z11_255230_c1 3300050494 Bacteria 1033
226 Ga0501082_0519401 3300060353 Bacteria 1041
227 Ga0466962_0002466 3300061719 Bacteria 8774
228 Ga0466962_0242716 3300061719 Bacteria 884
229 Ga0070709_11068044
230 Ga0070658_10006151
231 Ga0070658_10721678
232 Ga0070683_100166618
233 Ga0070660_100010958
234 Ga0070660_100016526
235 Ga0070660_101483507
236 Ga0070691_10395422
237 Ga0070661_100130424
238 Ga0070661_101355739
239 Ga0070661_101468466
240 Ga0070661_101793988
241 Ga0070659_101859937
242 Ga0070714_100131233
243 Ga0070714_100239478
244 Ga0070714_101026789
245 Ga0070714_101433092
246 Ga0070714_101825362
247 Ga0070713_100010952
248 Ga0070713_100897050
249 Ga0070711_100840587
250 Ga0070662_101441011
251 Ga0070681_10071312
252 Ga0070681_10761815
253 Ga0070684_100037910
254 Ga0070684_100297024
255 Ga0068853_101663735
256 Ga0070695_100000297
257 Ga0068855_100331317
258 Ga0068855_100584856
259 Ga0068855_101540273
260 Ga0068852_100084806
261 Ga0068852_101980755
262 Ga0068852_102225111
263 Ga0081539_10001930
264 Ga0070717_10004232
265 Ga0070717_10639451
266 Ga0070716_100242191
267 Ga0070712_100802503
268 Ga0105240_10006157
269 Ga0105240_10274541
270 Ga0105237_10015417
271 Ga0105238_11434656
272 Ga0157373_10496790
273 Ga0157373_11089192
274 Ga0157371_11479064
275 Ga0157370_10005396
276 Ga0157369_10007347
277 Ga0157369_10110857
278 Ga0157369_10363790
279 Ga0157372_10008149
280 Ga0157372_10083431
281 Ga0157372_10314784
282 Ga0182008_10156484
283 Ga0197907_10876247
284 Ga0206349_1154389
285 Ga0206352_10335055
286 Ga0206354_11613819
287 Ga0206353_11400551
288 Ga0224712_10118644
289 Ga0207699_11190133
290 Ga0207705_10010046
291 Ga0207705_10030854
292 Ga0207707_10992969
293 Ga0207707_11499864
294 Ga0207695_10070161
295 Ga0207671_11031307
296 Ga0207660_10174952
297 Ga0207660_10294340
298 Ga0207660_10297851
299 Ga0207660_10384123
300 Ga0207657_10003131
301 Ga0207657_10115364
302 Ga0207649_10936060
303 Ga0207649_11139097
304 Ga0207652_10060995
305 Ga0207652_10548973
306 Ga0207652_10633554
307 Ga0207694_11650049
308 Ga0207700_10320249
309 Ga0207700_10836938
310 Ga0207664_10019652
311 Ga0207664_10036049
312 Ga0207664_10300416
313 Ga0207664_10406034
314 Ga0207664_10957654
315 Ga0207664_11753477
316 Ga0207690_11513572
317 Ga0207661_10137738
318 Ga0207667_10587338
319 Ga0207667_11990733
320 Ga0207698_10073956
321 Ga0373947_0640286
322 Ga0395899_0333652
323 Ga0395900_0034259
324 Ga0395900_1909987
325 Ga0395898_0028242
326 Ga0395898_0232289
327 Ga0395898_0401777
328 Ga0395898_0639123
329 Ga0395905_0851979
330 Ga0395905_1576829
331 Ga0395901_0162967
332 Ga0395901_1881857
333 Ga0451789_0174414
334 Ga0451791_0288553
335 Ga0451793_0073281
336 Ga0451795_0080721
337 Ga0451798_0184685
338 Ga0451802_1719339
339 Ga0451804_0602594
340 Ga0451807_0986498
341 Ga0451841_0958266
342 Ga0451845_0497892
343 Ga0451847_0122028
344 Ga0451851_0310844
345 Ga0451855_1032848
346 Ga0451853_0320166
347 Ga0466969_0000734
348 Ga0466972_0178027
349 Ga0466972_0406095
350 Ga0466965_0062715
351 Ga0466965_0093717
352 Ga0466966_0004046
353 Ga0466966_0413614
354 Ga0466961_0011324
355 Ga0466961_0158200
356 Ga0466961_0186024
357 Ga0466961_0746106
358 Ga0466963_0000700
359 Ga0466963_0005249
360 Ga0466963_0005671
361 Ga0466963_0019704
362 Ga0466963_0025823
363 Ga0466963_0037184
364 Ga0466963_0048335
365 Ga0466963_0069665
366 Ga0466963_0327100
367 Ga0466963_0615092
368 Ga0466964_0004035
369 Ga0466964_0012932
370 Ga0466964_0018724
371 Ga0466964_0024729
372 Ga0466964_0074184
373 Ga0466964_0103098
374 Ga0466964_0238106
375 Ga0466964_0331711
376 Ga0466964_0446912
377 Ga0466964_0516728
378 Ga0466964_0531057
379 Ga0466971_0002636
380 Ga0466971_0002668
381 Ga0466971_0114864
382 Ga0466971_0129438
383 Ga0466971_0283501
384 Ga0466968_0007944
385 Ga0466968_0008822
386 Ga0466968_0466373
387 Ga0466970_0101927
388 Ga0466957_0000767
389 Ga0466957_0083009
390 Ga0466957_0116156
391 Ga0466957_0117864
392 Ga0466957_0124118
393 Ga0466957_0180840
394 Ga0466957_0182437
395 Ga0466957_0257776
396 Ga0466957_0495578
397 Ga0466957_0631748
398 Ga0466960_0021324
399 Ga0466960_0090718
400 Ga0466960_0137842
401 Ga0466959_0001733
402 Ga0466959_0001830
403 Ga0466959_0238168
404 Ga0466959_0282610
405 Ga0466959_0385057
406 Ga0466959_0849512
407 Ga0466958_0001082
408 Ga0466958_0002088
409 Ga0466958_0006936
410 Ga0466958_0014663
411 Ga0466958_0024450
412 Ga0466958_0175709
413 Ga0466967_0008793
414 Ga0466967_0019372
415 Ga0466967_0019823
416 Ga0466967_0021766
417 Ga0466967_0023440
418 Ga0466967_0048875
419 Ga0466967_0070296
420 Ga0466967_0079970
421 Ga0466967_0079984
422 Ga0466967_0150086
423 Ga0466967_0181499
424 Ga0466967_0304639
425 Ga0466967_0402469
426 Ga0466967_0438702
427 Ga0466967_0528673
428 Ga0466967_0750196
429 Ga0466967_0805819
430 Ga0466967_0860203
431 Ga0466967_0960361
432 Ga0466967_1334597
433 Ga0466967_1432903
434 Ga0466967_1475159
435 Ga0466967_1813962
436 Ga0466967_2421261
437 Ga0495624_0734038
438 Ga0496102_0045828
439 Ga0496103_0097108
440 Ga0496109_0536651
441 Ga0501047_0507555
442 Ga0501067_0082279
443 Ga0501067_0199172
444 Ga0501069_0548916
445 Ga0501070_0007832
446 Ga0501070_1192691
447 Ga0501072_0078465
448 Ga0501073_0012414
449 Ga0501074_0039602
450 Ga0501079_0464237
451 Ga0501080_0045236
452 Ga0501083_0000145
453 nmdc:mga06z11_255230_c1
454 Ga0501082_0519401
455 Ga0466962_0002466
456 Ga0466962_0242716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map