F340397

General Info

Members Datasets Scaffolds Average Seq Length
227 153 227 281

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_39400_c1|nmdc:mga05p37_39400_c1_3046_4023
Length 325
Sequence MRRKTREQTKHRKDETLKVLDVGAKVTDKVETLYKNLPFIRKSQGDSQEIPWLEIRPTLGWFSLDFRELWSYRELAYFLAWREIKVRYKQTAIGVAWAVLQPLAMMLVFTVFFGKLGNMPSEGIPYPLFAFAALLPWQLFSRTITECTNSLVTDQRLITRVYFPRIIIPLATTLSAIVDFAISAGLLVALMLFYGIFPGIEVVWLPAFILLMLIGALGVGFWLSALNVEYRDVRYALPFVSQFWLFVTPVVYSSSMVPEQWQILYGLNPMVGVVEGFRWALLGIGKGPSPMLVVSAVIAVALFVSGIIWFQRHEETFVDTLGTGG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.61
Nodule 0
Rhizoplane 1.32
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10382118 3300003323 Bacteria 1315
2 Ga0070676_10008956 3300005328 Bacteria 5413
3 Ga0070683_100088997 3300005329 Unclassified 2897
4 Ga0070683_100602705 3300005329 Bacteria 1051
5 Ga0070680_100267439 3300005336 Unclassified 1447
6 Ga0070669_100072544 3300005353 Bacteria 2549
7 Ga0070700_100038057 3300005441 Bacteria 2930
8 Ga0070694_100001384 3300005444 Bacteria 14179
9 Ga0070681_10025886 3300005458 Bacteria 5897
10 Ga0068867_100033739 3300005459 Bacteria 3709
11 Ga0070706_100090291 3300005467 Unclassified 2841
12 Ga0070707_100007701 3300005468 Bacteria 10003
13 Ga0070698_100066289 3300005471 Bacteria 3635
14 Ga0070699_100008332 3300005518 Bacteria 8986
15 Ga0070699_100167380 3300005518 Bacteria 1947
16 Ga0070679_100138664 3300005530 Bacteria 2413
17 Ga0070679_100251649 3300005530 Bacteria 1723
18 Ga0070684_100010426 3300005535 Bacteria 7364
19 Ga0070697_100050579 3300005536 Bacteria 3374
20 Ga0070672_100124442 3300005543 Bacteria 2113
21 Ga0070686_100049765 3300005544 Bacteria 2661
22 Ga0070695_100004610 3300005545 Bacteria 8092
23 Ga0070696_100003940 3300005546 Bacteria 9904
24 Ga0070704_100006671 3300005549 Bacteria 6821
25 Ga0070702_100010013 3300005615 Bacteria 4655
26 Ga0070702_100202989 3300005615 Bacteria 1314
27 Ga0068859_100066253 3300005617 Bacteria 3646
28 Ga0068859_100124086 3300005617 Bacteria 2650
29 Ga0068859_100126589 3300005617 Bacteria 2624
30 Ga0068859_100395529 3300005617 Bacteria 1478
31 Ga0068864_100148738 3300005618 Bacteria 2119
32 Ga0068866_10118281 3300005718 Bacteria 1489
33 Ga0068861_100002900 3300005719 Bacteria 11300
34 Ga0068861_100253653 3300005719 Bacteria 1502
35 Ga0068863_100205462 3300005841 Bacteria 1896
36 Ga0068860_100020170 3300005843 Bacteria 6460
37 Ga0068860_100055427 3300005843 Bacteria 3769
38 Ga0068860_100154508 3300005843 Unclassified 2211
39 Ga0068862_100157787 3300005844 Bacteria 2024
40 Ga0075365_10131990 3300006038 Bacteria 1729
41 Ga0075363_100066817 3300006048 Bacteria 1947
42 Ga0075364_10000386 3300006051 Bacteria 21904
43 Ga0075364_10009549 3300006051 Bacteria 5824
44 Ga0075362_10014639 3300006177 Bacteria 3170
45 Ga0075367_10005938 3300006178 Bacteria 6126
46 Ga0075367_10011829 3300006178 Bacteria 4634
47 Ga0075366_10051005 3300006195 Bacteria 2458
48 Ga0075366_10135297 3300006195 Bacteria 1488
49 Ga0097621_100000004 3300006237 Bacteria 144414
50 Ga0097621_100535935 3300006237 Unclassified 1064
51 Ga0068871_100000028 3300006358 Bacteria 78414
52 Ga0068871_100006713 3300006358 Bacteria 8167
53 Ga0068871_100124526 3300006358 Bacteria 2180
54 Ga0075428_100011317 3300006844 Bacteria 9925
55 Ga0075428_100378195 3300006844 Unclassified 1518
56 Ga0075431_100020389 3300006847 Bacteria 6773
57 Ga0075431_100094505 3300006847 Bacteria 3085
58 Ga0075431_100410094 3300006847 Bacteria 1355
59 Ga0075433_10014875 3300006852 Bacteria 6369
60 Ga0075433_10068550 3300006852 Bacteria 3114
61 Ga0075433_10165393 3300006852 Bacteria 1969
62 Ga0075434_100043566 3300006871 Bacteria 4452
63 Ga0075434_100100214 3300006871 Bacteria 2903
64 Ga0075436_100010897 3300006914 Bacteria 6240
65 Ga0097620_100066257 3300006931 Bacteria 3646
66 Ga0097620_100124082 3300006931 Bacteria 2650
67 Ga0097620_100126591 3300006931 Bacteria 2624
68 Ga0097620_100395532 3300006931 Bacteria 1478
69 Ga0075435_100015011 3300007076 Bacteria 5812
70 Ga0075435_100092003 3300007076 Unclassified 2504
71 Ga0105240_10000416 3300009093 Bacteria 78700
72 Ga0114129_10000665 3300009147 Bacteria 43114
73 Ga0114129_10038259 3300009147 Bacteria 6769
74 Ga0114129_10054744 3300009147 Bacteria 5593
75 Ga0114129_10085306 3300009147 Bacteria 4381
76 Ga0114129_10229350 3300009147 Unclassified 2502
77 Ga0114129_10566114 3300009147 Bacteria 1476
78 Ga0105241_10022769 3300009174 Unclassified 4644
79 Ga0105241_10294445 3300009174 Unclassified 1391
80 Ga0105242_10002799 3300009176 Bacteria 13660
81 Ga0105242_10215034 3300009176 Bacteria 1715
82 Ga0105248_10041947 3300009177 Bacteria 5131
83 Ga0105248_10137822 3300009177 Bacteria 2753
84 Ga0105248_10301798 3300009177 Bacteria 1803
85 Ga0105238_10115716 3300009551 Bacteria 2661
86 Ga0105246_10206389 3300011119 Bacteria 1531
87 Ga0157369_10002756 3300013105 Bacteria 20978
88 Ga0157374_10016237 3300013296 Bacteria 6542
89 Ga0157378_10074313 3300013297 Bacteria 3058
90 Ga0157378_10085327 3300013297 Unclassified 2860
91 Ga0163162_10009754 3300013306 Bacteria 9346
92 Ga0163162_10010593 3300013306 Bacteria 8966
93 Ga0157375_10087006 3300013308 Bacteria 3176
94 Ga0157375_10306091 3300013308 Bacteria 1753
95 Ga0163163_10280536 3300014325 Bacteria 1717
96 Ga0163163_10346010 3300014325 Bacteria 1542
97 Ga0163163_10382716 3300014325 Bacteria 1464
98 Ga0157379_10245865 3300014968 Bacteria 1623
99 Ga0157379_10438607 3300014968 Unclassified 1204
100 Ga0157376_10013120 3300014969 Bacteria 6172
101 Ga0163161_10151902 3300017792 Bacteria 1760
102 Ga0207645_10004855 3300025907 Bacteria 9868
103 Ga0207684_10074268 3300025910 Unclassified 2889
104 Ga0207660_10122810 3300025917 Bacteria 1968
105 Ga0207662_10031412 3300025918 Bacteria 3085
106 Ga0207652_10343789 3300025921 Bacteria 1347
107 Ga0207646_10008875 3300025922 Bacteria 10012
108 Ga0207694_10024691 3300025924 Unclassified 4566
109 Ga0207686_10000892 3300025934 Bacteria 18025
110 Ga0207665_10001011 3300025939 Bacteria 18999
111 Ga0207691_10184537 3300025940 Bacteria 1821
112 Ga0207711_10188582 3300025941 Bacteria 1878
113 Ga0207689_10144476 3300025942 Bacteria 1960
114 Ga0207661_10484231 3300025944 Bacteria 1130
115 Ga0207658_10393466 3300025986 Bacteria 1217
116 Ga0207703_10076976 3300026035 Bacteria 2768
117 Ga0207703_10097801 3300026035 Bacteria 2481
118 Ga0207708_10016359 3300026075 Bacteria 5576
119 Ga0207648_10101806 3300026089 Bacteria 2517
120 Ga0207676_10040856 3300026095 Bacteria 3557
121 Ga0207675_100006140 3300026118 Bacteria 11417
122 Ga0207675_100370173 3300026118 Bacteria 1407
123 Ga0268265_10085233 3300028380 Bacteria 2507
124 Ga0268264_10008195 3300028381 Bacteria 8677
125 Ga0268264_10032641 3300028381 Unclassified 4273
126 Ga0268264_10041415 3300028381 Bacteria 3810
127 Ga0265334_10035870 3300028573 Bacteria 1960
128 Ga0316579_10007734 3300031691 Bacteria 4453
129 Ga0316576_10003731 3300031727 Bacteria 8994
130 Ga0316576_10007383 3300031727 Bacteria 6920
131 Ga0316577_10000495 3300031733 Bacteria 15597
132 Ga0316577_10005306 3300031733 Bacteria 6754
133 Ga0373956_0007066 3300035119 Bacteria 4516
134 Ga0373957_0023519 3300035120 Bacteria 2205
135 Ga0373955_0004113 3300035172 Bacteria 6422
136 Ga0316574_0005090 3300035398 Bacteria 6984
137 Ga0373931_0086016 3300035691 Bacteria 1744
138 Ga0373933_0123263 3300035724 Bacteria 1624
139 Ga0373937_0000563 3300036401 Bacteria 32890
140 Ga0316582_0057775 3300036647 Unclassified 2479
141 Ga0316584_0001126 3300036712 Bacteria 15682
142 Ga0316584_0008873 3300036712 Bacteria 6950
143 Ga0316584_0131335 3300036712 Unclassified 1870
144 Ga0316584_0316029 3300036712 Unclassified 1128
145 Ga0395905_0000078 3300037471 Bacteria 161593
146 Ga0395905_0037307 3300037471 Bacteria 4564
147 Ga0395905_0470163 3300037471 Unclassified 1156
148 Ga0395901_0485092 3300038443 Bacteria 1260
149 Ga0436365_1646798 3300039437 Unclassified 1388
150 Ga0453683_0069160 3300044673 Bacteria 2208
151 Ga0453683_0072099 3300044673 Bacteria 2162
152 Ga0453684_0072955 3300044712 Unclassified 4330
153 Ga0453684_0353320 3300044712 Bacteria 1657
154 Ga0466967_0087236 3300045976 Bacteria 2828
155 Ga0495629_0058187 3300046459 Bacteria 2702
156 Ga0495641_0048913 3300046461 Bacteria 1937
157 Ga0495653_0178018 3300046463 Bacteria 1462
158 Ga0495608_0059418 3300046511 Bacteria 2519
159 Ga0495634_0070283 3300046642 Bacteria 2308
160 Ga0495624_0074412 3300046690 Bacteria 2110
161 Ga0495674_0066556 3300047319 Bacteria 3125
162 Ga0495680_0005918 3300047322 Bacteria 11429
163 Ga0495680_0161003 3300047322 Bacteria 1630
164 Ga0496100_0040639 3300048903 Bacteria 2961
165 Ga0496114_0086756 3300048917 Bacteria 2653
166 Ga0496115_0080202 3300048918 Bacteria 2657
167 Ga0501031_0072712 3300049568 Bacteria 2238
168 Ga0501032_0092630 3300049569 Bacteria 2004
169 Ga0501033_0000590 3300049570 Bacteria 33630
170 Ga0501034_0042512 3300049571 Bacteria 4600
171 Ga0501036_0025335 3300049572 Bacteria 5004
172 Ga0501037_0027426 3300049573 Bacteria 4207
173 Ga0501037_0051684 3300049573 Bacteria 3006
174 Ga0501038_0291548 3300049574 Bacteria 1282
175 Ga0501039_0076717 3300049575 Bacteria 2598
176 Ga0501040_0120167 3300049576 Bacteria 1843
177 Ga0501040_0193859 3300049576 Bacteria 1442
178 Ga0501041_0086019 3300049577 Bacteria 1939
179 Ga0501042_0039865 3300049578 Bacteria 3339
180 Ga0501042_0079051 3300049578 Bacteria 2356
181 Ga0501043_0031677 3300049579 Bacteria 4157
182 Ga0501047_0017971 3300049581 Bacteria 6778
183 Ga0501047_0410456 3300049581 Bacteria 1186
184 Ga0501048_0105341 3300049582 Bacteria 1990
185 Ga0501067_0025194 3300049583 Bacteria 3297
186 Ga0501069_0103038 3300049585 Bacteria 1621
187 Ga0501070_0058835 3300049586 Bacteria 3185
188 Ga0501071_0023963 3300049587 Bacteria 4267
189 Ga0501071_0099627 3300049587 Bacteria 2141
190 Ga0501072_0014721 3300049588 Bacteria 5998
191 Ga0501072_0149491 3300049588 Bacteria 1862
192 Ga0501076_0060909 3300049592 Bacteria 3004
193 Ga0501079_0059919 3300049741 Bacteria 2936
194 Ga0501083_0011626 3300049744 Bacteria 6176
195 Ga0501035_0093113 3300049822 Bacteria 2651
196 Ga0501044_0010161 3300049823 Bacteria 10228
197 Ga0501045_0075991 3300049824 Bacteria 2474
198 Ga0501045_0091502 3300049824 Unclassified 2248
199 nmdc:mga03n38_235959_c1 3300050490 Unclassified 960
200 nmdc:mga00v17_53570_c1 3300050491 Bacteria 2459
201 nmdc:mga00v17_8661_c1 3300050491 Bacteria 5481
202 nmdc:mga0yw44_252364_c1 3300050492 Bacteria 1174
203 nmdc:mga06z11_2173_c1 3300050494 Bacteria 7446
204 nmdc:mga04h51_4780_c1 3300050495 Bacteria 3400
205 nmdc:mga05p37_102319_c1 3300050507 Bacteria 3528
206 nmdc:mga05p37_1789_c1 3300050507 Bacteria 25102
207 nmdc:mga05p37_198723_c1 3300050507 Unclassified 2430
208 nmdc:mga05p37_39400_c1 3300050507 Bacteria 5802
209 nmdc:mga05p37_48928_c1 3300050507 Bacteria 5199
210 nmdc:mga09592_70103_c1 3300050508 Bacteria 2974
211 nmdc:mga06r32_141491_c1 3300050510 Bacteria 2382
212 nmdc:mga06r32_34933_c1 3300050510 Bacteria 4742
213 nmdc:mga08y16_90044_c1 3300050511 Bacteria 3197
214 nmdc:mga0n895_10902_c1 3300050512 Bacteria 8073
215 nmdc:mga0n895_135611_c1 3300050512 Bacteria 2488
216 nmdc:mga0n895_136713_c1 3300050512 Bacteria 2477
217 nmdc:mga0n895_17146_c1 3300050512 Bacteria 6672
218 nmdc:mga0n895_195279_c1 3300050512 Bacteria 2055
219 nmdc:mga0rr50_4494_c1 3300050513 Bacteria 8216
220 nmdc:mga0rr50_89792_c1 3300050513 Unclassified 2389
221 nmdc:mga08x19_2236_c1 3300050514 Bacteria 11821
222 nmdc:mga0a205_131739_c1 3300050515 Bacteria 2400
223 nmdc:mga0a205_18429_c1 3300050515 Bacteria 6563
224 Ga0495619_0101982 3300053085 Bacteria 1954
225 Ga0501084_0042280 3300054114 Bacteria 3812
226 Ga0501082_0016327 3300060353 Bacteria 6391
227 Ga0530510_0001587 3300061734 Bacteria 15335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_10902_c1 nmdc:mga0n895_10902_c1_7222_7992 235
2 3300014325 Ga0163163_10280536 Ga0163163_102805362 236
3 3300006051 Ga0075364_10009549 Ga0075364_100095494 243
4 3300006177 Ga0075362_10014639 Ga0075362_100146393 243
5 3300006178 Ga0075367_10005938 Ga0075367_100059384 243
6 3300006195 Ga0075366_10051005 Ga0075366_100510052 243
7 3300014325 Ga0163163_10346010 Ga0163163_103460101 244
8 3300006195 Ga0075366_10135297 Ga0075366_101352972 247
9 3300050512 nmdc:mga0n895_195279_c1 nmdc:mga0n895_195279_c1_1139_1984 250
10 3300005617 Ga0068859_100124086 Ga0068859_1001240862 252
11 3300006931 Ga0097620_100124082 Ga0097620_1001240822 252
12 3300009177 Ga0105248_10137822 Ga0105248_101378223 252
13 3300025942 Ga0207689_10144476 Ga0207689_101444762 253
14 3300050511 nmdc:mga08y16_90044_c1 nmdc:mga08y16_90044_c1_2374_3186 253
15 3300049585 Ga0501069_0103038 Ga0501069_0103038_20_823 256
16 3300050491 nmdc:mga00v17_53570_c1 nmdc:mga00v17_53570_c1_221_1033 256
17 3300005329 Ga0070683_100602705 Ga0070683_1006027051 258
18 3300039437 Ga0436365_1646798 Ga0436365_1646798_573_1355 260
19 3300050510 nmdc:mga06r32_141491_c1 nmdc:mga06r32_141491_c1_1125_2015 261
20 3300005719 Ga0068861_100253653 Ga0068861_1002536532 262
21 3300025944 Ga0207661_10484231 Ga0207661_104842311 262
22 3300044673 Ga0453683_0072099 Ga0453683_0072099_70_912 262
23 3300049578 Ga0501042_0079051 Ga0501042_0079051_740_1528 262
24 3300006914 Ga0075436_100010897 Ga0075436_1000108975 264
25 3300007076 Ga0075435_100015011 Ga0075435_1000150116 264
26 3300049568 Ga0501031_0072712 Ga0501031_0072712_1072_1905 264
27 3300049569 Ga0501032_0092630 Ga0501032_0092630_334_1167 264
28 3300049571 Ga0501034_0042512 Ga0501034_0042512_995_1828 264
29 3300049572 Ga0501036_0025335 Ga0501036_0025335_1031_1864 264
30 3300049573 Ga0501037_0027426 Ga0501037_0027426_63_896 264
31 3300049575 Ga0501039_0076717 Ga0501039_0076717_212_1045 264
32 3300049576 Ga0501040_0120167 Ga0501040_0120167_352_1185 264
33 3300049578 Ga0501042_0039865 Ga0501042_0039865_1204_2037 264
34 3300049581 Ga0501047_0410456 Ga0501047_0410456_334_1167 264
35 3300049582 Ga0501048_0105341 Ga0501048_0105341_884_1717 264
36 3300049583 Ga0501067_0025194 Ga0501067_0025194_1512_2345 264
37 3300049586 Ga0501070_0058835 Ga0501070_0058835_1753_2586 264
38 3300049587 Ga0501071_0099627 Ga0501071_0099627_1030_1863 264
39 3300049588 Ga0501072_0149491 Ga0501072_0149491_796_1629 264
40 3300049744 Ga0501083_0011626 Ga0501083_0011626_1756_2589 264
41 3300049822 Ga0501035_0093113 Ga0501035_0093113_935_1768 264
42 3300049824 Ga0501045_0091502 Ga0501045_0091502_1303_2136 264
43 3300050513 nmdc:mga0rr50_4494_c1 nmdc:mga0rr50_4494_c1_263_1099 264
44 3300050514 nmdc:mga08x19_2236_c1 nmdc:mga08x19_2236_c1_8921_9757 264
45 3300054114 Ga0501084_0042280 Ga0501084_0042280_1948_2781 264
46 3300060353 Ga0501082_0016327 Ga0501082_0016327_1997_2830 264
47 3300009093 Ga0105240_10000416 Ga0105240_1000041625 267
48 3300050490 nmdc:mga03n38_235959_c1 nmdc:mga03n38_235959_c1_16_819 267
49 3300005328 Ga0070676_10008956 Ga0070676_100089562 268
50 3300005353 Ga0070669_100072544 Ga0070669_1000725442 268
51 3300005441 Ga0070700_100038057 Ga0070700_1000380571 268
52 3300005459 Ga0068867_100033739 Ga0068867_1000337393 268
53 3300005545 Ga0070695_100004610 Ga0070695_1000046105 268
54 3300005546 Ga0070696_100003940 Ga0070696_1000039404 268
55 3300005549 Ga0070704_100006671 Ga0070704_1000066713 268
56 3300005615 Ga0070702_100010013 Ga0070702_1000100133 268
57 3300005718 Ga0068866_10118281 Ga0068866_101182812 268
58 3300005719 Ga0068861_100002900 Ga0068861_1000029003 268
59 3300025907 Ga0207645_10004855 Ga0207645_100048556 268
60 3300025941 Ga0207711_10188582 Ga0207711_101885822 268
61 3300026075 Ga0207708_10016359 Ga0207708_100163593 268
62 3300026089 Ga0207648_10101806 Ga0207648_101018061 268
63 3300026118 Ga0207675_100006140 Ga0207675_1000061406 268
64 3300005544 Ga0070686_100049765 Ga0070686_1000497652 269
65 3300026118 Ga0207675_100370173 Ga0207675_1003701731 269
66 3300005535 Ga0070684_100010426 Ga0070684_1000104262 270
67 3300006038 Ga0075365_10131990 Ga0075365_101319902 270
68 3300006048 Ga0075363_100066817 Ga0075363_1000668172 270
69 3300006051 Ga0075364_10000386 Ga0075364_1000038614 270
70 3300006178 Ga0075367_10011829 Ga0075367_100118296 270
71 3300013105 Ga0157369_10002756 Ga0157369_100027568 270
72 3300046459 Ga0495629_0058187 Ga0495629_0058187_503_1342 270
73 3300046461 Ga0495641_0048913 Ga0495641_0048913_260_1090 270
74 3300046463 Ga0495653_0178018 Ga0495653_0178018_35_874 270
75 3300046511 Ga0495608_0059418 Ga0495608_0059418_931_1770 270
76 3300046642 Ga0495634_0070283 Ga0495634_0070283_1357_2196 270
77 3300046690 Ga0495624_0074412 Ga0495624_0074412_258_1097 270
78 3300047319 Ga0495674_0066556 Ga0495674_0066556_385_1224 270
79 3300047322 Ga0495680_0005918 Ga0495680_0005918_2375_3214 270
80 3300050491 nmdc:mga00v17_8661_c1 nmdc:mga00v17_8661_c1_3057_3869 270
81 3300050492 nmdc:mga0yw44_252364_c1 nmdc:mga0yw44_252364_c1_300_1112 270
82 3300050494 nmdc:mga06z11_2173_c1 nmdc:mga06z11_2173_c1_3235_4047 270
83 3300050495 nmdc:mga04h51_4780_c1 nmdc:mga04h51_4780_c1_731_1543 270
84 3300053085 Ga0495619_0101982 Ga0495619_0101982_1026_1865 270
85 3300025939 Ga0207665_10001011 Ga0207665_100010112 271
86 3300035119 Ga0373956_0007066 Ga0373956_0007066_3062_3880 271
87 3300035120 Ga0373957_0023519 Ga0373957_0023519_711_1529 271
88 3300035172 Ga0373955_0004113 Ga0373955_0004113_1543_2361 271
89 3300035724 Ga0373933_0123263 Ga0373933_0123263_652_1470 271
90 3300036401 Ga0373937_0000563 Ga0373937_0000563_15551_16369 271
91 3300047322 Ga0495680_0161003 Ga0495680_0161003_107_925 271
92 3300049570 Ga0501033_0000590 Ga0501033_0000590_12721_13596 271
93 3300049573 Ga0501037_0051684 Ga0501037_0051684_173_1048 271
94 3300049574 Ga0501038_0291548 Ga0501038_0291548_279_1154 271
95 3300049579 Ga0501043_0031677 Ga0501043_0031677_1399_2274 271
96 3300049581 Ga0501047_0017971 Ga0501047_0017971_5516_6391 271
97 3300049823 Ga0501044_0010161 Ga0501044_0010161_7739_8614 271
98 3300006871 Ga0075434_100043566 Ga0075434_1000435665 272
99 3300014968 Ga0157379_10245865 Ga0157379_102458652 272
100 3300006852 Ga0075433_10068550 Ga0075433_100685502 273
101 3300013297 Ga0157378_10085327 Ga0157378_100853272 273
102 3300026035 Ga0207703_10076976 Ga0207703_100769763 273
103 3300035691 Ga0373931_0086016 Ga0373931_0086016_687_1517 273
104 3300037471 Ga0395905_0000078 Ga0395905_0000078_142927_143772 273
105 3300037471 Ga0395905_0037307 Ga0395905_0037307_2671_3519 273
106 3300044712 Ga0453684_0353320 Ga0453684_0353320_639_1484 273
107 3300050515 nmdc:mga0a205_131739_c1 nmdc:mga0a205_131739_c1_1174_2085 273
108 3300031691 Ga0316579_10007734 Ga0316579_100077342 274
109 3300031727 Ga0316576_10007383 Ga0316576_100073836 274
110 3300031733 Ga0316577_10000495 Ga0316577_1000049513 274
111 3300035398 Ga0316574_0005090 Ga0316574_0005090_5984_6838 274
112 3300036712 Ga0316584_0008873 Ga0316584_0008873_5634_6488 274
113 3300044712 Ga0453684_0072955 Ga0453684_0072955_3196_4047 274
114 3300005471 Ga0070698_100066289 Ga0070698_1000662894 275
115 3300005518 Ga0070699_100008332 Ga0070699_1000083324 275
116 3300005530 Ga0070679_100138664 Ga0070679_1001386642 275
117 3300005536 Ga0070697_100050579 Ga0070697_1000505792 275
118 3300005543 Ga0070672_100124442 Ga0070672_1001244422 275
119 3300005843 Ga0068860_100020170 Ga0068860_1000201704 275
120 3300009174 Ga0105241_10294445 Ga0105241_102944451 275
121 3300011119 Ga0105246_10206389 Ga0105246_102063892 275
122 3300013306 Ga0163162_10009754 Ga0163162_100097549 275
123 3300013308 Ga0157375_10087006 Ga0157375_100870062 275
124 3300028381 Ga0268264_10008195 Ga0268264_100081953 275
125 3300005444 Ga0070694_100001384 Ga0070694_1000013842 276
126 3300005468 Ga0070707_100007701 Ga0070707_1000077014 276
127 3300005615 Ga0070702_100202989 Ga0070702_1002029891 276
128 3300005617 Ga0068859_100066253 Ga0068859_1000662534 276
129 3300005617 Ga0068859_100126589 Ga0068859_1001265892 276
130 3300005617 Ga0068859_100395529 Ga0068859_1003955292 276
131 3300005618 Ga0068864_100148738 Ga0068864_1001487382 276
132 3300005841 Ga0068863_100205462 Ga0068863_1002054622 276
133 3300005843 Ga0068860_100154508 Ga0068860_1001545082 276
134 3300005844 Ga0068862_100157787 Ga0068862_1001577872 276
135 3300006931 Ga0097620_100066257 Ga0097620_1000662574 276
136 3300006931 Ga0097620_100126591 Ga0097620_1001265913 276
137 3300006931 Ga0097620_100395532 Ga0097620_1003955322 276
138 3300013306 Ga0163162_10010593 Ga0163162_100105938 276
139 3300013308 Ga0157375_10306091 Ga0157375_103060912 276
140 3300025918 Ga0207662_10031412 Ga0207662_100314123 276
141 3300025922 Ga0207646_10008875 Ga0207646_100088758 276
142 3300026035 Ga0207703_10097801 Ga0207703_100978014 276
143 3300026095 Ga0207676_10040856 Ga0207676_100408562 276
144 3300028380 Ga0268265_10085233 Ga0268265_100852332 276
145 3300028381 Ga0268264_10032641 Ga0268264_100326415 276
146 3300005843 Ga0068860_100055427 Ga0068860_1000554272 277
147 3300009176 Ga0105242_10215034 Ga0105242_102150342 277
148 3300009177 Ga0105248_10041947 Ga0105248_100419472 277
149 3300014325 Ga0163163_10382716 Ga0163163_103827162 277
150 3300025986 Ga0207658_10393466 Ga0207658_103934662 277
151 3300028381 Ga0268264_10041415 Ga0268264_100414154 277
152 3300006847 Ga0075431_100020389 Ga0075431_1000203893 278
153 3300050510 nmdc:mga06r32_34933_c1 nmdc:mga06r32_34933_c1_2483_3328 278
154 3300038443 Ga0395901_0485092 Ga0395901_0485092_315_1217 279
155 3300005329 Ga0070683_100088997 Ga0070683_1000889972 280
156 3300005336 Ga0070680_100267439 Ga0070680_1002674392 280
157 3300006847 Ga0075431_100410094 Ga0075431_1004100942 280
158 3300009176 Ga0105242_10002799 Ga0105242_100027992 281
159 3300025934 Ga0207686_10000892 Ga0207686_100008925 281
160 3300005518 Ga0070699_100167380 Ga0070699_1001673802 282
161 3300006844 Ga0075428_100011317 Ga0075428_1000113171 282
162 3300006847 Ga0075431_100094505 Ga0075431_1000945053 282
163 3300006852 Ga0075433_10014875 Ga0075433_100148754 282
164 3300006871 Ga0075434_100100214 Ga0075434_1001002142 282
165 3300007076 Ga0075435_100092003 Ga0075435_1000920032 282
166 3300009147 Ga0114129_10000665 Ga0114129_100006655 282
167 3300009147 Ga0114129_10054744 Ga0114129_100547443 282
168 3300009147 Ga0114129_10229350 Ga0114129_102293502 282
169 3300050507 nmdc:mga05p37_1789_c1 nmdc:mga05p37_1789_c1_4293_5141 282
170 3300050507 nmdc:mga05p37_198723_c1 nmdc:mga05p37_198723_c1_315_1163 282
171 3300050507 nmdc:mga05p37_48928_c1 nmdc:mga05p37_48928_c1_2772_3620 282
172 3300050508 nmdc:mga09592_70103_c1 nmdc:mga09592_70103_c1_1964_2812 282
173 3300050512 nmdc:mga0n895_135611_c1 nmdc:mga0n895_135611_c1_1108_1956 282
174 3300050512 nmdc:mga0n895_136713_c1 nmdc:mga0n895_136713_c1_1385_2233 282
175 3300050512 nmdc:mga0n895_17146_c1 nmdc:mga0n895_17146_c1_4730_5578 282
176 3300050513 nmdc:mga0rr50_89792_c1 nmdc:mga0rr50_89792_c1_1215_2072 282
177 3300050515 nmdc:mga0a205_18429_c1 nmdc:mga0a205_18429_c1_2818_3666 282
178 3300045976 Ga0466967_0087236 Ga0466967_0087236_1636_2547 283
179 3300006844 Ga0075428_100378195 Ga0075428_1003781952 284
180 3300009147 Ga0114129_10038259 Ga0114129_100382593 284
181 3300017792 Ga0163161_10151902 Ga0163161_101519022 284
182 3300031727 Ga0316576_10003731 Ga0316576_100037318 284
183 3300031733 Ga0316577_10005306 Ga0316577_100053066 284
184 3300036647 Ga0316582_0057775 Ga0316582_0057775_632_1528 284
185 3300036712 Ga0316584_0001126 Ga0316584_0001126_1176_2072 284
186 3300036712 Ga0316584_0131335 Ga0316584_0131335_504_1400 284
187 3300036712 Ga0316584_0316029 Ga0316584_0316029_103_999 284
188 3300050507 nmdc:mga05p37_102319_c1 nmdc:mga05p37_102319_c1_1911_2774 284
189 3300006237 Ga0097621_100000004 Ga0097621_10000000475 286
190 3300006358 Ga0068871_100000028 Ga0068871_10000002837 286
191 3300028573 Ga0265334_10035870 Ga0265334_100358702 286
192 3300044673 Ga0453683_0069160 Ga0453683_0069160_73_948 286
193 3300009177 Ga0105248_10301798 Ga0105248_103017982 287
194 3300037471 Ga0395905_0470163 Ga0395905_0470163_202_1107 287
195 3300025940 Ga0207691_10184537 Ga0207691_101845371 288
196 3300005458 Ga0070681_10025886 Ga0070681_100258863 289
197 3300005530 Ga0070679_100251649 Ga0070679_1002516492 289
198 3300006237 Ga0097621_100535935 Ga0097621_1005359351 289
199 3300006358 Ga0068871_100006713 Ga0068871_1000067134 289
200 3300006358 Ga0068871_100124526 Ga0068871_1001245262 289
201 3300009174 Ga0105241_10022769 Ga0105241_100227693 289
202 3300009551 Ga0105238_10115716 Ga0105238_101157162 289
203 3300013296 Ga0157374_10016237 Ga0157374_100162375 289
204 3300013297 Ga0157378_10074313 Ga0157378_100743132 289
205 3300014968 Ga0157379_10438607 Ga0157379_104386071 289
206 3300014969 Ga0157376_10013120 Ga0157376_100131204 289
207 3300025917 Ga0207660_10122810 Ga0207660_101228102 289
208 3300025921 Ga0207652_10343789 Ga0207652_103437892 289
209 3300025924 Ga0207694_10024691 Ga0207694_100246913 289
210 3300048903 Ga0496100_0040639 Ga0496100_0040639_1689_2588 289
211 3300048917 Ga0496114_0086756 Ga0496114_0086756_1248_2147 289
212 3300048918 Ga0496115_0080202 Ga0496115_0080202_291_1190 289
213 3300006852 Ga0075433_10165393 Ga0075433_101653932 290
214 3300009147 Ga0114129_10085306 Ga0114129_100853062 290
215 3300049576 Ga0501040_0193859 Ga0501040_0193859_25_948 290
216 3300049577 Ga0501041_0086019 Ga0501041_0086019_205_1128 290
217 3300049587 Ga0501071_0023963 Ga0501071_0023963_629_1552 290
218 3300049588 Ga0501072_0014721 Ga0501072_0014721_4874_5797 290
219 3300049592 Ga0501076_0060909 Ga0501076_0060909_1188_2111 290
220 3300049741 Ga0501079_0059919 Ga0501079_0059919_433_1356 290
221 3300049824 Ga0501045_0075991 Ga0501045_0075991_336_1259 290
222 3300050507 nmdc:mga05p37_39400_c1 nmdc:mga05p37_39400_c1_3046_4023 290
223 3300061734 Ga0530510_0001587 Ga0530510_0001587_6678_7601 290
224 3300009147 Ga0114129_10566114 Ga0114129_105661142 291
225 3300003323 rootH1_10382118 rootH1_103821181 294
226 3300005467 Ga0070706_100090291 Ga0070706_1000902912 294
227 3300025910 Ga0207684_10074268 Ga0207684_100742682 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

74

282

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8992 42 287
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8823 42 287
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8797 42 287
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.8795 34 287
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8756 42 287
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.651 87 280 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6463 94 282 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.589 72 280 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.461 87 280 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4508 94 282 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A3D1KIT2-F1-model_v4 Transport permease protein 0.9752 32 288 GO:0005886
GO:0015920
GO:0140359
AF-A0A533YVI4-F1-model_v4 ABC transporter permease 0.9741 174 287 GO:0015920
GO:0016020
GO:0140359
AF-A0A2V2RQ40-F1-model_v4 Phosphate ABC transporter permease 0.9642 133 287 GO:0015920
GO:0016020
GO:0140359
AF-A0A7V4A9N5-F1-model_v4 Transport permease protein 0.9628 18 288 GO:0005886
GO:0015920
GO:0140359
AF-A0A4Q7DIT9-F1-model_v4 Transport permease protein 0.9621 33 288 GO:0005886
GO:0015920
GO:0140359

Feature Viewer

pLDDT pTM Quality
81.51 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map