F340248

General Info

Members Datasets Scaffolds Average Seq Length
227 140 454 352

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0092271|Ga0466967_0092271_896_2002
Length 368
Sequence VPIKVVQWSTGNVGRHALAGIAARPELELTGVWVSSDAKAGQDAGRLAGLDRDLGVTATTDADALIASKPDCIVYTAMADNRLPEAIADLTKFLAAGINVVSSCPVFLQYPYGVVPPELIEPIEQAAQAGGASLFVNGVDPGFANDWLPLVLTSVSERIDEVRCMELLDYATYDNPTVLFDVMGFGKPLDETPMLLMPGVLSLAWGSVVRQIAAGLDVELDELKETVVRLPAPDTFEIPSGTIKEGTMAALRFEVQGMKDRRPVVVLEHVTRLRPDLGPDWPQPAGQGGYRVVVSGEPNYTLDLQLLGTDGDHNTAGLKATAMRLVNAVEAVVAAEPGIRTALDLPLITGRGLIGQFGRVGPDAVAAH

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
75 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
87 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
88 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
129 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2558860280 Kutzneria sp. 744 Isolate Unclassified
134 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
135 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
136 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
137 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
138 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
139 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
140 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0.44
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 6.61
Rhizosphere 81.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0092271 3300045976 Bacteria 2753
2 JGI25406J46586_10020918 3300003203 Bacteria 2635
3 Ga0055540_1000022 3300003792 Bacteria 201257
4 Ga0070658_10035349 3300005327 Bacteria 4024
5 Ga0070667_100021896 3300005367 Bacteria 5304
6 Ga0070714_100003326 3300005435 Bacteria 11985
7 Ga0070713_100055000 3300005436 Bacteria 3305
8 Ga0070681_10092852 3300005458 Bacteria 2967
9 Ga0070706_100326834 3300005467 Bacteria 1430
10 Ga0070698_100001488 3300005471 Bacteria 26030
11 Ga0068855_100285818 3300005563 Bacteria 1830
12 Ga0068856_100209268 3300005614 Bacteria 1965
13 Ga0068856_100357526 3300005614 Bacteria 1479
14 Ga0068852_100055907 3300005616 Bacteria 3408
15 Ga0081455_10003545 3300005937 Bacteria 17904
16 Ga0081455_10088943 3300005937 Bacteria 2508
17 Ga0081455_10123980 3300005937 Bacteria 2031
18 Ga0081538_10007334 3300005981 Bacteria 9550
19 Ga0081539_10000286 3300005985 Bacteria 114239
20 Ga0075364_10003798 3300006051 Bacteria 8644
21 Ga0075428_100001556 3300006844 Bacteria 24578
22 Ga0075428_100008627 3300006844 Bacteria 11303
23 Ga0075430_100002842 3300006846 Bacteria 14489
24 Ga0075430_100043178 3300006846 Bacteria 3811
25 Ga0075430_100055882 3300006846 Bacteria 3319
26 Ga0075431_100000341 3300006847 Bacteria 36704
27 Ga0075431_100023204 3300006847 Bacteria 6346
28 Ga0075429_100000385 3300006880 Bacteria 32534
29 Ga0075429_100096582 3300006880 Bacteria 2577
30 Ga0105240_10066708 3300009093 Bacteria 4463
31 Ga0111539_10002655 3300009094 Bacteria 23699
32 Ga0111539_10008398 3300009094 Bacteria 13142
33 Ga0111539_10104544 3300009094 Bacteria 3322
34 Ga0105245_10352753 3300009098 Bacteria 1458
35 Ga0114129_10003531 3300009147 Bacteria 21990
36 Ga0114129_10034790 3300009147 Bacteria 7117
37 Ga0114129_10061761 3300009147 Bacteria 5236
38 Ga0114129_10091723 3300009147 Bacteria 4208
39 Ga0105241_10097807 3300009174 Bacteria 2328
40 Ga0105237_10023699 3300009545 Bacteria 6284
41 Ga0105237_10208087 3300009545 Bacteria 1956
42 Ga0105239_10025074 3300010375 Bacteria 6569
43 Ga0105239_10056707 3300010375 Bacteria 4297
44 Ga0105239_10219011 3300010375 Bacteria 2134
45 Ga0157369_10068402 3300013105 Bacteria 3816
46 Ga0157372_10598903 3300013307 Bacteria 1285
47 Ga0206353_11119700 3300020082 Bacteria 6705
48 Ga0213876_10001008 3300021384 Bacteria 18308
49 Ga0224572_1004042 3300024225 Bacteria 2523
50 Ga0207695_10278151 3300025913 Bacteria 1568
51 Ga0207671_10026584 3300025914 Bacteria 4334
52 Ga0207671_10368982 3300025914 Bacteria 1140
53 Ga0207652_10249524 3300025921 Bacteria 1601
54 Ga0207681_10202882 3300025923 Bacteria 1524
55 Ga0207700_10044515 3300025928 Bacteria 3269
56 Ga0207664_10003823 3300025929 Bacteria 10108
57 Ga0207664_10351991 3300025929 Bacteria 1304
58 Ga0207664_10380144 3300025929 Bacteria 1254
59 Ga0207691_10278547 3300025940 Bacteria 1439
60 Ga0207667_10079043 3300025949 Bacteria 3408
61 Ga0207658_10004895 3300025986 Bacteria 9240
62 Ga0207702_10300179 3300026078 Bacteria 1524
63 Ga0207698_10010836 3300026142 Bacteria 5884
64 Ga0207428_10050904 3300027907 Bacteria 3311
65 Ga0207428_10179791 3300027907 Bacteria 1599
66 Ga0265318_10028567 3300028577 Bacteria 2180
67 Ga0265338_10021771 3300028800 Bacteria 6664
68 Ga0307512_10003053 3300030522 Bacteria 20071
69 Ga0265325_10029591 3300031241 Bacteria 2943
70 Ga0265327_10000252 3300031251 Bacteria 106339
71 Ga0265327_10002300 3300031251 Bacteria 20453
72 Ga0265327_10010631 3300031251 Bacteria 6443
73 Ga0307518_10000687 3300031838 Bacteria 25470
74 Ga0307407_10034664 3300031903 Bacteria 2766
75 Ga0307409_100077297 3300031995 Bacteria 2673
76 Ga0307411_10074561 3300032005 Bacteria 2313
77 Ga0373953_0050321 3300035117 Bacteria 1682
78 Ga0373956_0006029 3300035119 Bacteria 4853
79 Ga0373933_0005039 3300035724 Bacteria 7206
80 Ga0373937_0005961 3300036401 Bacteria 10491
81 Ga0436365_1223135 3300039437 Bacteria 5128
82 Ga0436365_1818876 3300039437 Bacteria 65425
83 Ga0436360_1069076 3300039438 Bacteria 3182
84 Ga0436362_0242738 3300039453 Bacteria 11388
85 Ga0466972_0003512 3300044658 Bacteria 7782
86 Ga0466972_0058711 3300044658 Bacteria 1847
87 Ga0466965_0084363 3300044683 Bacteria 1609
88 Ga0466966_0025745 3300044684 Bacteria 3843
89 Ga0466966_0062036 3300044684 Bacteria 2357
90 Ga0466966_0089342 3300044684 Bacteria 1914
91 Ga0466966_0133582 3300044684 Bacteria 1518
92 Ga0466966_0221782 3300044684 Bacteria 1141
93 Ga0466961_0029827 3300044693 Bacteria 3504
94 Ga0466961_0032536 3300044693 Bacteria 3352
95 Ga0466961_0039689 3300044693 Bacteria 3018
96 Ga0466961_0052177 3300044693 Bacteria 2610
97 Ga0466961_0072409 3300044693 Bacteria 2186
98 Ga0466961_0085374 3300044693 Bacteria 1996
99 Ga0466963_0086971 3300044694 Bacteria 2125
100 Ga0466963_0212369 3300044694 Bacteria 1354
101 Ga0466963_0221853 3300044694 Bacteria 1324
102 Ga0466971_0029230 3300044719 Bacteria 2465
103 Ga0466957_0054178 3300044842 Bacteria 2447
104 Ga0466960_0100238 3300044901 Bacteria 1490
105 Ga0466959_0041302 3300045049 Bacteria 3405
106 Ga0466959_0114706 3300045049 Bacteria 1920
107 Ga0466959_0262835 3300045049 Bacteria 1188
108 Ga0466958_0013050 3300045836 Bacteria 4721
109 Ga0466958_0018544 3300045836 Bacteria 4041
110 Ga0466958_0024262 3300045836 Bacteria 3568
111 Ga0466958_0039727 3300045836 Bacteria 2827
112 Ga0466958_0042191 3300045836 Bacteria 2747
113 Ga0466958_0086321 3300045836 Bacteria 1936
114 Ga0466958_0155696 3300045836 Bacteria 1442
115 Ga0466967_0004025 3300045976 Bacteria 9803
116 Ga0466967_0007050 3300045976 Bacteria 8052
117 Ga0466967_0009518 3300045976 Bacteria 7215
118 Ga0466967_0013211 3300045976 Bacteria 6368
119 Ga0466967_0076248 3300045976 Bacteria 3016
120 Ga0466967_0081217 3300045976 Bacteria 2928
121 Ga0466967_0173432 3300045976 Bacteria 2030
122 Ga0466967_0431750 3300045976 Bacteria 1285
123 Ga0495628_0040947 3300046516 Bacteria 3699
124 Ga0495669_0004308 3300046684 Bacteria 5871
125 Ga0496100_0000097 3300048903 Bacteria 50092
126 Ga0496101_0000032 3300048904 Bacteria 186783
127 Ga0496102_0000721 3300048905 Bacteria 32596
128 Ga0496102_0040122 3300048905 Bacteria 4233
129 Ga0496103_0000801 3300048906 Bacteria 23137
130 Ga0496103_0010603 3300048906 Bacteria 5454
131 Ga0496106_0008971 3300048909 Bacteria 7387
132 Ga0496107_0000522 3300048910 Bacteria 21371
133 Ga0496108_0023307 3300048911 Bacteria 5092
134 Ga0496108_0073769 3300048911 Bacteria 2881
135 Ga0496109_0000030 3300048912 Bacteria 164120
136 Ga0496111_0001243 3300048914 Bacteria 14263
137 Ga0496113_0300467 3300048916 Bacteria 1285
138 Ga0496114_0000187 3300048917 Bacteria 44786
139 Ga0496115_0009045 3300048918 Bacteria 7389
140 Ga0496116_0004962 3300048919 Bacteria 12540
141 Ga0496117_0072826 3300048920 Bacteria 2294
142 Ga0496119_0008172 3300048922 Bacteria 9261
143 Ga0496121_0000004 3300048924 Bacteria 1139011
144 Ga0496122_0000173 3300048925 Bacteria 153768
145 Ga0496123_0003164 3300048926 Bacteria 18798
146 Ga0496124_0000012 3300048927 Bacteria 512581
147 Ga0496125_0000003 3300048928 Bacteria 1189767
148 Ga0496126_0000001 3300048929 Bacteria 1139011
149 Ga0501031_0018093 3300049568 Bacteria 4583
150 Ga0501031_0050177 3300049568 Bacteria 2719
151 Ga0501033_0023306 3300049570 Bacteria 4669
152 Ga0501034_0037214 3300049571 Bacteria 4927
153 Ga0501036_0015008 3300049572 Bacteria 6464
154 Ga0501036_0062263 3300049572 Bacteria 3160
155 Ga0501037_0015220 3300049573 Bacteria 5660
156 Ga0501037_0032908 3300049573 Bacteria 3831
157 Ga0501037_0206833 3300049573 Bacteria 1385
158 Ga0501038_0000163 3300049574 Bacteria 56384
159 Ga0501038_0042099 3300049574 Bacteria 3978
160 Ga0501039_0021324 3300049575 Bacteria 4971
161 Ga0501040_0006320 3300049576 Bacteria 7690
162 Ga0501041_0015317 3300049577 Bacteria 4552
163 Ga0501042_0076223 3300049578 Bacteria 2400
164 Ga0501042_0113281 3300049578 Bacteria 1953
165 Ga0501043_0039501 3300049579 Bacteria 3708
166 Ga0501043_0083316 3300049579 Bacteria 2514
167 Ga0501046_0009289 3300049580 Bacteria 8513
168 Ga0501047_0001872 3300049581 Bacteria 20254
169 Ga0501047_0184240 3300049581 Bacteria 1953
170 Ga0501048_0000286 3300049582 Bacteria 34220
171 Ga0501048_0022956 3300049582 Bacteria 4560
172 Ga0501048_0039510 3300049582 Bacteria 3385
173 Ga0501069_0000592 3300049585 Bacteria 16794
174 Ga0501069_0161529 3300049585 Bacteria 1290
175 Ga0501070_0010545 3300049586 Bacteria 7811
176 Ga0501070_0010729 3300049586 Bacteria 7743
177 Ga0501070_0011898 3300049586 Bacteria 7349
178 Ga0501070_0168130 3300049586 Bacteria 1807
179 Ga0501071_0038390 3300049587 Bacteria 3422
180 Ga0501071_0092294 3300049587 Bacteria 2225
181 Ga0501072_0012511 3300049588 Bacteria 6488
182 Ga0501074_0017590 3300049590 Bacteria 5191
183 Ga0501075_0008818 3300049591 Bacteria 7030
184 Ga0501076_0018450 3300049592 Bacteria 5319
185 Ga0501077_0015657 3300049593 Bacteria 4776
186 Ga0501079_0019386 3300049741 Bacteria 5194
187 Ga0501080_0001451 3300049742 Bacteria 19932
188 Ga0501080_0015998 3300049742 Bacteria 6922
189 Ga0501080_0048946 3300049742 Bacteria 3933
190 Ga0501083_0091360 3300049744 Bacteria 2010
191 Ga0501035_0031548 3300049822 Bacteria 4825
192 Ga0501044_0037697 3300049823 Bacteria 5052
193 Ga0501044_0040012 3300049823 Bacteria 4888
194 Ga0501044_0044587 3300049823 Bacteria 4601
195 Ga0501044_0112915 3300049823 Bacteria 2724
196 Ga0501044_0250989 3300049823 Bacteria 1710
197 Ga0501044_0326717 3300049823 Bacteria 1457
198 nmdc:mga09592_29372_c1 3300050508 Bacteria 4573
199 nmdc:mga09592_408_c1 3300050508 Bacteria 31545
200 nmdc:mga09592_86372_c1 3300050508 Bacteria 2677
201 nmdc:mga0qj67_155638_c1 3300050509 Bacteria 1855
202 nmdc:mga0qj67_30288_c1 3300050509 Bacteria 4210
203 nmdc:mga0qj67_49533_c1 3300050509 Bacteria 3320
204 nmdc:mga0qj67_525_c1 3300050509 Bacteria 26055
205 nmdc:mga0qj67_54048_c1 3300050509 Bacteria 3180
206 nmdc:mga06r32_278599_c1 3300050510 Bacteria 1659
207 nmdc:mga06r32_328625_c1 3300050510 Bacteria 1514
208 nmdc:mga06r32_65812_c1 3300050510 Bacteria 3497
209 nmdc:mga06r32_9668_c1 3300050510 Bacteria 8710
210 nmdc:mga08y16_21570_c1 3300050511 Bacteria 6802
211 nmdc:mga08y16_23785_c1 3300050511 Bacteria 6469
212 nmdc:mga08y16_271961_c1 3300050511 Bacteria 1749
213 Ga0495619_0094797 3300053085 Bacteria 2025
214 Ga0500644_0018212 3300053088 Bacteria 2053
215 Ga0500641_0013759 3300053096 Bacteria 2976
216 Ga0500577_0002549 3300053142 Bacteria 4665
217 Ga0501084_0031055 3300054114 Bacteria 4467
218 Ga0501082_0074525 3300060353 Bacteria 2923
219 Ga0466962_0044949 3300061719 Bacteria 2112
220 2559432330 2558860280 Bacteria 11429938
221 2586059603 2585427649 Bacteria 9053857
222 2645721693 2643221961 Bacteria 3919167
223 2645724355 2643221962 Bacteria 3874254
224 2791913504 2791354901 Bacteria 8322202
225 2866613353 2866612099 Bacteria 7543886
226 2899363962 2899359706 Bacteria 10940472
227 8055071998 8055066027 Bacteria 9479577
228 Ga0466967_0092271
229 JGI25406J46586_10020918
230 Ga0055540_1000022
231 Ga0070658_10035349
232 Ga0070667_100021896
233 Ga0070714_100003326
234 Ga0070713_100055000
235 Ga0070681_10092852
236 Ga0070706_100326834
237 Ga0070698_100001488
238 Ga0068855_100285818
239 Ga0068856_100209268
240 Ga0068856_100357526
241 Ga0068852_100055907
242 Ga0081455_10003545
243 Ga0081455_10088943
244 Ga0081455_10123980
245 Ga0081538_10007334
246 Ga0081539_10000286
247 Ga0075364_10003798
248 Ga0075428_100001556
249 Ga0075428_100008627
250 Ga0075430_100002842
251 Ga0075430_100043178
252 Ga0075430_100055882
253 Ga0075431_100000341
254 Ga0075431_100023204
255 Ga0075429_100000385
256 Ga0075429_100096582
257 Ga0105240_10066708
258 Ga0111539_10002655
259 Ga0111539_10008398
260 Ga0111539_10104544
261 Ga0105245_10352753
262 Ga0114129_10003531
263 Ga0114129_10034790
264 Ga0114129_10061761
265 Ga0114129_10091723
266 Ga0105241_10097807
267 Ga0105237_10023699
268 Ga0105237_10208087
269 Ga0105239_10025074
270 Ga0105239_10056707
271 Ga0105239_10219011
272 Ga0157369_10068402
273 Ga0157372_10598903
274 Ga0206353_11119700
275 Ga0213876_10001008
276 Ga0224572_1004042
277 Ga0207695_10278151
278 Ga0207671_10026584
279 Ga0207671_10368982
280 Ga0207652_10249524
281 Ga0207681_10202882
282 Ga0207700_10044515
283 Ga0207664_10003823
284 Ga0207664_10351991
285 Ga0207664_10380144
286 Ga0207691_10278547
287 Ga0207667_10079043
288 Ga0207658_10004895
289 Ga0207702_10300179
290 Ga0207698_10010836
291 Ga0207428_10050904
292 Ga0207428_10179791
293 Ga0265318_10028567
294 Ga0265338_10021771
295 Ga0307512_10003053
296 Ga0265325_10029591
297 Ga0265327_10000252
298 Ga0265327_10002300
299 Ga0265327_10010631
300 Ga0307518_10000687
301 Ga0307407_10034664
302 Ga0307409_100077297
303 Ga0307411_10074561
304 Ga0373953_0050321
305 Ga0373956_0006029
306 Ga0373933_0005039
307 Ga0373937_0005961
308 Ga0436365_1223135
309 Ga0436365_1818876
310 Ga0436360_1069076
311 Ga0436362_0242738
312 Ga0466972_0003512
313 Ga0466972_0058711
314 Ga0466965_0084363
315 Ga0466966_0025745
316 Ga0466966_0062036
317 Ga0466966_0089342
318 Ga0466966_0133582
319 Ga0466966_0221782
320 Ga0466961_0029827
321 Ga0466961_0032536
322 Ga0466961_0039689
323 Ga0466961_0052177
324 Ga0466961_0072409
325 Ga0466961_0085374
326 Ga0466963_0086971
327 Ga0466963_0212369
328 Ga0466963_0221853
329 Ga0466971_0029230
330 Ga0466957_0054178
331 Ga0466960_0100238
332 Ga0466959_0041302
333 Ga0466959_0114706
334 Ga0466959_0262835
335 Ga0466958_0013050
336 Ga0466958_0018544
337 Ga0466958_0024262
338 Ga0466958_0039727
339 Ga0466958_0042191
340 Ga0466958_0086321
341 Ga0466958_0155696
342 Ga0466967_0004025
343 Ga0466967_0007050
344 Ga0466967_0009518
345 Ga0466967_0013211
346 Ga0466967_0076248
347 Ga0466967_0081217
348 Ga0466967_0173432
349 Ga0466967_0431750
350 Ga0495628_0040947
351 Ga0495669_0004308
352 Ga0496100_0000097
353 Ga0496101_0000032
354 Ga0496102_0000721
355 Ga0496102_0040122
356 Ga0496103_0000801
357 Ga0496103_0010603
358 Ga0496106_0008971
359 Ga0496107_0000522
360 Ga0496108_0023307
361 Ga0496108_0073769
362 Ga0496109_0000030
363 Ga0496111_0001243
364 Ga0496113_0300467
365 Ga0496114_0000187
366 Ga0496115_0009045
367 Ga0496116_0004962
368 Ga0496117_0072826
369 Ga0496119_0008172
370 Ga0496121_0000004
371 Ga0496122_0000173
372 Ga0496123_0003164
373 Ga0496124_0000012
374 Ga0496125_0000003
375 Ga0496126_0000001
376 Ga0501031_0018093
377 Ga0501031_0050177
378 Ga0501033_0023306
379 Ga0501034_0037214
380 Ga0501036_0015008
381 Ga0501036_0062263
382 Ga0501037_0015220
383 Ga0501037_0032908
384 Ga0501037_0206833
385 Ga0501038_0000163
386 Ga0501038_0042099
387 Ga0501039_0021324
388 Ga0501040_0006320
389 Ga0501041_0015317
390 Ga0501042_0076223
391 Ga0501042_0113281
392 Ga0501043_0039501
393 Ga0501043_0083316
394 Ga0501046_0009289
395 Ga0501047_0001872
396 Ga0501047_0184240
397 Ga0501048_0000286
398 Ga0501048_0022956
399 Ga0501048_0039510
400 Ga0501069_0000592
401 Ga0501069_0161529
402 Ga0501070_0010545
403 Ga0501070_0010729
404 Ga0501070_0011898
405 Ga0501070_0168130
406 Ga0501071_0038390
407 Ga0501071_0092294
408 Ga0501072_0012511
409 Ga0501074_0017590
410 Ga0501075_0008818
411 Ga0501076_0018450
412 Ga0501077_0015657
413 Ga0501079_0019386
414 Ga0501080_0001451
415 Ga0501080_0015998
416 Ga0501080_0048946
417 Ga0501083_0091360
418 Ga0501035_0031548
419 Ga0501044_0037697
420 Ga0501044_0040012
421 Ga0501044_0044587
422 Ga0501044_0112915
423 Ga0501044_0250989
424 Ga0501044_0326717
425 nmdc:mga09592_29372_c1
426 nmdc:mga09592_408_c1
427 nmdc:mga09592_86372_c1
428 nmdc:mga0qj67_155638_c1
429 nmdc:mga0qj67_30288_c1
430 nmdc:mga0qj67_49533_c1
431 nmdc:mga0qj67_525_c1
432 nmdc:mga0qj67_54048_c1
433 nmdc:mga06r32_278599_c1
434 nmdc:mga06r32_328625_c1
435 nmdc:mga06r32_65812_c1
436 nmdc:mga06r32_9668_c1
437 nmdc:mga08y16_21570_c1
438 nmdc:mga08y16_23785_c1
439 nmdc:mga08y16_271961_c1
440 Ga0495619_0094797
441 Ga0500644_0018212
442 Ga0500641_0013759
443 Ga0500577_0002549
444 Ga0501084_0031055
445 Ga0501082_0074525
446 Ga0466962_0044949
447 2559432330
448 2586059603
449 2645721693
450 2645724355
451 2791913504
452 2866613353
453 2899363962
454 8055071998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19328

DAP_DH_C

2,4-diaminopentanoate dehydrogenase C-terminal domain

143

359

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1h-assembly1.cif.gz_A-2 amine dehydrogenase from petrotoga mobilis; open form 0.8706 2 346
6g1m-assembly1.cif.gz_B amine dehydrogenase from petrotoga mobilis; open and closed form 0.8583 2 346
6g1m-assembly2.cif.gz_C amine dehydrogenase from petrotoga mobilis; open and closed form 0.8564 2 346
7xdu-assembly1.cif.gz_A ttheramdh-nad+ 0.8474 1 346
6iaq-assembly2.cif.gz_B structure of amine dehydrogenase from mycobacterium smegmatis 0.8459 1 348
ID Description Score Start End Superfamily
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 1 102 3.40.50.720
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9242 1 102 3.40.50.720
af_O53407_4_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8985 1 156 3.40.50.720
af_Q10SL7_36_116_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.891 1 65 3.40.50.720
af_O53407_4_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8648 1 156 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3IZA5-F1-model_v4 deleted 0.9939 2 70
AF-A0A7K0CA33-F1-model_v4 2,4-diaminopentanoate dehydrogenase (EC 1.4.1.26) 0.9899 2 352 GO:0016491
AF-A0A076N5B4-F1-model_v4 Dihydrodipicolinate reductase 0.9886 2 353
AF-A0A076N5B4-F1-model_v4 Dihydrodipicolinate reductase 0.9831 2 353
AF-A0A6J7RUX9-F1-model_v4 Unannotated protein 0.9819 82 352

Map