F340146

General Info

Members Datasets Scaffolds Average Seq Length
227 162 454 179

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0153328|Ga0373937_0153328_935_1540
Length 201
Sequence MKAGLNKYVKEKLIMKTYARLMMVTLLLTFAVPTLVAHAANKADIDGEVRVALAQLYESTPAARHLAAKAKAILVFPSILKAGLIIGGQGGNGALLKKGKTVGYYNTSAASYGLQAGVQTFGYAMFFMDEAALAYLNKSDGWEVGVGPSIVIVDKETAAAFGKSMTSSTLKDDIYAFIFSQKGLMAGIGLQGSKITRIHPE

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.44
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.52
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 16.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0153328 3300036401 Unclassified 2159
2 Ga0070683_100317712 3300005329 Bacteria 1482
3 Ga0070680_100373672 3300005336 Bacteria 1213
4 Ga0070689_100115236 3300005340 Bacteria 2142
5 Ga0070669_100818210 3300005353 Bacteria 792
6 Ga0070671_100000794 3300005355 Bacteria 22759
7 Ga0070671_100016457 3300005355 Bacteria 5980
8 Ga0070673_100614947 3300005364 Bacteria 992
9 Ga0070688_100081387 3300005365 Bacteria 2097
10 Ga0070714_100630183 3300005435 Unclassified 1031
11 Ga0070713_100322819 3300005436 Bacteria 1426
12 Ga0070713_100614611 3300005436 Bacteria 1033
13 Ga0070711_100649928 3300005439 Bacteria 884
14 Ga0070694_100501481 3300005444 Bacteria 966
15 Ga0070662_100459687 3300005457 Bacteria 1058
16 Ga0068867_100550061 3300005459 Bacteria 1000
17 Ga0070706_100113675 3300005467 Unclassified 2521
18 Ga0070706_101353520 3300005467 Bacteria 652
19 Ga0070679_100009503 3300005530 Bacteria 9198
20 Ga0070665_100000055 3300005548 Bacteria 242706
21 Ga0070665_100924079 3300005548 Bacteria 885
22 Ga0070664_100905130 3300005564 Bacteria 827
23 Ga0068856_100176300 3300005614 Bacteria 2150
24 Ga0068859_100153695 3300005617 Bacteria 2377
25 Ga0068859_101128169 3300005617 Unclassified 863
26 Ga0068864_100074720 3300005618 Bacteria 2957
27 Ga0068864_100235439 3300005618 Bacteria 1695
28 Ga0068866_10244813 3300005718 Bacteria 1094
29 Ga0068866_10804367 3300005718 Bacteria 654
30 Ga0068861_100884989 3300005719 Bacteria 845
31 Ga0068861_100936571 3300005719 Unclassified 823
32 Ga0068863_100396363 3300005841 Unclassified 1349
33 Ga0068858_100009445 3300005842 Bacteria 9303
34 Ga0068858_100593132 3300005842 Unclassified 1074
35 Ga0068862_100881444 3300005844 Bacteria 879
36 Ga0081538_10179156 3300005981 Unclassified 910
37 Ga0070717_10106964 3300006028 Bacteria 2382
38 Ga0075432_10006763 3300006058 Bacteria 3906
39 Ga0075432_10011255 3300006058 Bacteria 3041
40 Ga0097621_100235776 3300006237 Bacteria 1598
41 Ga0075428_100046635 3300006844 Bacteria 4760
42 Ga0075428_100105545 3300006844 Unclassified 3072
43 Ga0075428_100111474 3300006844 Bacteria 2980
44 Ga0075430_100007771 3300006846 Bacteria 9060
45 Ga0075430_100418659 3300006846 Bacteria 1106
46 Ga0075431_100003624 3300006847 Bacteria 14962
47 Ga0075431_100046815 3300006847 Bacteria 4460
48 Ga0075431_100123429 3300006847 Unclassified 2672
49 Ga0075431_100306424 3300006847 Unclassified 1604
50 Ga0075433_10198040 3300006852 Bacteria 1786
51 Ga0075434_100001390 3300006871 Bacteria 20313
52 Ga0075434_100212617 3300006871 Unclassified 1954
53 Ga0075434_101775791 3300006871 Unclassified 624
54 Ga0075429_100061209 3300006880 Unclassified 3279
55 Ga0075429_100099525 3300006880 Bacteria 2537
56 Ga0075436_100108328 3300006914 Bacteria 1938
57 Ga0097620_100153704 3300006931 Bacteria 2377
58 Ga0097620_101128280 3300006931 Unclassified 863
59 Ga0075435_100001541 3300007076 Bacteria 14847
60 Ga0105251_10026283 3300009011 Bacteria 2965
61 Ga0105240_10005750 3300009093 Bacteria 18397
62 Ga0111539_11117766 3300009094 Bacteria 916
63 Ga0114129_10106412 3300009147 Unclassified 3874
64 Ga0114129_10138896 3300009147 Bacteria 3332
65 Ga0114129_10141236 3300009147 Bacteria 3301
66 Ga0114129_10179368 3300009147 Unclassified 2883
67 Ga0105248_10121764 3300009177 Bacteria 2943
68 Ga0105248_10345728 3300009177 Bacteria 1674
69 Ga0105248_11388820 3300009177 Unclassified 795
70 Ga0105248_11822324 3300009177 Unclassified 690
71 Ga0105237_10095773 3300009545 Bacteria 2958
72 Ga0105249_10518063 3300009553 Bacteria 1239
73 Ga0105249_10716531 3300009553 Unclassified 1061
74 Ga0105239_10068818 3300010375 Bacteria 3890
75 Ga0105246_10250671 3300011119 Bacteria 1405
76 Ga0157370_10024509 3300013104 Bacteria 5976
77 Ga0157370_10157860 3300013104 Bacteria 2110
78 Ga0157374_10305160 3300013296 Bacteria 1575
79 Ga0163162_10033651 3300013306 Bacteria 5093
80 Ga0163162_10144282 3300013306 Bacteria 2495
81 Ga0163162_10231148 3300013306 Bacteria 1980
82 Ga0157380_10067722 3300014326 Bacteria 2876
83 Ga0182008_10200206 3300014497 Bacteria 1016
84 Ga0157379_10247301 3300014968 Bacteria 1618
85 Ga0157376_10040658 3300014969 Unclassified 3801
86 Ga0224712_10068477 3300022467 Bacteria 1435
87 Ga0207642_10194387 3300025899 Bacteria 1116
88 Ga0207688_10241177 3300025901 Bacteria 1093
89 Ga0207695_10001305 3300025913 Bacteria 42353
90 Ga0207663_10106025 3300025916 Bacteria 1898
91 Ga0207660_10326177 3300025917 Bacteria 1227
92 Ga0207652_10127699 3300025921 Bacteria 2266
93 Ga0207646_10816054 3300025922 Bacteria 830
94 Ga0207694_10170916 3300025924 Bacteria 1760
95 Ga0207700_10254140 3300025928 Bacteria 1502
96 Ga0207700_10282856 3300025928 Bacteria 1427
97 Ga0207644_10011429 3300025931 Bacteria 5874
98 Ga0207644_10238722 3300025931 Bacteria 1446
99 Ga0207669_10009936 3300025937 Bacteria 4558
100 Ga0207711_10148390 3300025941 Bacteria 2114
101 Ga0207711_11265382 3300025941 Unclassified 680
102 Ga0207679_10805232 3300025945 Bacteria 857
103 Ga0207651_11018446 3300025960 Unclassified 740
104 Ga0207712_10178489 3300025961 Bacteria 1666
105 Ga0207658_10608450 3300025986 Bacteria 982
106 Ga0207703_10002277 3300026035 Bacteria 16727
107 Ga0207708_10654115 3300026075 Bacteria 895
108 Ga0207702_10815744 3300026078 Bacteria 922
109 Ga0207676_10011525 3300026095 Bacteria 6323
110 Ga0207676_10826051 3300026095 Bacteria 905
111 Ga0207675_100265855 3300026118 Bacteria 1663
112 Ga0207698_10640356 3300026142 Bacteria 1052
113 Ga0207428_10104676 3300027907 Bacteria 2183
114 Ga0268266_10000027 3300028379 Bacteria 426852
115 Ga0268266_10021459 3300028379 Bacteria 5501
116 Ga0265325_10005576 3300031241 Bacteria 7764
117 Ga0265327_10000463 3300031251 Bacteria 72345
118 Ga0307513_10094960 3300031456 Bacteria 3025
119 Ga0307408_100590954 3300031548 Bacteria 985
120 Ga0307409_100123354 3300031995 Bacteria 2199
121 Ga0373944_0073222 3300035089 Bacteria 1120
122 Ga0373943_0006039 3300035170 Bacteria 5437
123 Ga0373943_0297552 3300035170 Bacteria 916
124 Ga0373946_0011384 3300035171 Bacteria 3319
125 Ga0373935_0014431 3300035692 Bacteria 4767
126 Ga0373935_0227258 3300035692 Unclassified 1298
127 Ga0373927_0032683 3300035695 Bacteria 3389
128 Ga0373927_0602157 3300035695 Bacteria 726
129 Ga0373933_0483171 3300035724 Bacteria 811
130 Ga0373947_0049487 3300035725 Bacteria 2524
131 Ga0373937_0105024 3300036401 Bacteria 2624
132 Ga0373925_0011013 3300037068 Bacteria 6567
133 Ga0373925_0023282 3300037068 Bacteria 4520
134 Ga0373925_0232026 3300037068 Bacteria 1476
135 Ga0436361_0526949 3300039447 Bacteria 1930
136 Ga0436361_0830673 3300039447 Unclassified 2707
137 Ga0451577_0024523 3300042876 Bacteria 5486
138 Ga0453684_0208283 3300044712 Bacteria 2275
139 Ga0453684_0441147 3300044712 Bacteria 1451
140 Ga0451576_0032828 3300045051 Bacteria 5521
141 Ga0495627_018725 3300046453 Bacteria 2330
142 Ga0495592_0142834 3300046454 Bacteria 1663
143 Ga0495603_0014176 3300046455 Bacteria 4822
144 Ga0495591_022761 3300046458 Bacteria 2020
145 Ga0495638_0045036 3300046460 Bacteria 2777
146 Ga0495638_0054693 3300046460 Bacteria 2480
147 Ga0495650_0079145 3300046471 Bacteria 1271
148 Ga0495582_0072993 3300046473 Bacteria 1899
149 Ga0495639_0040024 3300046475 Bacteria 2108
150 Ga0495584_0000180 3300046491 Bacteria 44615
151 Ga0495584_0188391 3300046491 Bacteria 1048
152 Ga0495594_0013706 3300046499 Bacteria 4237
153 Ga0495596_0000189 3300046500 Bacteria 42603
154 Ga0495610_0150097 3300046512 Bacteria 995
155 Ga0495616_0001701 3300046513 Bacteria 15005
156 Ga0495628_0089205 3300046516 Bacteria 2389
157 Ga0495631_0000083 3300046518 Bacteria 60818
158 Ga0495632_0020294 3300046519 Bacteria 3599
159 Ga0495632_0094022 3300046519 Bacteria 1418
160 Ga0495648_0003844 3300046524 Bacteria 13031
161 Ga0495642_0001785 3300046528 Bacteria 9273
162 Ga0495642_0055145 3300046528 Bacteria 1640
163 Ga0495652_0540597 3300046529 Bacteria 802
164 Ga0495654_0001806 3300046530 Bacteria 14258
165 Ga0495654_0009635 3300046530 Bacteria 5289
166 Ga0495654_0029891 3300046530 Bacteria 2776
167 Ga0495587_0270634 3300046536 Unclassified 953
168 Ga0495609_0023162 3300046538 Bacteria 2855
169 Ga0495622_0007428 3300046557 Bacteria 5085
170 Ga0495633_0144549 3300046558 Bacteria 1099
171 Ga0495667_0300406 3300046559 Bacteria 1017
172 Ga0495668_0000783 3300046616 Bacteria 36934
173 Ga0495588_0085505 3300046674 Bacteria 1649
174 Ga0495623_0000268 3300046679 Bacteria 33703
175 Ga0495646_0249333 3300046680 Bacteria 952
176 Ga0495646_0270498 3300046680 Unclassified 905
177 Ga0495658_0209376 3300046683 Bacteria 1218
178 Ga0495669_0022427 3300046684 Unclassified 2742
179 Ga0495669_0042269 3300046684 Bacteria 2026
180 Ga0495670_0009651 3300046691 Bacteria 4742
181 Ga0495649_0123327 3300046694 Bacteria 1369
182 Ga0495589_0046846 3300046794 Bacteria 2144
183 Ga0495600_0217792 3300046809 Bacteria 1222
184 Ga0495660_0040502 3300046810 Bacteria 2581
185 Ga0495674_0378759 3300047319 Bacteria 1145
186 Ga0495674_0857839 3300047319 Unclassified 703
187 Ga0495680_0051622 3300047322 Bacteria 3209
188 Ga0495683_0103088 3300047323 Bacteria 1370
189 Ga0495675_0377890 3300047444 Bacteria 829
190 Ga0495681_0002692 3300047470 Bacteria 12586
191 Ga0495681_0051144 3300047470 Bacteria 1944
192 Ga0495684_0499744 3300047471 Bacteria 836
193 Ga0495593_0004306 3300047673 Bacteria 8467
194 Ga0495626_0057050 3300048091 Bacteria 1787
195 Ga0496107_0420720 3300048910 Bacteria 993
196 Ga0496108_0029796 3300048911 Bacteria 4522
197 Ga0496109_0003678 3300048912 Bacteria 12813
198 Ga0496109_0381107 3300048912 Archaea 1332
199 Ga0496110_0691734 3300048913 Bacteria 921
200 Ga0496111_0570888 3300048914 Unclassified 829
201 Ga0496112_0110859 3300048915 Bacteria 2714
202 Ga0496113_0251209 3300048916 Bacteria 1412
203 Ga0496118_0160012 3300048921 Bacteria 1394
204 Ga0496121_0030445 3300048924 Bacteria 4956
205 Ga0501076_0104368 3300049592 Bacteria 2287
206 Ga0501076_0835562 3300049592 Bacteria 760
207 nmdc:mga05p37_127704_c1 3300050507 Bacteria 3121
208 nmdc:mga05p37_20396_c1 3300050507 Bacteria 8018
209 nmdc:mga05p37_94730_c1 3300050507 Bacteria 3678
210 nmdc:mga09592_85554_c1 3300050508 Bacteria 2689
211 nmdc:mga0qj67_103252_c1 3300050509 Bacteria 2299
212 nmdc:mga0qj67_360893_c1 3300050509 Bacteria 1174
213 nmdc:mga0qj67_414093_c1 3300050509 Bacteria 1087
214 nmdc:mga06r32_236005_c1 3300050510 Unclassified 1816
215 nmdc:mga06r32_280700_c1 3300050510 Unclassified 1652
216 nmdc:mga06r32_388637_c1 3300050510 Unclassified 1378
217 nmdc:mga08y16_1370787_c1 3300050511 Bacteria 671
218 nmdc:mga08y16_632026_c1 3300050511 Bacteria 1076
219 nmdc:mga0n895_1150247_c1 3300050512 Unclassified 752
220 nmdc:mga0n895_5475_c1 3300050512 Bacteria 10622
221 nmdc:mga0rr50_403192_c1 3300050513 Bacteria 1155
222 nmdc:mga0rr50_6939_c1 3300050513 Bacteria 6945
223 nmdc:mga0a205_181299_c1 3300050515 Unclassified 2000
224 nmdc:mga0a205_738247_c1 3300050515 Unclassified 833
225 Ga0495595_0059472 3300053084 Unclassified 1787
226 Ga0501084_0222738 3300054114 Bacteria 1592
227 2919462244 2919456309 Bacteria 6586567
228 Ga0373937_0153328
229 Ga0070683_100317712
230 Ga0070680_100373672
231 Ga0070689_100115236
232 Ga0070669_100818210
233 Ga0070671_100000794
234 Ga0070671_100016457
235 Ga0070673_100614947
236 Ga0070688_100081387
237 Ga0070714_100630183
238 Ga0070713_100322819
239 Ga0070713_100614611
240 Ga0070711_100649928
241 Ga0070694_100501481
242 Ga0070662_100459687
243 Ga0068867_100550061
244 Ga0070706_100113675
245 Ga0070706_101353520
246 Ga0070679_100009503
247 Ga0070665_100000055
248 Ga0070665_100924079
249 Ga0070664_100905130
250 Ga0068856_100176300
251 Ga0068859_100153695
252 Ga0068859_101128169
253 Ga0068864_100074720
254 Ga0068864_100235439
255 Ga0068866_10244813
256 Ga0068866_10804367
257 Ga0068861_100884989
258 Ga0068861_100936571
259 Ga0068863_100396363
260 Ga0068858_100009445
261 Ga0068858_100593132
262 Ga0068862_100881444
263 Ga0081538_10179156
264 Ga0070717_10106964
265 Ga0075432_10006763
266 Ga0075432_10011255
267 Ga0097621_100235776
268 Ga0075428_100046635
269 Ga0075428_100105545
270 Ga0075428_100111474
271 Ga0075430_100007771
272 Ga0075430_100418659
273 Ga0075431_100003624
274 Ga0075431_100046815
275 Ga0075431_100123429
276 Ga0075431_100306424
277 Ga0075433_10198040
278 Ga0075434_100001390
279 Ga0075434_100212617
280 Ga0075434_101775791
281 Ga0075429_100061209
282 Ga0075429_100099525
283 Ga0075436_100108328
284 Ga0097620_100153704
285 Ga0097620_101128280
286 Ga0075435_100001541
287 Ga0105251_10026283
288 Ga0105240_10005750
289 Ga0111539_11117766
290 Ga0114129_10106412
291 Ga0114129_10138896
292 Ga0114129_10141236
293 Ga0114129_10179368
294 Ga0105248_10121764
295 Ga0105248_10345728
296 Ga0105248_11388820
297 Ga0105248_11822324
298 Ga0105237_10095773
299 Ga0105249_10518063
300 Ga0105249_10716531
301 Ga0105239_10068818
302 Ga0105246_10250671
303 Ga0157370_10024509
304 Ga0157370_10157860
305 Ga0157374_10305160
306 Ga0163162_10033651
307 Ga0163162_10144282
308 Ga0163162_10231148
309 Ga0157380_10067722
310 Ga0182008_10200206
311 Ga0157379_10247301
312 Ga0157376_10040658
313 Ga0224712_10068477
314 Ga0207642_10194387
315 Ga0207688_10241177
316 Ga0207695_10001305
317 Ga0207663_10106025
318 Ga0207660_10326177
319 Ga0207652_10127699
320 Ga0207646_10816054
321 Ga0207694_10170916
322 Ga0207700_10254140
323 Ga0207700_10282856
324 Ga0207644_10011429
325 Ga0207644_10238722
326 Ga0207669_10009936
327 Ga0207711_10148390
328 Ga0207711_11265382
329 Ga0207679_10805232
330 Ga0207651_11018446
331 Ga0207712_10178489
332 Ga0207658_10608450
333 Ga0207703_10002277
334 Ga0207708_10654115
335 Ga0207702_10815744
336 Ga0207676_10011525
337 Ga0207676_10826051
338 Ga0207675_100265855
339 Ga0207698_10640356
340 Ga0207428_10104676
341 Ga0268266_10000027
342 Ga0268266_10021459
343 Ga0265325_10005576
344 Ga0265327_10000463
345 Ga0307513_10094960
346 Ga0307408_100590954
347 Ga0307409_100123354
348 Ga0373944_0073222
349 Ga0373943_0006039
350 Ga0373943_0297552
351 Ga0373946_0011384
352 Ga0373935_0014431
353 Ga0373935_0227258
354 Ga0373927_0032683
355 Ga0373927_0602157
356 Ga0373933_0483171
357 Ga0373947_0049487
358 Ga0373937_0105024
359 Ga0373925_0011013
360 Ga0373925_0023282
361 Ga0373925_0232026
362 Ga0436361_0526949
363 Ga0436361_0830673
364 Ga0451577_0024523
365 Ga0453684_0208283
366 Ga0453684_0441147
367 Ga0451576_0032828
368 Ga0495627_018725
369 Ga0495592_0142834
370 Ga0495603_0014176
371 Ga0495591_022761
372 Ga0495638_0045036
373 Ga0495638_0054693
374 Ga0495650_0079145
375 Ga0495582_0072993
376 Ga0495639_0040024
377 Ga0495584_0000180
378 Ga0495584_0188391
379 Ga0495594_0013706
380 Ga0495596_0000189
381 Ga0495610_0150097
382 Ga0495616_0001701
383 Ga0495628_0089205
384 Ga0495631_0000083
385 Ga0495632_0020294
386 Ga0495632_0094022
387 Ga0495648_0003844
388 Ga0495642_0001785
389 Ga0495642_0055145
390 Ga0495652_0540597
391 Ga0495654_0001806
392 Ga0495654_0009635
393 Ga0495654_0029891
394 Ga0495587_0270634
395 Ga0495609_0023162
396 Ga0495622_0007428
397 Ga0495633_0144549
398 Ga0495667_0300406
399 Ga0495668_0000783
400 Ga0495588_0085505
401 Ga0495623_0000268
402 Ga0495646_0249333
403 Ga0495646_0270498
404 Ga0495658_0209376
405 Ga0495669_0022427
406 Ga0495669_0042269
407 Ga0495670_0009651
408 Ga0495649_0123327
409 Ga0495589_0046846
410 Ga0495600_0217792
411 Ga0495660_0040502
412 Ga0495674_0378759
413 Ga0495674_0857839
414 Ga0495680_0051622
415 Ga0495683_0103088
416 Ga0495675_0377890
417 Ga0495681_0002692
418 Ga0495681_0051144
419 Ga0495684_0499744
420 Ga0495593_0004306
421 Ga0495626_0057050
422 Ga0496107_0420720
423 Ga0496108_0029796
424 Ga0496109_0003678
425 Ga0496109_0381107
426 Ga0496110_0691734
427 Ga0496111_0570888
428 Ga0496112_0110859
429 Ga0496113_0251209
430 Ga0496118_0160012
431 Ga0496121_0030445
432 Ga0501076_0104368
433 Ga0501076_0835562
434 nmdc:mga05p37_127704_c1
435 nmdc:mga05p37_20396_c1
436 nmdc:mga05p37_94730_c1
437 nmdc:mga09592_85554_c1
438 nmdc:mga0qj67_103252_c1
439 nmdc:mga0qj67_360893_c1
440 nmdc:mga0qj67_414093_c1
441 nmdc:mga06r32_236005_c1
442 nmdc:mga06r32_280700_c1
443 nmdc:mga06r32_388637_c1
444 nmdc:mga08y16_1370787_c1
445 nmdc:mga08y16_632026_c1
446 nmdc:mga0n895_1150247_c1
447 nmdc:mga0n895_5475_c1
448 nmdc:mga0rr50_403192_c1
449 nmdc:mga0rr50_6939_c1
450 nmdc:mga0a205_181299_c1
451 nmdc:mga0a205_738247_c1
452 Ga0495595_0059472
453 Ga0501084_0222738
454 2919462244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

108

199

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.8074 32 184
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.757 32 184
3e5t-assembly1.cif.gz_A-2 crystal structure analysis of fp611 0.6095 57 118
1xmz-assembly1.cif.gz_B crystal structure of the dark state of kindling fluorescent protein kfp from anemonia sulcata 0.5959 57 120
3mgf-assembly2.cif.gz_B crystal structure of monomeric kusabira-orange (mko), orange-emitting gfp-like protein, at ph 7.5 0.591 57 119
ID Description Score Start End Superfamily
af_A0A0P0Y7I2_39_194_2.170.150.80 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;NAC domain 0.6325 67 100 2.170.150.80
af_Q58217_26_175_3.40.1410.10 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.6168 65 98 3.40.1410.10
af_Q8NDA2_4372_4606_2.40.155.10 Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein 0.6162 59 112 2.40.155.10
af_Q96RW7_4860_5085_2.40.155.10 Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein 0.6108 59 112 2.40.155.10
af_P12111_2988_3089_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6034 60 106 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1V0B3D6-F1-model_v4 Twin-arginine translocation pathway signal protein 0.977 31 184
AF-A0A840UPK2-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.9711 21 187
AF-A0A1A8XRH8-F1-model_v4 Twin-arginine translocation pathway signal 0.9671 32 184
AF-A0A482J2M3-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9648 32 185
AF-A0A661KE92-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9646 65 187

Map