F340054

General Info

Members Datasets Scaffolds Average Seq Length
227 177 211 242

Family's Representative Sequence

Representative Sequence 3300027665|Ga0209983_1007910|Ga0209983_10079102
Length 275
Sequence MSTTLLQLSDLCVSYGPVEAVHHIDLEVHEGEIVTVIGPNGAGKTTLLSAAMGLLPARGTLRWMGQALPRITVEAMVARGVGLVPEKRELFGEMSVEDNLLLGGFSAWRERWAPNRLRRRPPGGDAGSAWGGPAPAGGKRDLRTRMDEVFGIFPRLKERRAQLAATLSGGERQMLAIGRALMAGPKLLMLDEPSLGLAPLIVREVLQVVAGLRERGVAVLLVEQNARAALQIADRGYVLEMGSVALSGPADELARDPRIVHTYLGLGGDAVQAAA

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
3 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
4 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
5 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
6 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
7 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
8 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
9 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
10 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
11 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
119 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
120 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 639633007 Azoarcus olearius BH72 Isolate Unclassified
176 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
177 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.95
Metatranscriptomes 0
Isolates 7.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.61
Nodule 0.88
Rhizoplane 3.08
Rhizosphere 81.06
Stem 0
Stem Tuber 0
Unclassified 8.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000720 3300003187 Bacteria 27528
2 Ga0055537_1000381 3300003773 Bacteria 29870
3 Ga0055534_1002984 3300003784 Bacteria 5577
4 Ga0055530_10028242 3300003791 Bacteria 1517
5 Ga0055540_1045772 3300003792 Bacteria 923
6 Ga0070680_100001224 3300005336 Bacteria 18477
7 Ga0070692_10004159 3300005345 Bacteria 5995
8 Ga0070669_100253479 3300005353 Bacteria 1402
9 Ga0070673_100087759 3300005364 Bacteria 2536
10 Ga0070659_100254824 3300005366 Bacteria 1455
11 Ga0070703_10001503 3300005406 Bacteria 6983
12 Ga0070713_100025474 3300005436 Bacteria 4625
13 Ga0070701_10125197 3300005438 Bacteria 1453
14 Ga0070705_100000049 3300005440 Bacteria 61456
15 Ga0070705_100159083 3300005440 Bacteria 1508
16 Ga0070700_100003879 3300005441 Bacteria 7765
17 Ga0070708_100017116 3300005445 Bacteria 6037
18 Ga0070663_100007554 3300005455 Bacteria 6625
19 Ga0070678_100112243 3300005456 Bacteria 2134
20 Ga0070662_100004984 3300005457 Bacteria 8439
21 Ga0070681_10002101 3300005458 Bacteria 18090
22 Ga0070706_100563043 3300005467 Bacteria 1060
23 Ga0070698_100007089 3300005471 Bacteria 12140
24 Ga0070698_100506098 3300005471 Bacteria 1146
25 Ga0070699_100000208 3300005518 Bacteria 57911
26 Ga0070695_100000921 3300005545 Bacteria 15836
27 Ga0070696_100000380 3300005546 Bacteria 27162
28 Ga0070693_100048486 3300005547 Bacteria 2419
29 Ga0070704_100000726 3300005549 Bacteria 16115
30 Ga0070704_100004718 3300005549 Bacteria 7886
31 Ga0068855_100076713 3300005563 Bacteria 3878
32 Ga0068857_100025844 3300005577 Bacteria 5171
33 Ga0070702_100082460 3300005615 Bacteria 1929
34 Ga0068859_100004962 3300005617 Bacteria 13515
35 Ga0068859_100230730 3300005617 Bacteria 1939
36 Ga0068864_100055899 3300005618 Bacteria 3409
37 Ga0068861_100127337 3300005719 Bacteria 2062
38 Ga0068863_100173946 3300005841 Bacteria 2066
39 Ga0068858_100157807 3300005842 Bacteria 2135
40 Ga0068860_100001868 3300005843 Bacteria 22381
41 Ga0068862_100001305 3300005844 Bacteria 23208
42 Ga0070717_10000031 3300006028 Bacteria 139394
43 Ga0070717_10044643 3300006028 Bacteria 3621
44 Ga0075365_10458898 3300006038 Bacteria 900
45 Ga0075362_10027003 3300006177 Bacteria 2456
46 Ga0075428_100031677 3300006844 Bacteria 5842
47 Ga0075428_100143023 3300006844 Bacteria 2600
48 Ga0075430_100015068 3300006846 Bacteria 6578
49 Ga0075431_100039856 3300006847 Bacteria 4840
50 Ga0075429_100001869 3300006880 Bacteria 17432
51 Ga0075436_100009711 3300006914 Bacteria 6583
52 Ga0097620_100004962 3300006931 Bacteria 13515
53 Ga0097620_100230743 3300006931 Bacteria 1939
54 Ga0114129_10071182 3300009147 Bacteria 4849
55 Ga0105243_10341309 3300009148 Bacteria 1372
56 Ga0105249_10002579 3300009553 Bacteria 15685
57 Ga0105249_10273023 3300009553 Bacteria 1685
58 Ga0157370_10867065 3300013104 Bacteria 820
59 Ga0157372_11245609 3300013307 Bacteria 859
60 Ga0157375_11120174 3300013308 Bacteria 922
61 Ga0182008_10008302 3300014497 Bacteria 5676
62 Ga0182006_1092285 3300015261 Bacteria 1087
63 Ga0182007_10003424 3300015262 Bacteria 7474
64 Ga0182005_1013986 3300015265 Bacteria 2251
65 Ga0183362_10009 3300015683 Bacteria 154236
66 Ga0163161_10028138 3300017792 Bacteria 3990
67 Ga0209673_1051278 3300025273 Bacteria 1090
68 Ga0209130_1022606 3300025284 Bacteria 1399
69 Ga0209675_1004227 3300025291 Bacteria 6475
70 Ga0209025_1010423 3300025294 Bacteria 6295
71 Ga0209050_1041470 3300025298 Bacteria 1269
72 Ga0209051_1026496 3300025303 Bacteria 2335
73 Ga0209257_1020929 3300025304 Bacteria 2397
74 Ga0207653_10001724 3300025885 Bacteria 6986
75 Ga0207688_10387222 3300025901 Bacteria 865
76 Ga0207707_10007257 3300025912 Bacteria 9645
77 Ga0207662_10159476 3300025918 Bacteria 1440
78 Ga0207646_10117012 3300025922 Bacteria 2394
79 Ga0207700_10061345 3300025928 Bacteria 2851
80 Ga0207664_10129116 3300025929 Bacteria 2126
81 Ga0207706_10064687 3300025933 Bacteria 3220
82 Ga0207709_10079164 3300025935 Bacteria 2112
83 Ga0207679_10368313 3300025945 Bacteria 1257
84 Ga0207712_10008555 3300025961 Bacteria 6471
85 Ga0207703_10078040 3300026035 Bacteria 2751
86 Ga0207678_10007748 3300026067 Bacteria 9488
87 Ga0207678_10311474 3300026067 Bacteria 1354
88 Ga0207708_10000469 3300026075 Bacteria 31148
89 Ga0207708_10353718 3300026075 Bacteria 1206
90 Ga0207641_10154609 3300026088 Bacteria 2080
91 Ga0207648_10177315 3300026089 Bacteria 1885
92 Ga0207648_10294374 3300026089 Bacteria 1454
93 Ga0207676_10011388 3300026095 Bacteria 6357
94 Ga0207674_10003556 3300026116 Bacteria 19017
95 Ga0207675_100077331 3300026118 Bacteria 3117
96 Ga0209983_1007910 3300027665 Bacteria 2175
97 Ga0268266_10507352 3300028379 Bacteria 1152
98 Ga0268265_10002635 3300028380 Bacteria 13323
99 Ga0268264_10001571 3300028381 Bacteria 21185
100 Ga0265318_10007311 3300028577 Bacteria 5003
101 Ga0307517_10009641 3300028786 Bacteria 13656
102 Ga0265330_10054626 3300031235 Bacteria 1746
103 Ga0265339_10009965 3300031249 Bacteria 5929
104 Ga0316579_10076886 3300031691 Bacteria 1587
105 Ga0316578_10037237 3300031728 Bacteria 2802
106 Ga0307516_10397929 3300031730 Bacteria 1037
107 Ga0316583_10003327 3300032133 Bacteria 5660
108 Ga0373950_0020380 3300034818 Bacteria 1166
109 Ga0373923_0006325 3300035111 Bacteria 4086
110 Ga0373923_0109118 3300035111 Bacteria 1227
111 Ga0373937_0024238 3300036401 Bacteria 5470
112 Ga0316584_0024080 3300036712 Bacteria 4453
113 Ga0373925_0149709 3300037068 Bacteria 1832
114 Ga0373925_0233930 3300037068 Bacteria 1470
115 Ga0395899_0065780 3300037312 Bacteria 2664
116 Ga0395900_0000021 3300037418 Bacteria 351144
117 Ga0395900_0002772 3300037418 Bacteria 19155
118 Ga0395898_0003463 3300037466 Bacteria 17637
119 Ga0395898_0004101 3300037466 Bacteria 15975
120 Ga0395905_0006047 3300037471 Bacteria 12257
121 Ga0395905_0006542 3300037471 Bacteria 11714
122 Ga0395905_0080301 3300037471 Bacteria 3056
123 Ga0395901_0002059 3300038443 Bacteria 20616
124 Ga0395901_0003300 3300038443 Bacteria 16243
125 Ga0400490_20818 3300038726 Bacteria 28661
126 Ga0400488_21957 3300038741 Bacteria 3908
127 Ga0400487_13295 3300039110 Bacteria 22511
128 Ga0400487_36717 3300039110 Bacteria 12210
129 Ga0436365_0473402 3300039437 Bacteria 993
130 Ga0436365_0733257 3300039437 Bacteria 1012
131 Ga0450907_018532 3300042146 Bacteria 1165
132 Ga0451577_0000137 3300042876 Bacteria 163955
133 Ga0451577_0001974 3300042876 Bacteria 25742
134 Ga0451577_0006153 3300042876 Bacteria 12056
135 Ga0451577_0009019 3300042876 Bacteria 9633
136 Ga0451577_0092460 3300042876 Bacteria 2700
137 Ga0451577_0125928 3300042876 Bacteria 2295
138 Ga0451577_0146663 3300042876 Bacteria 2122
139 Ga0451577_0183354 3300042876 Bacteria 1887
140 Ga0451577_0703071 3300042876 Bacteria 915
141 Ga0466969_0000008 3300044656 Bacteria 139607
142 Ga0453683_0021827 3300044673 Bacteria 4084
143 Ga0466966_0145392 3300044684 Bacteria 1447
144 Ga0466963_0003287 3300044694 Bacteria 9213
145 Ga0453684_0000014 3300044712 Bacteria 993311
146 Ga0453684_0000158 3300044712 Bacteria 302033
147 Ga0453684_0000384 3300044712 Bacteria 181189
148 Ga0453684_0005966 3300044712 Bacteria 23618
149 Ga0453684_0072515 3300044712 Bacteria 4347
150 Ga0453684_0190230 3300044712 Bacteria 2401
151 Ga0453684_0431346 3300044712 Bacteria 1470
152 Ga0453684_0574805 3300044712 Bacteria 1238
153 Ga0466971_0138717 3300044719 Bacteria 1132
154 Ga0466970_0215162 3300044765 Bacteria 1071
155 Ga0451576_0000169 3300045051 Bacteria 164329
156 Ga0451576_0000799 3300045051 Bacteria 61576
157 Ga0451576_0005410 3300045051 Bacteria 16029
158 Ga0451576_0020603 3300045051 Bacteria 7176
159 Ga0451576_0036410 3300045051 Bacteria 5217
160 Ga0451576_0055629 3300045051 Bacteria 4139
161 Ga0451576_0134532 3300045051 Bacteria 2577
162 Ga0451576_0172364 3300045051 Bacteria 2259
163 Ga0451576_0393225 3300045051 Bacteria 1453
164 Ga0451576_0686783 3300045051 Bacteria 1075
165 Ga0466958_0016018 3300045836 Bacteria 4310
166 Ga0495592_0062700 3300046454 Bacteria 2728
167 Ga0495639_0023120 3300046475 Bacteria 2730
168 Ga0495618_0106066 3300046514 Bacteria 1799
169 Ga0495628_0027269 3300046516 Bacteria 4650
170 Ga0495630_0137498 3300046517 Bacteria 1857
171 Ga0495643_0119255 3300046522 Bacteria 1335
172 Ga0495642_0123182 3300046528 Bacteria 1113
173 Ga0495587_0029943 3300046536 Bacteria 3303
174 Ga0495645_0027322 3300046543 Bacteria 4145
175 Ga0495667_0017303 3300046559 Bacteria 4869
176 Ga0495656_0000111 3300046615 Bacteria 32250
177 Ga0495668_0264467 3300046616 Bacteria 942
178 Ga0495635_0020470 3300046663 Bacteria 4608
179 Ga0495599_0029979 3300046678 Bacteria 3412
180 Ga0495600_0160991 3300046809 Bacteria 1451
181 Ga0495672_0009091 3300047320 Bacteria 7244
182 Ga0495672_0044470 3300047320 Bacteria 2664
183 Ga0495672_0222266 3300047320 Bacteria 932
184 Ga0495673_0247808 3300047469 Bacteria 651
185 Ga0495684_0014965 3300047471 Bacteria 5975
186 Ga0496102_0002027 3300048905 Bacteria 17501
187 Ga0496103_0039438 3300048906 Bacteria 2902
188 Ga0496104_0095864 3300048907 Bacteria 2838
189 Ga0496105_0257048 3300048908 Bacteria 1414
190 Ga0496106_0006849 3300048909 Bacteria 8435
191 Ga0496107_0005417 3300048910 Bacteria 8736
192 Ga0496115_0031883 3300048918 Bacteria 4155
193 Ga0496126_0361037 3300048929 Bacteria 1186
194 Ga0495682_0038361 3300049460 Bacteria 1761
195 Ga0501031_0241971 3300049568 Bacteria 1173
196 Ga0501034_0088489 3300049571 Bacteria 3095
197 Ga0501034_0156574 3300049571 Bacteria 2251
198 Ga0501036_0756929 3300049572 Bacteria 801
199 Ga0501037_0191732 3300049573 Bacteria 1447
200 Ga0501043_0283051 3300049579 Bacteria 1271
201 Ga0501047_0131929 3300049581 Bacteria 2378
202 Ga0501047_0159593 3300049581 Bacteria 2127
203 Ga0501070_0072949 3300049586 Bacteria 2841
204 Ga0501044_0072625 3300049823 Bacteria 3498
205 nmdc:mga05p37_1689_c1 3300050507 Bacteria 25685
206 nmdc:mga09592_667_c1 3300050508 Bacteria 26230
207 nmdc:mga06r32_31702_c1 3300050510 Bacteria 4967
208 nmdc:mga08x19_26784_c1 3300050514 Bacteria 3600
209 Ga0495595_0024041 3300053084 Bacteria 2688
210 Ga0495619_0112404 3300053085 Bacteria 1862
211 Ga0500616_0000028 3300053153 Bacteria 435722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047469 Ga0495673_0247808 Ga0495673_0247808_12_623 202
2 3300046809 Ga0495600_0160991 Ga0495600_0160991_12_671 218
3 3300046616 Ga0495668_0264467 Ga0495668_0264467_10_678 222
4 3300003784 Ga0055534_1002984 Ga0055534_10029846 231
5 3300003792 Ga0055540_1045772 Ga0055540_10457721 231
6 3300025273 Ga0209673_1051278 Ga0209673_10512782 231
7 3300025284 Ga0209130_1022606 Ga0209130_10226062 231
8 3300025291 Ga0209675_1004227 Ga0209675_10042272 231
9 3300025298 Ga0209050_1041470 Ga0209050_10414702 231
10 3300025303 Ga0209051_1026496 Ga0209051_10264962 231
11 3300025304 Ga0209257_1020929 Ga0209257_10209292 231
12 3300028577 Ga0265318_10007311 Ga0265318_100073115 232
13 3300042876 Ga0451577_0146663 Ga0451577_0146663_375_1076 232
14 3300044712 Ga0453684_0574805 Ga0453684_0574805_41_742 232
15 3300031691 Ga0316579_10076886 Ga0316579_100768862 233
16 3300031728 Ga0316578_10037237 Ga0316578_100372373 233
17 3300036712 Ga0316584_0024080 Ga0316584_0024080_1417_2124 233
18 3300039437 Ga0436365_0733257 Ga0436365_0733257_216_920 233
19 3300047320 Ga0495672_0044470 Ga0495672_0044470_1173_1886 233
20 3300049568 Ga0501031_0241971 Ga0501031_0241971_230_934 233
21 3300049571 Ga0501034_0088489 Ga0501034_0088489_1108_1812 233
22 3300049572 Ga0501036_0756929 Ga0501036_0756929_38_742 233
23 3300049573 Ga0501037_0191732 Ga0501037_0191732_613_1317 233
24 3300049579 Ga0501043_0283051 Ga0501043_0283051_302_1006 233
25 3300049581 Ga0501047_0131929 Ga0501047_0131929_494_1198 233
26 3300049586 Ga0501070_0072949 Ga0501070_0072949_1094_1798 233
27 3300049823 Ga0501044_0072625 Ga0501044_0072625_2744_3448 233
28 iso_pu_bacteria 2721755763 2723878597 233
29 iso_pu_bacteria 2894023352 2894024239 233
30 iso_pu_bacteria 8055266321 8055272971 233
31 3300005336 Ga0070680_100001224 Ga0070680_1000012247 235
32 3300005345 Ga0070692_10004159 Ga0070692_100041597 235
33 3300005406 Ga0070703_10001503 Ga0070703_100015035 235
34 3300005438 Ga0070701_10125197 Ga0070701_101251972 235
35 3300005440 Ga0070705_100000049 Ga0070705_10000004913 235
36 3300005441 Ga0070700_100003879 Ga0070700_1000038793 235
37 3300005445 Ga0070708_100017116 Ga0070708_1000171164 235
38 3300005455 Ga0070663_100007554 Ga0070663_1000075543 235
39 3300005458 Ga0070681_10002101 Ga0070681_100021012 235
40 3300005467 Ga0070706_100563043 Ga0070706_1005630431 235
41 3300005471 Ga0070698_100506098 Ga0070698_1005060981 235
42 3300005518 Ga0070699_100000208 Ga0070699_10000020818 235
43 3300005545 Ga0070695_100000921 Ga0070695_1000009218 235
44 3300005546 Ga0070696_100000380 Ga0070696_10000038019 235
45 3300005547 Ga0070693_100048486 Ga0070693_1000484862 235
46 3300005549 Ga0070704_100000726 Ga0070704_1000007267 235
47 3300005563 Ga0068855_100076713 Ga0068855_1000767134 235
48 3300005577 Ga0068857_100025844 Ga0068857_1000258447 235
49 3300005615 Ga0070702_100082460 Ga0070702_1000824602 235
50 3300005617 Ga0068859_100004962 Ga0068859_10000496211 235
51 3300005618 Ga0068864_100055899 Ga0068864_1000558994 235
52 3300005719 Ga0068861_100127337 Ga0068861_1001273372 235
53 3300005841 Ga0068863_100173946 Ga0068863_1001739462 235
54 3300005842 Ga0068858_100157807 Ga0068858_1001578072 235
55 3300005843 Ga0068860_100001868 Ga0068860_10000186814 235
56 3300005844 Ga0068862_100001305 Ga0068862_10000130512 235
57 3300006028 Ga0070717_10000031 Ga0070717_10000031138 235
58 3300006177 Ga0075362_10027003 Ga0075362_100270032 235
59 3300006844 Ga0075428_100143023 Ga0075428_1001430233 235
60 3300006931 Ga0097620_100004962 Ga0097620_1000049626 235
61 3300009148 Ga0105243_10341309 Ga0105243_103413092 235
62 3300009553 Ga0105249_10002579 Ga0105249_1000257911 235
63 3300025294 Ga0209025_1010423 Ga0209025_10104233 235
64 3300025885 Ga0207653_10001724 Ga0207653_100017244 235
65 3300025901 Ga0207688_10387222 Ga0207688_103872222 235
66 3300025912 Ga0207707_10007257 Ga0207707_100072572 235
67 3300025918 Ga0207662_10159476 Ga0207662_101594762 235
68 3300025933 Ga0207706_10064687 Ga0207706_100646873 235
69 3300025935 Ga0207709_10079164 Ga0207709_100791642 235
70 3300025945 Ga0207679_10368313 Ga0207679_103683132 235
71 3300025961 Ga0207712_10008555 Ga0207712_100085557 235
72 3300026035 Ga0207703_10078040 Ga0207703_100780402 235
73 3300026067 Ga0207678_10007748 Ga0207678_1000774810 235
74 3300026075 Ga0207708_10000469 Ga0207708_1000046918 235
75 3300026075 Ga0207708_10353718 Ga0207708_103537182 235
76 3300026088 Ga0207641_10154609 Ga0207641_101546092 235
77 3300026095 Ga0207676_10011388 Ga0207676_100113888 235
78 3300026116 Ga0207674_10003556 Ga0207674_1000355610 235
79 3300026118 Ga0207675_100077331 Ga0207675_1000773312 235
80 3300028380 Ga0268265_10002635 Ga0268265_1000263512 235
81 3300028381 Ga0268264_10001571 Ga0268264_1000157113 235
82 3300031235 Ga0265330_10054626 Ga0265330_100546261 235
83 3300037418 Ga0395900_0002772 Ga0395900_0002772_10703_11419 235
84 3300037466 Ga0395898_0003463 Ga0395898_0003463_10736_11452 235
85 3300037471 Ga0395905_0006542 Ga0395905_0006542_3845_4561 235
86 3300037471 Ga0395905_0080301 Ga0395905_0080301_1669_2385 235
87 3300038443 Ga0395901_0002059 Ga0395901_0002059_13425_14141 235
88 3300042876 Ga0451577_0703071 Ga0451577_0703071_47_763 235
89 3300045051 Ga0451576_0172364 Ga0451576_0172364_667_1383 235
90 3300047320 Ga0495672_0222266 Ga0495672_0222266_26_742 235
91 3300048905 Ga0496102_0002027 Ga0496102_0002027_137_847 235
92 3300048906 Ga0496103_0039438 Ga0496103_0039438_1983_2693 235
93 3300048907 Ga0496104_0095864 Ga0496104_0095864_200_910 235
94 3300048909 Ga0496106_0006849 Ga0496106_0006849_4414_5124 235
95 3300048910 Ga0496107_0005417 Ga0496107_0005417_5439_6149 235
96 3300048918 Ga0496115_0031883 Ga0496115_0031883_1241_1951 235
97 3300048929 Ga0496126_0361037 Ga0496126_0361037_249_965 235
98 3300049460 Ga0495682_0038361 Ga0495682_0038361_650_1372 235
99 3300049581 Ga0501047_0159593 Ga0501047_0159593_59_775 235
100 3300005440 Ga0070705_100159083 Ga0070705_1001590832 236
101 3300005617 Ga0068859_100230730 Ga0068859_1002307302 236
102 3300006931 Ga0097620_100230743 Ga0097620_1002307432 236
103 3300009553 Ga0105249_10273023 Ga0105249_102730233 236
104 3300013308 Ga0157375_11120174 Ga0157375_111201741 236
105 3300025922 Ga0207646_10117012 Ga0207646_101170122 236
106 3300026067 Ga0207678_10311474 Ga0207678_103114742 236
107 3300035111 Ga0373923_0006325 Ga0373923_0006325_2810_3541 236
108 3300035111 Ga0373923_0109118 Ga0373923_0109118_83_814 236
109 3300036401 Ga0373937_0024238 Ga0373937_0024238_3092_3823 236
110 3300045051 Ga0451576_0020603 Ga0451576_0020603_2759_3523 236
111 iso_pu_bacteria 2617270889 2617916814 236
112 iso_pu_bacteria 2848694841 2848702072 236
113 iso_pu_bacteria 2886627955 2886629676 236
114 iso_pu_bacteria 2913844669 2913848016 236
115 iso_pu_bacteria 2913912277 2913915724 236
116 iso_pu_bacteria 2913939268 2913943388 236
117 iso_pu_bacteria 642555144 642604024 236
118 3300006038 Ga0075365_10458898 Ga0075365_104588981 237
119 3300025929 Ga0207664_10129116 Ga0207664_101291162 237
120 3300026089 Ga0207648_10294374 Ga0207648_102943742 237
121 3300031249 Ga0265339_10009965 Ga0265339_100099655 237
122 3300039437 Ga0436365_0473402 Ga0436365_0473402_137_898 237
123 3300053153 Ga0500616_0000028 Ga0500616_0000028_36813_37538 237
124 3300005366 Ga0070659_100254824 Ga0070659_1002548241 238
125 3300005436 Ga0070713_100025474 Ga0070713_1000254743 238
126 3300006028 Ga0070717_10044643 Ga0070717_100446432 238
127 3300025928 Ga0207700_10061345 Ga0207700_100613453 238
128 3300034818 Ga0373950_0020380 Ga0373950_0020380_409_1125 238
129 3300044694 Ga0466963_0003287 Ga0466963_0003287_2998_3729 238
130 3300045836 Ga0466958_0016018 Ga0466958_0016018_2988_3719 238
131 3300046454 Ga0495592_0062700 Ga0495592_0062700_105_845 238
132 3300046514 Ga0495618_0106066 Ga0495618_0106066_1037_1777 238
133 3300046516 Ga0495628_0027269 Ga0495628_0027269_1600_2340 238
134 3300046517 Ga0495630_0137498 Ga0495630_0137498_49_789 238
135 3300046536 Ga0495587_0029943 Ga0495587_0029943_1076_1816 238
136 3300046543 Ga0495645_0027322 Ga0495645_0027322_1965_2705 238
137 3300046559 Ga0495667_0017303 Ga0495667_0017303_3225_3965 238
138 3300046663 Ga0495635_0020470 Ga0495635_0020470_2347_3087 238
139 3300046678 Ga0495599_0029979 Ga0495599_0029979_1292_2032 238
140 3300047471 Ga0495684_0014965 Ga0495684_0014965_2125_2865 238
141 3300049571 Ga0501034_0156574 Ga0501034_0156574_1114_1833 238
142 3300053084 Ga0495595_0024041 Ga0495595_0024041_1567_2307 238
143 3300053085 Ga0495619_0112404 Ga0495619_0112404_781_1521 238
144 3300006914 Ga0075436_100009711 Ga0075436_1000097116 239
145 3300048908 Ga0496105_0257048 Ga0496105_0257048_143_949 239
146 3300050514 nmdc:mga08x19_26784_c1 nmdc:mga08x19_26784_c1_2437_3156 239
147 3300005471 Ga0070698_100007089 Ga0070698_1000070898 240
148 3300005549 Ga0070704_100004718 Ga0070704_1000047186 240
149 3300006844 Ga0075428_100031677 Ga0075428_1000316774 240
150 3300006847 Ga0075431_100039856 Ga0075431_1000398563 240
151 3300006880 Ga0075429_100001869 Ga0075429_10000186918 240
152 3300009147 Ga0114129_10071182 Ga0114129_100711823 240
153 3300050507 nmdc:mga05p37_1689_c1 nmdc:mga05p37_1689_c1_1961_2689 240
154 3300050508 nmdc:mga09592_667_c1 nmdc:mga09592_667_c1_23318_24046 240
155 3300050510 nmdc:mga06r32_31702_c1 nmdc:mga06r32_31702_c1_1851_2579 240
156 3300013307 Ga0157372_11245609 Ga0157372_112456091 241
157 3300003773 Ga0055537_1000381 Ga0055537_100038119 243
158 3300003791 Ga0055530_10028242 Ga0055530_100282422 243
159 3300017792 Ga0163161_10028138 Ga0163161_100281382 243
160 3300032133 Ga0316583_10003327 Ga0316583_100033273 243
161 3300042876 Ga0451577_0000137 Ga0451577_0000137_10939_11676 243
162 3300042876 Ga0451577_0009019 Ga0451577_0009019_7638_8378 243
163 3300042876 Ga0451577_0092460 Ga0451577_0092460_640_1374 243
164 3300042876 Ga0451577_0125928 Ga0451577_0125928_147_893 243
165 3300042876 Ga0451577_0183354 Ga0451577_0183354_1124_1864 243
166 3300044656 Ga0466969_0000008 Ga0466969_0000008_7983_8744 243
167 3300044673 Ga0453683_0021827 Ga0453683_0021827_1746_2486 243
168 3300044684 Ga0466966_0145392 Ga0466966_0145392_510_1271 243
169 3300044712 Ga0453684_0000014 Ga0453684_0000014_178204_178941 243
170 3300044712 Ga0453684_0000158 Ga0453684_0000158_251744_252478 243
171 3300044712 Ga0453684_0000384 Ga0453684_0000384_58980_59717 243
172 3300044712 Ga0453684_0005966 Ga0453684_0005966_4356_5093 243
173 3300044712 Ga0453684_0072515 Ga0453684_0072515_1357_2103 243
174 3300044712 Ga0453684_0190230 Ga0453684_0190230_596_1330 243
175 3300044712 Ga0453684_0431346 Ga0453684_0431346_649_1386 243
176 3300044719 Ga0466971_0138717 Ga0466971_0138717_75_836 243
177 3300044765 Ga0466970_0215162 Ga0466970_0215162_97_858 243
178 3300045051 Ga0451576_0000169 Ga0451576_0000169_152543_153280 243
179 3300045051 Ga0451576_0005410 Ga0451576_0005410_5624_6358 243
180 3300045051 Ga0451576_0036410 Ga0451576_0036410_3443_4177 243
181 3300045051 Ga0451576_0134532 Ga0451576_0134532_1743_2477 243
182 3300045051 Ga0451576_0393225 Ga0451576_0393225_29_763 243
183 3300045051 Ga0451576_0686783 Ga0451576_0686783_101_835 243
184 3300005457 Ga0070662_100004984 Ga0070662_1000049847 244
185 3300028786 Ga0307517_10009641 Ga0307517_100096414 244
186 3300031730 Ga0307516_10397929 Ga0307516_103979292 244
187 iso_pu_bacteria 2928115317 2928116280 244
188 3300005456 Ga0070678_100112243 Ga0070678_1001122432 245
189 3300013104 Ga0157370_10867065 Ga0157370_108670651 245
190 3300014497 Ga0182008_10008302 Ga0182008_100083022 245
191 3300015261 Ga0182006_1092285 Ga0182006_10922851 245
192 3300015262 Ga0182007_10003424 Ga0182007_100034243 245
193 3300037312 Ga0395899_0065780 Ga0395899_0065780_1143_1892 245
194 3300037418 Ga0395900_0000021 Ga0395900_0000021_4004_4753 245
195 3300037466 Ga0395898_0004101 Ga0395898_0004101_11223_11972 245
196 3300037471 Ga0395905_0006047 Ga0395905_0006047_4004_4753 245
197 3300038443 Ga0395901_0003300 Ga0395901_0003300_14809_15558 245
198 iso_pu_bacteria 2932422444 2932423645 245
199 3300015683 Ga0183362_10009 Ga0183362_1000944 246
200 3300042876 Ga0451577_0001974 Ga0451577_0001974_15099_15863 246
201 3300042876 Ga0451577_0006153 Ga0451577_0006153_2175_2927 246
202 3300045051 Ga0451576_0000799 Ga0451576_0000799_13382_14134 246
203 3300046615 Ga0495656_0000111 Ga0495656_0000111_19621_20361 246
204 3300047320 Ga0495672_0009091 Ga0495672_0009091_1471_2214 247
205 3300005364 Ga0070673_100087759 Ga0070673_1000877592 248
206 3300015265 Ga0182005_1013986 Ga0182005_10139862 248
207 3300027665 Ga0209983_1007910 Ga0209983_10079102 248
208 3300028379 Ga0268266_10507352 Ga0268266_105073522 248
209 3300046475 Ga0495639_0023120 Ga0495639_0023120_1688_2434 248
210 3300046522 Ga0495643_0119255 Ga0495643_0119255_286_1032 248
211 3300046528 Ga0495642_0123182 Ga0495642_0123182_316_1062 248
212 3300003187 JGI25151J46595_10000720 JGI25151J46595_100007205 249
213 3300005353 Ga0070669_100253479 Ga0070669_1002534791 249
214 3300006846 Ga0075430_100015068 Ga0075430_1000150686 249
215 3300026089 Ga0207648_10177315 Ga0207648_101773152 249
216 3300037068 Ga0373925_0149709 Ga0373925_0149709_804_1607 249
217 3300037068 Ga0373925_0233930 Ga0373925_0233930_520_1296 249
218 3300038726 Ga0400490_20818 Ga0400490_20818_8749_9504 249
219 3300038741 Ga0400488_21957 Ga0400488_21957_1298_2053 249
220 3300039110 Ga0400487_13295 Ga0400487_13295_12312_13067 249
221 3300039110 Ga0400487_36717 Ga0400487_36717_1068_1823 249
222 3300042146 Ga0450907_018532 Ga0450907_018532_41_835 249
223 3300045051 Ga0451576_0055629 Ga0451576_0055629_3017_3769 249
224 iso_pu_bacteria 2891633521 2891633640 249
225 iso_pu_bacteria 639633007 639785424 249
226 iso_pu_bacteria 639633007 639787141 249
227 iso_pu_bacteria 639633007 639787656 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

195

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9474 1 240
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9398 1 240
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9168 4 226
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9148 4 226
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9099 6 236
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 1 238 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9591 1 238 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9424 6 239 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9365 1 240 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9326 1 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A521VCI3-F1-model_v4 Aldehyde dehydrogenase family protein 0.9796 3 238 GO:0005524
GO:0005886
GO:0016620
GO:0016887
AF-A0A3B8HPL4-F1-model_v4 ABC transporter ATP-binding protein 0.9785 146 239 GO:0005524
GO:0015658
GO:0015807
AF-A0A7V2UKX9-F1-model_v4 ABC transporter ATP-binding protein 0.9722 34 238 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9714 6 238 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A382XKN7-F1-model_v4 ABC transporter domain-containing protein 0.9714 8 219 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map